>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.42 E-value=1.2e-12 Score=94.01 Aligned_cols=66 Identities=47% Similarity=0.700 Sum_probs=31.4 Q ss_pred CCEEEEEEEEEECCEEEEEECCCEEEEEEHHHHCCCC---CCCCCCCCCEEEEEEEEEECCCCEEEEEH Q ss_conf 8779999999819989999479603678997505664---35563789879999999747998599968 Q gi|254780456|r 27 NCVTKGIVVGLEKDTVVVDVGLKFEGRIPRREFMGKG---QYTPIKVGDEVEVYVERTENSFGEAVFSR 92 (576) Q Consensus 27 G~iv~G~V~~i~~~~v~vdig~k~~G~i~~~e~~~~~---~~~~~kvGd~i~v~V~~~~~~~g~i~lS~ 92 (576) T Consensus 1 G~iV~G~V~~i~~~gv~Vdig~k~eG~ip~~E~s~~~~~~~~~~~~vGd~i~~~V~~~d~~~g~i~LS~ 69 (70) T cd05687 1 GDIVKGTVVSVDDDEVLVDIGYKSEGIIPISEFSDDPIENGEDEVKVGDEVEVYVLRVEDEEGNVVLSK 69 (70) T ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEHHHHCCCCCCCHHHCCCCCCEEEEEEEEEECCCCEEEEEC T ss_conf 998999999997886999968985026899994533238974712699999999999999999799850

HHsearch alignment for GI: 254780456 and conserved domain: cd05687