>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.

Probab=99.67 E-value=9.1e-17 Score=118.89 Aligned_cols=68 Identities=44% Similarity=0.808 Sum_probs=39.5 Q ss_pred CCEEEEEEEEEECCCCEEEEC-CCEEEEEEEECCCCCCCCCCEEECCCCEEEEEEEEECCCCCEEEEEEC Q ss_conf 330246788753147177744-831578864202444443311332697258999987476527998521 Q gi|254780456|r 198 GQVIEGTVKNITDYGVFVDLS-GVDGLLHVTDIAWHRILHPSKVLSIGQQVKVKIIRINQETHRISLGMK 266 (576) Q Consensus 198 G~~v~g~V~~i~~~g~~V~~~-g~~g~i~~~~ls~~~~~~~~~~~~~G~~v~~~Vl~~d~~~~~i~lslK 266 (576) T Consensus 1 G~vv~G~V~~I~~fGaFV~l~~g~~GL~HiSeis~~~v~~~~~~~~~Gd~v~vkVi~id-~~~ri~LS~K 69 (69) T cd05692 1 GSVVEGTVTRLKPFGAFVELGGGISGLVHISQIAHKRVKDVKDVLKEGDKVKVKVLSID-ARGRISLSIK 69 (69) T ss_pred CCEEEEEEEEEECCEEEEEECCCCEEEEEHHHHCCCCCCCHHHHCCCCCEEEEEEEEEC-CCCCEEECCC T ss_conf 99999999999853899996899889999698345655798891789999999999999-9996680159

HHsearch alignment for GI: 254780456 and conserved domain: cd05692