>TIGR00448 rpoE DNA-directed RNA polymerase; InterPro: IPR004519 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme . The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length . The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise: RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors. RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs. Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kD, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family seems to be confined to the archea and eukaryotic taxa and are quite dissimilar to Escherichia coli RpoE.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006350 transcription, 0005634 nucleus.

Probab=98.30  E-value=1.4e-06  Score=57.11  Aligned_cols=71  Identities=30%  Similarity=0.472  Sum_probs=38.9

Q ss_pred             CCCEEEEEEEEEEEEEEEE-ECCCCEEEEEHHHHHCCCC------------C-HHHHHHHCCCCCCEEEEEECC-----C
Q ss_conf             2213699999850169997-0688413540055300122------------0-012342111234226885215-----6
Q gi|254780456|r  370 GTEVEGEVKNKTDFGLFIG-LDEHLDGMIHLSDLDWNRP------------G-EKVIAEYAKGDIVKAVVLDID-----V  430 (576)
Q Consensus       370 G~~v~g~V~~v~~~g~~V~-l~~~i~g~i~~~dls~~~~------------~-~~~~~~~k~G~~i~~~Vl~id-----~  430 (576)
T Consensus        82 ~EiVeGev~~~~efG~fV~LlG-p~D~l~h~sq~~ddy~~YdPk~~~liGPmD~Etk~~ld~gd~vRaRIv~~slk~~~p  160 (184)
T TIGR00448        82 GEIVEGEVIEIVEFGAFVSLLG-PFDGLLHVSQVLDDYVVYDPKESALIGPMDKETKKVLDVGDKVRARIVALSLKDRRP  160 (184)
T ss_pred             EEEEEEEEEEEEECCCEEEEEC-CCCCEEEEEEEEECCEEECCCCCCEECCCCHHCCCEEECCCEEEEEEEEEEECCCCC
T ss_conf             1678658998985274267522-313234410011356366265660456740121735101675667888876404137


Q ss_pred             -CCCCCCCCHHH
Q ss_conf             -54553201132
Q gi|254780456|r  431 -GKERISLGVKQ  441 (576)
Q Consensus       431 -~~~~i~LS~K~  441 (576)
T Consensus       161 k~~~k~~LtmRq  172 (184)
T TIGR00448       161 KEGSKIGLTMRQ  172 (184)
T ss_pred             CCCCEEEEECCC
T ss_conf             888511001157