>pfam06309 Torsin Torsin. This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterized by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of (pfam00004) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia.

Probab=95.68  E-value=0.015  Score=36.12  Aligned_cols=30  Identities=17%  Similarity=0.358  Sum_probs=27.0

Q ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             655588189866687789678999999981
Q gi|254780457|r    3 RLESQSIIIAIDGTAAAGKGVLSRFIALEY   32 (217)
Q Consensus         3 ~~~~k~~iIaIDGpagsGKsT~ak~lA~~l   32 (217)
T Consensus        48 ~~p~KpLVlSfHG~tGtGKn~vs~liA~~L   77 (127)
T pfam06309        48 PKPRKPLVLSFHGWTGTGKNFVAEIIADNL   77 (127)
T ss_pred             CCCCCCEEEEECCCCCCCHHHHHHHHHHHH
T ss_conf             999997488701899987989999999998