RPSBLAST alignment for GI: 254780456 and conserved domain: cd05708

>gnl|CDD|88463 cd05708, S1_Rrp5_repeat_sc12, S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.. Length = 77
 Score = 57.2 bits (138), Expect = 1e-08
 Identities = 28/72 (38%), Positives = 45/72 (62%), Gaps = 2/72 (2%)

Query: 370 GTEVEGEVKNKTDFGLFIGLD-EHLDGMIHLSDLDWNRPGEKVIAEYAKGDIVKAVVLDI 428
           G +++G V+   D+G+FI +D  ++ G+ H S++  NR  +     +  GD V+A VL I
Sbjct: 3   GQKIDGTVRRVEDYGVFIDIDGTNVSGLCHKSEISDNRVAD-ASKLFRVGDKVRAKVLKI 61

Query: 429 DVGKERISLGVK 440
           D  K+RISLG+K
Sbjct: 62  DAEKKRISLGLK 73