>gnl|CDD|88452 cd05697, S1_Rrp5_repeat_hs5, S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 5 (hs5) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.. Length = 69

 Score = 40.5 bits (95), Expect = 0.001
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 7/71 (9%)

Query: 370 GTEVEGEVKNKTDFGLFIGLDEHLDGMI---HLSDLDWNRPGEKVIAEYAKGDIVKAVVL 426
           G  V+G ++     G+F+ L +H+ G++   HL+D+    P +K    +  G  VK  VL
Sbjct: 1   GQVVKGTIRKLRPSGIFVKLSDHIKGLVPPMHLADVRLKHPEKK----FKPGLKVKCRVL 56

Query: 427 DIDVGKERISL 437
            ++  ++R+ L
Sbjct: 57  SVEPERKRLVL 67