BLAST/PSIBLAST alignment of GI: 254780460 and GI: 150398636 at iteration 1
>gi|150398636|ref|YP_001329103.1| 3-hydroxydecanoyl-(acyl carrier protein) dehydratase [Sinorhizobium medicae WSM419] Length = 171
>gi|166233354|sp|A6UF38|FABA_SINMW RecName: Full=3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase; AltName: Full=Beta-hydroxydecanoyl thioester dehydrase Length = 171
>gi|150030151|gb|ABR62268.1| beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA [Sinorhizobium medicae WSM419] Length = 171
 Score =  263 bits (672), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 140/165 (84%)

Query: 1   MKNRKSSYTYEEILRCGEGEMFGEGNAQLPKPPMLMFHRITQISETGGNYNQGVVRAEMD 60
           M  R+SS++YEEIL CG GEMFG GNAQLP PPMLMF+RIT ISETGG +++G VRAE D
Sbjct: 1   MTTRQSSFSYEEILICGRGEMFGPGNAQLPLPPMLMFNRITDISETGGPHDKGYVRAEFD 60

Query: 61  ITPNLWFFDCHFKNDPVMPGCLGLDALWQLTGFFLGWLGELGKGRAVSVSNIKFRGMVTP 120
           ITP+LWFF CHF  DPVMPGCLGLDA+WQLTGFFLGWLGE GKGRA+S   +KF GMVTP
Sbjct: 61  ITPDLWFFPCHFMGDPVMPGCLGLDAMWQLTGFFLGWLGEAGKGRAISTGEVKFTGMVTP 120

Query: 121 DCKLVEYGIDFKKILRGRVVLGAADGWVKVNGKEIYQANDLRVCL 165
             KLVEYGIDFK+++RGR+VLG ADGW+K +G+ IY+A DLRV L
Sbjct: 121 KTKLVEYGIDFKRVMRGRLVLGIADGWMKADGETIYKATDLRVGL 165