HHsearch alignment for GI: 254780458 and conserved domain: PRK02427

>PRK02427 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional.
Probab=100.00  E-value=0  Score=740.94  Aligned_cols=410  Identities=36%  Similarity=0.586  Sum_probs=379.0

Q ss_pred             EECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCEEEEEECCCCCCCCCC
Q ss_conf             70688536999818422289999999974498499977980289999999999849799998998999812688756853
Q gi|254780458|r   12 SSYSCGLQGTICIPGDRSLSHFSIILGGIAAGETQIRGVLESDDVLNTMRMMHYLGARFTKKDREWIVQGVGNGCLLSPE   91 (449)
Q Consensus        12 ~~~~~~L~G~i~vp~SKs~s~RaLl~AaLa~g~s~i~n~~~s~Dv~~~l~al~~LG~~i~~~~~~~~i~g~g~~~~~~~~   91 (449)
T Consensus         7 ~i~ps~l~G~i~ipgSKs~s~Rali~AaLa~g~s~i~n~~~~~Dv~~~~~~l~~lG~~i~~~~~~~~i~~~~~~~~~~~~   86 (424)
T PRK02427          7 PISPSPLKGTVRVPGSKSISHRALLLAALAEGETTITNLLDSEDTLATLEALRALGARIEEDGDELEVEGVGLGGLKEPE   86 (424)
T ss_pred             EECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCC
T ss_conf             23289867899748828999999999997699899905890399999999999879989994999999827877766872


Q ss_pred             CEEEECCCCCCCCEEEEECCCCCCEEEECCCCCCCCCCCCCEEEEEEECCCCEEECCC-CCCCCEEECCCCCCCEEEEEC
Q ss_conf             1055033333220013431455310331233333446542101012312741010134-322201202221111134302
Q gi|254780458|r   92 YPLDFKGFDMGYGLMMGVVGVYDFQTFFKGRAEILQPTIESLLAPLYQMGVQVKLPED-KRLPLVLHGPRTPNPIVYKSP  170 (449)
Q Consensus        92 ~~i~~~~sgt~~r~l~~~l~~~~~~~~i~G~~~l~~Rpi~~li~~L~~lGa~i~~~~~-~~~Pi~I~g~~~~~~~~~~~~  170 (449)
T Consensus        87 ~~i~~g~SGt~~R~l~~lla~~~~~~~l~G~~~l~~RPi~~l~~~L~~lGa~i~~~~~~~~lP~~i~g~~~~~~~~i~~~  166 (424)
T PRK02427         87 AVLDCGNSGTTMRLLAGLLALQPGEVVLTGDESLRKRPMGRLVDPLRQMGAKIEGREEGYRLPLTIRGPKKGGPIEYDGP  166 (424)
T ss_pred             CEEECCCCCCCHHHHHHHHHCCCCEEEEECCHHHCCCCCHHHHHHHHHCCCEEEECCCCEEEEEEEECCCCCCCEEEECC
T ss_conf             20551466441776767752689569997870105787106899999779999965784354357674777765799226


Q ss_pred             CCCCCCCCEEHHHHHCCCCCCCCCCCCCCCCHHHH---HHHHCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             34443320000000000112223465454424444---665449734441133310026752865102332002321122
Q gi|254780458|r  171 MDSVQSKSVVLLAGLNTPGITEVIEPVKTQDHMEI---ILKEFGVDLLIKSDTIEDYSVRIEGRKRISGCNLKIPGDSSI  247 (449)
Q Consensus       171 ~~S~q~~s~lLlA~~~~~g~t~i~~~~~s~~~i~~---~L~~fG~~i~~~~~~~~~~~i~i~g~~~l~~~~~~Ip~D~ss  247 (449)
T Consensus       167 ~sSq~vs~lll~A~l~~~g~t~i~~~~~s~pyi~~T~~~L~~~G~~I~~~~----~~~i~I~g~~~l~~~~~~V~~D~s~  242 (424)
T PRK02427        167 VSSQFVKSLLLLAPLAAEGTTIVIEPLPSRPHTEITLRMLRAFGVEVDDVD----GRRFTVKGGQRLKGPDITVPGDISS  242 (424)
T ss_pred             CCCHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHCCCEEEECC----CCEEEECCCCCCCCCCCCCCCCHHH
T ss_conf             575755434552132279707981576773679999999986896499628----8199977875446655769989889


Q ss_pred             HHHCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCHHCCCCCCCCCCCCEEEEECCCCCEEEEEECCCCCCCCCCCCCCCH
Q ss_conf             10000011225565322233323222222--2100000134323444227870343202564202333234644354301
Q gi|254780458|r  248 AFFPLAAALLIPGSDIKLLNVLTNPLRVG--IIDILREMGADITLSNSRIESGENIADIRVRFSKIKGITISDNRLRSIV  325 (449)
Q Consensus       248 Aa~~la~a~l~~g~~i~i~n~~~~~~q~~--~ldiL~~mG~~i~~~~~~~~~~~~~~~i~~~~~~l~g~~i~~~~~~~~~  325 (449)
T Consensus       243 A~~~l~aaal~~g~~i~i~~~~~~~~q~d~~~l~iL~~mGa~i~~~~~~~~~~-------~~~~~L~~i~id---~~~~p  312 (424)
T PRK02427        243 AAFFLAAAAITPGSEVTITNVGLNPTQGGKAILDVLEKMGADIEWGDDREEGE-------PVSGELKGIDID---IPDII  312 (424)
T ss_pred             HHHHHHHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHCCCEEEEECCEEEEE-------ECCCCCCCEEEC---CCCCC
T ss_conf             99999999975898699917776656551899999998699899947807997-------548887647833---88896


Q ss_pred             HHCCCCCCCCCCCCCCCCCCCCHHH--HHHHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCCCCCCCEEECCCCHH
Q ss_conf             1101112322223474100272001--24568999999997469789998895999767887666656872660488458
Q gi|254780458|r  326 DEYPILLVISAFAEGETIIKGLAEV--MTSKQFSGIIECFNINNIQYEREGDYLMIKGVPGGKGLGCSTGHMVQSKFGYR  403 (449)
Q Consensus       326 D~~p~Lavla~~a~G~t~i~gi~~l--kesdRi~~~~~~L~~~G~~~~~~~d~l~I~G~~~~~~~~~~~~~~v~s~~DHR  403 (449)
T Consensus       313 Dl~p~la~la~~a~G~s~i~~i~~lR~KESdRi~~~~~eL~k~G~~i~~~~d~l~I~G~~--------~g~~v~s~~DhR  384 (424)
T PRK02427        313 DEAPTLAVLAAFAEGTTVIRNAEELRVKETDRIAAMATELRKLGAEVEETEDGLIITGPL--------GGAVVDSYGDHR  384 (424)
T ss_pred             CHHHHHHHHHHHCCCCCEEECCHHHCCCCCHHHHHHHHHHHHCCCEEEEECCEEEEECCC--------CCCEEECCCCHH
T ss_conf             078999999983899836852134114013079999999997799899969969997889--------886676898789


Q ss_pred             HHHHHHHHHHHCCCCEEEECCCEECCCCCCHHHHHHHCCCE
Q ss_conf             99999999973599589944543027786988899865978
Q gi|254780458|r  404 VAMSFLVMGLASEYSVVVDDYTMISTIFPDFINLMKTLGAR  444 (449)
Q Consensus       404 iaMa~~i~gl~~~~~~~I~~~~~v~ksyP~F~~~l~~LGa~  444 (449)
T Consensus       385 iama~~ia~l~~~g-~~I~~~~~v~ksyp~F~~~l~~LGA~  424 (424)
T PRK02427        385 IAMAFAIAGLLASP-VTIDDPECVAKSFPDFFELLASLGAN  424 (424)
T ss_pred             HHHHHHHHHHCCCC-EEEECCCEEECCCHHHHHHHHHCCCC
T ss_conf             99999999981799-79937553768655199999974999