RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780459|ref|YP_003064872.1| hypothetical protein CLIBASIA_01720 [Candidatus Liberibacter asiaticus str. psy62] (129 letters) >gnl|CDD|34179 COG4530, COG4530, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 129 Score = 51.9 bits (124), Expect = 4e-08 Identities = 51/117 (43%), Positives = 69/117 (58%), Gaps = 4/117 (3%) Query: 1 MAKPELGTKRTCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPT---SPEKEKEICSLE 57 MAKPELGTKR P+TGK+FYDLN+ IVSPYT S+P +YFE T + E+E+E E Sbjct: 1 MAKPELGTKRIDPETGKKFYDLNRDPIVSPYTGKSYPRSYFEETTPDAAAEEEEEEVVKE 60 Query: 58 EETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTD 114 + E + V+ S E+ + +D L + ++D DDDD FLE + D D Sbjct: 61 VDAENEE-VEVVSLEDADDDPKGGDDLPDLGDDEDVDLDDDDDDTFLEDEEDDDDDV 116 >gnl|CDD|35517 KOG0296, KOG0296, KOG0296, Angio-associated migratory cell protein (contains WD40 repeats) [Function unknown]. Length = 399 Score = 31.1 bits (70), Expect = 0.085 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 3/52 (5%) Query: 71 EEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISI 122 EEEE +EDD + +M +E + + DD+ D D + VDMD S+ Sbjct: 9 EEEEVEEEILDEDDVAQEMVVDEEDENEQDDE---MMDDDEEALEVDMDDSL 57 >gnl|CDD|37043 KOG1832, KOG1832, KOG1832, HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]. Length = 1516 Score = 29.7 bits (66), Expect = 0.24 Identities = 16/58 (27%), Positives = 25/58 (43%) Query: 71 EEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDADE 128 E+E+E +++ D +E DDD + D +D D + DI I D E Sbjct: 1416 EDEDEDDDEEDDLDRDDGLEGDNSDSGDDDLSSEDNEDEVSDEDGDEADILIDGDFME 1473 Score = 28.5 bits (63), Expect = 0.57 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 8/63 (12%) Query: 67 KHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIPDDA 126 + T ++ +E EEDD + D + + + D D D + D ++D D D+S D+ Sbjct: 1401 RPTDDDSDE-----EEDDETEDEDEDDDEEDDLDRDDGLEGD---NSDSGDDDLSSEDNE 1452 Query: 127 DEN 129 DE Sbjct: 1453 DEV 1455 Score = 27.8 bits (61), Expect = 1.0 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 2/59 (3%) Query: 71 EEEEESPISKEEDDTSLDMEYVQEMDLDD--DDDFLEQNDTDTDTDVVDMDISIPDDAD 127 ++E E ++++ LD + E D D DDD +++ D +D + I D D Sbjct: 1412 DDETEDEDEDDDEEDDLDRDDGLEGDNSDSGDDDLSSEDNEDEVSDEDGDEADILIDGD 1470 >gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only]. Length = 4600 Score = 28.5 bits (63), Expect = 0.55 Identities = 19/90 (21%), Positives = 40/90 (44%), Gaps = 15/90 (16%) Query: 44 PTSPE-KEKEICSLEEETE----VKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLD 98 + E K+++ EEE + ++ +E P + ED ++ +++ LD Sbjct: 3942 NKALEDKDRQEKEDEEEMSDDVGIDDEIQPDIQENNSQPPPENED-----LDLPEDLKLD 3996 Query: 99 DDDDFLEQNDTDTDTDVVDMDISIPDDADE 128 + ++ D D+D+ DMD+ D+ E Sbjct: 3997 E-----KEGDVSKDSDLEDMDMEAADENKE 4021 >gnl|CDD|37551 KOG2340, KOG2340, KOG2340, Uncharacterized conserved protein [Function unknown]. Length = 698 Score = 28.4 bits (63), Expect = 0.58 Identities = 19/84 (22%), Positives = 31/84 (36%), Gaps = 1/84 (1%) Query: 47 PEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLE- 105 + E S E +V + H S+ +E S + +D D E +E D D E Sbjct: 12 SSAKPEGGSTETLEDVASDIDHRSDMDEVSDVESGDDFDIEDEEGKKEKVDDKSDHSEEK 71 Query: 106 QNDTDTDTDVVDMDISIPDDADEN 129 + V + + +D EN Sbjct: 72 ERRRKAIESVNNAPAEVGEDEKEN 95 Score = 26.5 bits (58), Expect = 2.2 Identities = 18/87 (20%), Positives = 33/87 (37%), Gaps = 12/87 (13%) Query: 49 KEKEICSLEE-ETEVKPFVKHTSEEEEESPISK--------EEDDTSLDMEYVQEMDLDD 99 + K I S+ EV K +EE+++ I K +DD +L + D + Sbjct: 74 RRKAIESVNNAPAEVGEDEKENTEEDDQLEIPKRKLKNHESTDDDETLIEKKN---DNES 130 Query: 100 DDDFLEQNDTDTDTDVVDMDISIPDDA 126 +D F D + + + I+ Sbjct: 131 EDPFWSHFDDELGSKHIADLIARTKTT 157 >gnl|CDD|48537 cd02988, Phd_like_VIAF, Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis. It was identified as an IAP binding protein through a screen of a human B-cell library using a prototype IAP. VIAF lacks a consensus IAP binding motif and while it does not function as an IAP antagonist, it still plays a regulatory role in the complete activation of caspases. VIAF itself is a substrate for IAP-mediated ubiquitination, suggesting that it may be a target of IAPs in the prevention of cell death. The similarity of VIAF to Phd points to a potential role distinct from apoptosis regulation. Phd functions as a cytosolic regulator of G protein by specifically binding to G protein betagamma (Gbg)-subunits. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.. Length = 192 Score = 27.9 bits (62), Expect = 0.87 Identities = 15/60 (25%), Positives = 23/60 (38%), Gaps = 10/60 (16%) Query: 47 PEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQ 106 P K EEE + E + + L E +E+D ++DD FLE+ Sbjct: 14 PPKPPSPKEEEEE----------ALELAIQEAHENALEKKLLDELDEELDEEEDDRFLEE 63 >gnl|CDD|40009 KOG4812, KOG4812, KOG4812, Golgi-associated protein/Nedd4 WW domain-binding protein [General function prediction only]. Length = 262 Score = 27.6 bits (61), Expect = 0.99 Identities = 11/48 (22%), Positives = 20/48 (41%) Query: 63 KPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTD 110 KP +E+P + E + Y +DL++ D ++ D D Sbjct: 106 KPVATSLPNNLDEAPPTYAEAAADMAPPYYGTIDLENSDGRNDEIDID 153 >gnl|CDD|147488 pfam05327, RRN3, RNA polymerase I specific transcription initiation factor RRN3. This family consists of several eukaryotic proteins which are homologous to the yeast RRN3 protein. RRN3 is one of the RRN genes specifically required for the transcription of rDNA by RNA polymerase I (Pol I) in Saccharomyces cerevisiae. Length = 550 Score = 27.6 bits (62), Expect = 1.1 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Query: 86 SLDMEYVQEMDLDDDD---DFLEQNDTDTDTDVVDMDISIPDDADE 128 LD+E E+D DD+ L D D + ++ +MD DD +E Sbjct: 213 KLDVEIQNELDDIDDEESEALLADLDDDDEDEMFEMD---DDDEEE 255 Score = 26.1 bits (58), Expect = 2.8 Identities = 10/43 (23%), Positives = 17/43 (39%) Query: 81 EEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMDISIP 123 + DD + D D+D+ F +D + + V D P Sbjct: 224 DIDDEESEALLADLDDDDEDEMFEMDDDDEEEVSVSSEDEGDP 266 Score = 25.7 bits (57), Expect = 3.7 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 3/42 (7%) Query: 71 EEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTD 112 +EE E+ ++ +DD +M EMD DD+++ ++ + D Sbjct: 227 DEESEALLADLDDDDEDEMF---EMDDDDEEEVSVSSEDEGD 265 >gnl|CDD|37202 KOG1991, KOG1991, KOG1991, Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure, Intracellular trafficking, secretion, and vesicular transport]. Length = 1010 Score = 27.6 bits (61), Expect = 1.2 Identities = 19/71 (26%), Positives = 28/71 (39%) Query: 55 SLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTD 114 SL E + V+ EE E EE+D D + + E D D D++ E D+ Sbjct: 873 SLPEALAERAQVEEEDSEEGEEEDDDEEEDFIDDEDDIDEDDQDYLDEYGELALEKEDSL 932 Query: 115 VVDMDISIPDD 125 D D + Sbjct: 933 DDDDDFDEDEL 943 >gnl|CDD|36161 KOG0943, KOG0943, KOG0943, Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]. Length = 3015 Score = 27.1 bits (59), Expect = 1.6 Identities = 18/51 (35%), Positives = 22/51 (43%) Query: 69 TSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMD 119 T+ + EE + E D D DDDD E +D D D D DMD Sbjct: 1716 TNADNEEREGQEGEFAGEEDHHDDDNDDDDDDDAEAEDDDDDDDDDDEDMD 1766 >gnl|CDD|37367 KOG2156, KOG2156, KOG2156, Tubulin-tyrosine ligase-related protein [Posttranslational modification, protein turnover, chaperones]. Length = 662 Score = 26.5 bits (58), Expect = 2.0 Identities = 15/59 (25%), Positives = 27/59 (45%), Gaps = 12/59 (20%) Query: 76 SPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMD-----ISIPDDADEN 129 +P S D S ++DL+ +DD E +D D +++ D D + D+ +E Sbjct: 77 APESSAPDHVS-------DIDLNRNDDGAEDDDIDGLSELDDSDSEEVLVDTEDEVEEK 128 >gnl|CDD|146667 pfam04147, Nop14, Nop14-like family. Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production. Length = 809 Score = 26.1 bits (58), Expect = 2.6 Identities = 17/73 (23%), Positives = 33/73 (45%), Gaps = 14/73 (19%) Query: 70 SEEEEESPISKEEDD--------------TSLDMEYVQEMDLDDDDDFLEQNDTDTDTDV 115 EEEE+S S ++ D + E +E +DD+D+ + +D + + + Sbjct: 289 DEEEEDSKESADDLDDEFEPDDDDNFGLGQGEEDEEEEEDGVDDEDEEDDDDDLEEEEED 348 Query: 116 VDMDISIPDDADE 128 VD+ D+ +E Sbjct: 349 VDLSDDEEDEEEE 361 >gnl|CDD|37262 KOG2051, KOG2051, KOG2051, Nonsense-mediated mRNA decay 2 protein [RNA processing and modification]. Length = 1128 Score = 26.1 bits (57), Expect = 2.9 Identities = 15/80 (18%), Positives = 33/80 (41%) Query: 48 EKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQN 107 E++ S E+E E + + +E+S + ED+ + + +E D+ E+ Sbjct: 905 VYEEDDGSDEDENEEEEPDTESEPGKEKSDLDDSEDEDIENDDEDEERLDRMIDEGFEEL 964 Query: 108 DTDTDTDVVDMDISIPDDAD 127 D D D + ++ + Sbjct: 965 TPDVDQDDEALLKAMHEKNP 984 >gnl|CDD|37249 KOG2038, KOG2038, KOG2038, CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis, Transcription]. Length = 988 Score = 26.2 bits (57), Expect = 2.9 Identities = 18/70 (25%), Positives = 32/70 (45%), Gaps = 1/70 (1%) Query: 59 ETEVKPFVKHTSEEEEESPISKEEDDTSLD-MEYVQEMDLDDDDDFLEQNDTDTDTDVVD 117 E + K TS+++ ++ +ED+ SL E E D D+D + ++ DT D Sbjct: 863 EKDDKNKKDMTSDDDVDADEDDDEDENSLGSEEDGGEEDDDEDIGDSDDDEDDTSDAEDD 922 Query: 118 MDISIPDDAD 127 + D+ D Sbjct: 923 FEDEDDDEVD 932 >gnl|CDD|36144 KOG0926, KOG0926, KOG0926, DEAH-box RNA helicase [RNA processing and modification, Translation, ribosomal structure and biogenesis]. Length = 1172 Score = 25.8 bits (56), Expect = 3.2 Identities = 17/81 (20%), Positives = 27/81 (33%), Gaps = 9/81 (11%) Query: 47 PEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQ 106 PE + E ETE ++ + E+ E D + +D+D + Sbjct: 144 PEDAIKSSMEEPETE--EEIEIEPPKFGENSEQVEVYDEDSLE-------ISEDEDSSPE 194 Query: 107 NDTDTDTDVVDMDISIPDDAD 127 + DT D DD D Sbjct: 195 ENDDTVDPSPLDDEEPSDDED 215 >gnl|CDD|39547 KOG4346, KOG4346, KOG4346, Uncharacterized conserved protein [Function unknown]. Length = 849 Score = 25.8 bits (56), Expect = 3.2 Identities = 17/83 (20%), Positives = 35/83 (42%), Gaps = 5/83 (6%) Query: 41 FEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDD 100 F + T + E+ + E T+ E EE + +++ S + ++ LD D Sbjct: 421 FLSSTVKQSERVRETANEITKDDA----GEEPEETNVQRLQDNKDSAAITSKNDLRLDSD 476 Query: 101 DDFLEQND-TDTDTDVVDMDISI 122 DD D +++D + + +I Sbjct: 477 DDDFPPYDMSESDKEFKNDEIGE 499 >gnl|CDD|37707 KOG2496, KOG2496, KOG2496, Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, cyclin H subunit [Cell cycle control, cell division, chromosome partitioning, Transcription, Replication, recombination and repair]. Length = 325 Score = 25.7 bits (56), Expect = 3.4 Identities = 12/39 (30%), Positives = 20/39 (51%) Query: 50 EKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLD 88 +K I LEEE + E EE ++KEE+ + ++ Sbjct: 27 QKAIQMLEEEAHNLDENEVFVLEAEELTLTKEEELSLVN 65 >gnl|CDD|146136 pfam03344, Daxx, Daxx Family. The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715 Score = 25.6 bits (56), Expect = 3.7 Identities = 12/56 (21%), Positives = 26/56 (46%) Query: 64 PFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMD 119 P + EEEES +EE++ + E + + + +D+ E+ + +M+ Sbjct: 432 PSMASQESEEEESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGSEEEME 487 Score = 24.5 bits (53), Expect = 8.8 Identities = 17/83 (20%), Positives = 30/83 (36%) Query: 32 TQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEY 91 T P + E +E EEE E + E E+E + E D + E Sbjct: 427 TSGESPSMASQESEEEESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGSEEEM 486 Query: 92 VQEMDLDDDDDFLEQNDTDTDTD 114 + D D + E++ +++ Sbjct: 487 EGSSEGDGDGEEPEEDAERRNSE 509 >gnl|CDD|35385 KOG0163, KOG0163, KOG0163, Myosin class VI heavy chain [Cytoskeleton]. Length = 1259 Score = 25.4 bits (55), Expect = 4.4 Identities = 17/75 (22%), Positives = 36/75 (48%) Query: 38 LAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDL 97 LA E +EK EE+ K ++ + EEE ++EE++ L +E +++ Sbjct: 932 LAEAERKRREAEEKRRREEEEKKRAKAEMETKRKAEEEQRKAQEEEERRLALELQEQLAK 991 Query: 98 DDDDDFLEQNDTDTD 112 + +++ QN + + Sbjct: 992 EAEEEAKRQNQLEQE 1006 >gnl|CDD|133140 cd05473, beta_secretase_like, Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease. Beta-secretase also called BACE (beta-site of APP cleaving enzyme) or memapsin-2. Beta-secretase is an aspartic-acid protease important in the pathogenesis of Alzheimer's disease, and in the formation of myelin sheaths in peripheral nerve cells. It cleaves amyloid precursor protein (APP) to reveal the N-terminus of the beta-amyloid peptides. The beta-amyloid peptides are the major components of the amyloid plaques formed in the brain of patients with Alzheimer's disease (AD). Since BACE mediates one of the cleavages responsible for generation of AD, it is regarded as a potential target for pharmacological intervention in AD. Beta-secretase is a member of pepsin family of aspartic proteases. Same as other aspartic proteases, beta-secretase is a bilobal enzyme, each lobe contributing a catalytic Asp residue, with an extended active site cleft localized between the two lobes of the molecule. The N- and C-terminal domains, although structurally related by a 2-fold axis, have only limited sequence homology except the vicinity of the active site. This suggests that the enzymes evolved by an ancient duplication event. The enzymes specifically cleave bonds in peptides which have at least six residues in length with hydrophobic residues in both the P1 and P1' positions. The active site is located at the groove formed by the two lobes, with an extended loop projecting over the cleft to form an 11-residue flap, which encloses substrates and inhibitors in the active site. Specificity is determined by nearest-neighbor hydrophobic residues surrounding the catalytic aspartates, and by three residues in the flap. The enzymes are mostly secreted from cells as inactive proenzymes that activate autocatalytically at acidic pH. This family of aspartate proteases is classified by MEROPS as the peptidase family A1 (pepsin A, clan AA). Length = 364 Score = 25.5 bits (56), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%), Gaps = 1/16 (6%) Query: 21 DLNKQVIVSPYTQNSW 36 DL K V V PYTQ SW Sbjct: 52 DLGKGVTV-PYTQGSW 66 >gnl|CDD|36714 KOG1501, KOG1501, KOG1501, Arginine N-methyltransferase [General function prediction only]. Length = 636 Score = 25.4 bits (55), Expect = 4.5 Identities = 11/60 (18%), Positives = 17/60 (28%), Gaps = 4/60 (6%) Query: 11 TCPDTGKRFYDLNKQVIVSPYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTS 70 +C I + S F + + I S E E++P V S Sbjct: 214 SCFGIKSVQDSQLVDAIEKEFKLLSSEGTIF----YSDFPRWIDSNSEIEELRPPVAVHS 269 >gnl|CDD|114083 pfam05340, DUF740, Protein of unknown function (DUF740). This family consists of several uncharacterized plant proteins of unknown function. Length = 565 Score = 25.4 bits (55), Expect = 4.9 Identities = 16/71 (22%), Positives = 29/71 (40%), Gaps = 3/71 (4%) Query: 49 KEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQND 108 + KP V EEEE + EED+ + E + + D+ + E+ + Sbjct: 118 PSSIAPPEIDPEPRKPIVPDLVLEEEE-EVEMEEDEEYYEKEPGKVV--DEKSEEEEEEE 174 Query: 109 TDTDTDVVDMD 119 T D +D++ Sbjct: 175 LKTMKDFIDLE 185 >gnl|CDD|39369 KOG4167, KOG4167, KOG4167, Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]. Length = 907 Score = 25.1 bits (54), Expect = 5.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Query: 45 TSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEE 82 S E E+ EEE + + K T EEE E P S EE Sbjct: 679 RSEELEELE--EEEEEDPEEDRKSTKEEESEVPKSPEE 714 >gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription]. Length = 895 Score = 25.3 bits (55), Expect = 5.3 Identities = 15/63 (23%), Positives = 31/63 (49%) Query: 41 FEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDD 100 F P++ E+EKE+ + + ++E+ +EEDD ++ E V+ ++ + Sbjct: 14 FMRPSNMEREKEVLGEKTNLSDENNNDDEIDDEDRDIDDEEEDDEDVESEDVEGVEASEH 73 Query: 101 DDF 103 DF Sbjct: 74 PDF 76 >gnl|CDD|37792 KOG2581, KOG2581, KOG2581, 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones]. Length = 493 Score = 24.9 bits (54), Expect = 5.8 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 4/40 (10%) Query: 64 PFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDLDDDDDF 103 P K E E K + ++E +EM +DDDDF Sbjct: 458 PPKKKKDLESAE----KRREREQQELELAKEMAEEDDDDF 493 >gnl|CDD|36134 KOG0916, KOG0916, KOG0916, 1,3-beta-glucan synthase/callose synthase catalytic subunit [Cell wall/membrane/envelope biogenesis]. Length = 1679 Score = 24.9 bits (54), Expect = 6.0 Identities = 11/57 (19%), Positives = 26/57 (45%), Gaps = 2/57 (3%) Query: 65 FVKHTSEE--EEESPISKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTDTDTDVVDMD 119 + SE+ + +E +D + Y+Q++ D+ +FLE+ + + D+ Sbjct: 838 LTPYYSEKVLYSLRELIRENEDGVSILFYLQKIYPDEWKNFLERTKCLAEEKIDDLP 894 >gnl|CDD|32597 COG2605, COG2605, Predicted kinase related to galactokinase and mevalonate kinase [General function prediction only]. Length = 333 Score = 24.9 bits (54), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Query: 23 NKQVIVSPYTQNSWPLAYFEA 43 N +V+V+P N A EA Sbjct: 168 NGEVVVNPLRINRERTAELEA 188 >gnl|CDD|113695 pfam04931, DNA_pol_phi, DNA polymerase phi. This family includes the fifth essential DNA polymerase in yeast EC:2.7.7.7. Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units. Length = 784 Score = 24.8 bits (54), Expect = 6.6 Identities = 17/85 (20%), Positives = 35/85 (41%), Gaps = 9/85 (10%) Query: 38 LAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEEDDTSLDMEYVQEMDL 97 L +A + + +++ EEE E E+E E+ I E ++ + Sbjct: 629 LDVLKADENKSRHQQLFEGEEEDEDDLEETDDDEDECEA-IEDSESES-------ESDGE 680 Query: 98 DDDDDFLEQNDTDTDTDVVDMDISI 122 D ++D E + + VV +D ++ Sbjct: 681 DGEEDEQEDDAEA-NEGVVPIDKAV 704 >gnl|CDD|38804 KOG3598, KOG3598, KOG3598, Thyroid hormone receptor-associated protein complex, subunit TRAP230 [Transcription]. Length = 2220 Score = 24.7 bits (53), Expect = 7.9 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Query: 37 PLAYFEAP--TSPEKEKEICSLEEETEVKPFVKHTSEEEEESPISKEED 83 P Y+ AP PE E+E EEE E + + E+E + E+ Sbjct: 1770 PRDYYLAPLPLPPEDEEEAKKAEEEKEAAEKEEESKNAEDEKNKNTAEN 1818 >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development. In addition, MEKK3 is involved in interleukin-1 receptor and Toll-like receptor 4 signaling. It is also a specific regulator of the proinflammatory cytokines IL-6 and GM-CSF in some immune cells. MEKK3 also regulates calcineurin, which plays a critical role in T cell activation, apoptosis, skeletal myocyte differentiation, and cardiac hypertrophy. Length = 266 Score = 24.6 bits (53), Expect = 7.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Query: 44 PTSPEKEKEICSLEEETEVKPFVKH 68 P SPE KE+ +LE E ++ ++H Sbjct: 39 PESPETSKEVSALECEIQLLKNLQH 63 >gnl|CDD|35689 KOG0468, KOG0468, KOG0468, U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]. Length = 971 Score = 24.6 bits (53), Expect = 8.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Query: 79 SKEEDDTSLDMEYVQEMDLDDDDDFLEQNDTD 110 S EE+D S++ E +QE+D DD+D+ ++ D Sbjct: 19 SDEEEDDSVEDEDLQEVDQDDEDEMEGDHNED 50 >gnl|CDD|38826 KOG3620, KOG3620, KOG3620, Uncharacterized conserved protein [Function unknown]. Length = 1626 Score = 24.3 bits (52), Expect = 9.5 Identities = 11/52 (21%), Positives = 19/52 (36%), Gaps = 1/52 (1%) Query: 30 PYTQNSWPLAYFEAPTSPEKEKEICSLEEETEVKPFVKHTSEEEEE-SPISK 80 P NS PLA + + + + V V+ E++ + SP Sbjct: 1131 PRQANSAPLAAPPVELPEAEPVKKSATPKPQGVPSSVQTRPEKKVKPSPAKV 1182 >gnl|CDD|177007 CHL00067, rps2, ribosomal protein S2. Length = 230 Score = 24.4 bits (54), Expect = 9.5 Identities = 11/21 (52%), Positives = 13/21 (61%), Gaps = 4/21 (19%) Query: 108 DTDTDTDVVDMDISIP--DDA 126 DT+ D D+ DI IP DDA Sbjct: 192 DTNCDPDLA--DIPIPANDDA 210 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.305 0.128 0.361 Gapped Lambda K H 0.267 0.0574 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,619,426 Number of extensions: 78955 Number of successful extensions: 530 Number of sequences better than 10.0: 1 Number of HSP's gapped: 464 Number of HSP's successfully gapped: 187 Length of query: 129 Length of database: 6,263,737 Length adjustment: 83 Effective length of query: 46 Effective length of database: 4,470,190 Effective search space: 205628740 Effective search space used: 205628740 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 43 (21.9 bits) S2: 52 (24.2 bits)