>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.42 E-value=4.3e-13 Score=96.62 Aligned_cols=70 Identities=26% Similarity=0.397 Sum_probs=41.4 Q ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEEEH Q ss_conf 987999999970890899961779849999974718212104201106898799999997057686998703 Q gi|254780456|r 459 NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIK 530 (576) Q Consensus 459 G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS~k 530 (576) T Consensus 1 G~iV~G~V~~i~~~gv~Vdig--~k~eG~ip~~E~s~~~~~~~~~~~~vGd~i~~~V~~~d~~~g~i~LS~k 70 (70) T cd05687 1 GDIVKGTVVSVDDDEVLVDIG--YKSEGIIPISEFSDDPIENGEDEVKVGDEVEVYVLRVEDEEGNVVLSKR 70 (70) T ss_pred CCEEEEEEEEEECCEEEEEEC--CCCCEEEEHHHHCCCCCCCHHHCCCCCCEEEEEEEEEECCCCEEEEECC T ss_conf 998999999997886999968--9850268999945332389747126999999999999999997998509

HHsearch alignment for GI: 254780456 and conserved domain: cd05687