RPSBLAST alignment for GI: 254780456 and conserved domain: cd05692

>gnl|CDD|88447 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 69
 Score = 61.4 bits (149), Expect = 6e-10
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 2/70 (2%)

Query: 198 GQVIEGTVKNITDYGVFVDL-SGVDGLLHVTDIAWHRILHPSKVLSIGQQVKVKIIRINQ 256
           G V+EGTV  +  +G FV+L  G+ GL+H++ IA  R+     VL  G +VKVK++ I+ 
Sbjct: 1   GSVVEGTVTRLKPFGAFVELGGGISGLVHISQIAHKRVKDVKDVLKEGDKVKVKVLSIDA 60

Query: 257 ETHRISLGMK 266
              RISL +K
Sbjct: 61  RG-RISLSIK 69