>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=99.68 E-value=2.8e-16 Score=115.90 Aligned_cols=73 Identities=27% Similarity=0.387 Sum_probs=61.7 Q ss_pred CCCCCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEEEH Q ss_conf 478987999999970890899961779849999974718212104201106898799999997057686998703 Q gi|254780456|r 456 LRKNDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIK 530 (576) Q Consensus 456 ~~~G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS~k 530 (576) T Consensus 1 lkvG~~l~G~Vt~V~~~g~fV~L~--~~~~Glvhisel~dd~~~~~~~~~~~g~~V~v~Vl~VD~~~krI~LSlr 73 (73) T cd05706 1 LKVGDILPGRVTKVNDRYVLVQLG--NKVTGPSFITDALDDYSEALPYKFKKNDIVRACVLSVDVPNKKIALSLR 73 (73) T ss_pred CCCCCEEEEEEEEECCCEEEEEEC--CCCEEEEEHHHHCCCCCCCCHHHCCCCCEEEEEEEEEECCCCEEEEECC T ss_conf 988989999999988887999908--9947999989930460138175168999999999999888998988619

HHsearch alignment for GI: 254780456 and conserved domain: cd05706