RPSBLAST alignment for GI: 254780456 and conserved domain: cd04465
>gnl|CDD|88430 cd04465, S1_RPS1_repeat_ec2_hs2, S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain.While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 2 of the Escherichia coli and Homo sapiens RPS1 (ec2 and hs2, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 67
Score = 38.9 bits (91), Expect = 0.004
Identities = 19/66 (28%), Positives = 35/66 (53%), Gaps = 2/66 (3%)
Query: 198 GQVIEGTVKNITDYGVFVDLSGVDGLLHVTDIAWHRILHPSKVLSIGQQVKVKIIRINQE 257
G+++EG V G+ VD+ GV L + + + + +G+++K KII I++E
Sbjct: 1 GEIVEGKVTEKVKGGLIVDIEGVRAFLPASQVDLRPVEDLDEY--VGKELKFKIIEIDRE 58
Query: 258 THRISL 263
+ I L
Sbjct: 59 RNNIVL 64