>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=99.65 E-value=5.3e-16 Score=114.25 Aligned_cols=68 Identities=28% Similarity=0.499 Sum_probs=58.4 Q ss_pred CCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEE Q ss_conf 9879999999708908999617798499999747182121042011068987999999970576869987 Q gi|254780456|r 459 NDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLS 528 (576) Q Consensus 459 G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS 528 (576) T Consensus 1 G~~v~G~V~~i~~~G~FV~l~--~~~~glVhiselsd~fVkd~~~~f~vGq~V~~kV~~iD~~~~ri~LS 68 (68) T cd05707 1 GDVVRGFVKNIANNGVFVTLG--RGVDARVRVSELSDSYLKDWKKRFKVGQLVKGKIVSIDPDNGRIEMT 68 (68) T ss_pred CCEEEEEEEEECCCCEEEEEC--CCCEEEEEHHHHCHHHHCCHHHHCCCCCEEEEEEEEEECCCCEEECC T ss_conf 999899999803640799917--99679999599172356499891799999999999982875867359

HHsearch alignment for GI: 254780456 and conserved domain: cd05707