RPSBLAST alignment for GI: 254780456 and conserved domain: cd05692

>gnl|CDD|88447 cd05692, S1_RPS1_repeat_hs4, S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.. Length = 69
 Score = 59.9 bits (145), Expect = 2e-09
 Identities = 32/71 (45%), Positives = 42/71 (59%), Gaps = 2/71 (2%)

Query: 283 GSKVSGVVTNLTDYGVFVELQSGIEGLAHISQISWTKKNIHPSKILSVGQQVEVVILEVN 342
           GS V G VT L  +G FVEL  GI GL HISQI+  +       +L  G +V+V +L ++
Sbjct: 1   GSVVEGTVTRLKPFGAFVELGGGISGLVHISQIAHKRVK-DVKDVLKEGDKVKVKVLSID 59

Query: 343 PARKRISLGLK 353
             R RISL +K
Sbjct: 60  A-RGRISLSIK 69