>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.

Probab=99.75 E-value=3.3e-18 Score=127.58 Aligned_cols=73 Identities=22% Similarity=0.365 Sum_probs=35.8 Q ss_pred CCCEEEEEEEEEECCEEEEEECCCCCEEEEEEHHHCCHHHHCCCHHHCCCCCEEEEEEEEECCCCCEEEEEEHH Q ss_conf 89879999999708908999617798499999747182121042011068987999999970576869987036 Q gi|254780456|r 458 KNDVVSCEVISVSEGGIEVSLIDHKGINSFIRRSDLSRDRVDQDPGRFSKGQIVDACVVNVSKKDGKVSLSIKA 531 (576) Q Consensus 458 ~G~iv~g~V~~v~~~G~~V~l~~~~gv~G~i~~s~is~~~~~~~~~~~~vG~~v~~~Vi~id~~~~ri~LS~k~ 531 (576) T Consensus 2 VG~~v~G~V~~i~~fG~FV~l~-g~~i~GLvHiSels~~~~~~~~~~~~~Gd~V~vkVl~iD~e~~rI~LSiKa 74 (77) T cd05708 2 VGQKIDGTVRRVEDYGVFIDID-GTNVSGLCHKSEISDNRVADASKLFRVGDKVRAKVLKIDAEKKRISLGLKA 74 (77) T ss_pred CCCEEEEEEEEEECEEEEEEEC-CCCEEEEEEHHHHCCCCCCCHHHHCCCCCEEEEEEEEEECCCCEEEEEEEC T ss_conf 9899999999996417899967-898079988788175656898891689999999999998999999989841

HHsearch alignment for GI: 254780456 and conserved domain: cd05708