HHsearch alignment for GI: 254780456 and conserved domain: PRK12327

>PRK12327 nusA transcription elongation factor NusA; Provisional.
Probab=98.28  E-value=1.7e-05  Score=50.64  Aligned_cols=57  Identities=26%  Similarity=0.405  Sum_probs=30.3

Q ss_pred             CCCEEEEEEEEECCCEEEEEECCCCEEEEECCCCCCCCCCCCCCCEECCCCEEEEEEEEEECCCC
Q ss_conf             89665899998159669998514200000011110111355742100378457999998621550
Q gi|254780456|r  282 EGSKVSGVVTNLTDYGVFVELQSGIEGLAHISQISWTKKNIHPSKILSVGQQVEVVILEVNPARK  346 (576)
Q Consensus       282 ~G~~v~g~V~~v~~~G~~V~l~~~v~G~i~~sels~~~~~~~~~~~~~~G~~v~~~Vl~id~~~~  346 (576)
T Consensus       134 ~GeiV~G~V~r~~~~~~~Vdlg-~~ea~LP~~eq-------ip~E~~~~Gdrika~i~~V~~~~k  190 (353)
T PRK12327        134 EGDIVTGTVQRDDNRFVYVNLG-KIEAVLPPAEQ-------IPGETYKHGDRIKVYVVKVEKTTK  190 (353)
T ss_pred             CCCEEEEEEEEECCCCEEEEEC-CEEEECCHHHC-------CCCCCCCCCCEEEEEEEEEEECCC
T ss_conf             3966999999975885899978-82464687986-------998777999979999999997599