HHsearch alignment for GI: 254780461 and conserved domain: PRK07108

>PRK07108 acetyl-CoA acetyltransferase; Provisional.
Probab=99.73  E-value=4e-17  Score=125.92  Aligned_cols=259  Identities=21%  Similarity=0.337  Sum_probs=168.1

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999975341013322223333205632567630145677888751252212320012233235677877631
Q gi|254780461|r   70 QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWF  149 (406)
Q Consensus        70 ~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~  149 (406)
T Consensus        26 ~~~eL~a~~i~~~l~r~gi~~~~Id~----Vi~G~v~~~g~~------------g--------------~n~aR~aaL~a   75 (392)
T PRK07108         26 HGATLGGHVVAAAVERAKLDPARVED----VIMGCANPEGAT------------G--------------ANIARQIALRA   75 (392)
T ss_pred             CHHHHHHHHHHHHHHHCCCCHHHCCE----EEEEECCCCCCC------------C--------------CCHHHHHHHHC
T ss_conf             99999999999999870989899998----999946655655------------5--------------77999999966


Q ss_pred             CC--CCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCC--CCC--C-------------CCCCCC----
Q ss_conf             22--333333333344443343210011345605578873134566753--222--2-------------221223----
Q gi|254780461|r  150 KI--RGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTM--SNL--F-------------DAMGAM----  206 (406)
Q Consensus       150 gl--~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~--~~~--f-------------~~~~~l----  206 (406)
T Consensus        76 Glp~~vpa~tVnr~C~SGl~Ai~~Aa~~I~~G~~dv~iAGGvEsmS~~~~~~~~~~~~~~~~~~~~p~~~~~Mg~tAE~~  155 (392)
T PRK07108         76 GLPVTVPGMTVNRFCSSGLQTIALAAQRIIAGEGDVFVAGGVESISCVQNEMNRHMLREGWLVEHKPEIYWSMLQTAENV  155 (392)
T ss_pred             CCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCEEEEECEECCCCCCCCCCCCCCCCHHHHCCCCHHHCCHHHHHHHH
T ss_conf             99988862777574555389999998786389998678804511455754345555666154426950103688999999


Q ss_pred             CCCC---------------------------CC--CC------------------------CCCCCC-------------
Q ss_conf             3467---------------------------86--62------------------------232223-------------
Q gi|254780461|r  207 SSHF---------------------------NH--DP------------------------CSASRP-------------  220 (406)
Q Consensus       207 s~~~---------------------------~~--~p------------------------~~~~rP-------------  220 (406)
T Consensus       156 A~~~gIsRe~qD~~A~~Sh~rA~~A~~~G~f~~EIvPv~v~~~~~d~~~g~~~~~~~~~~~DE~iR~~tt~e~La~LkPa  235 (392)
T PRK07108        156 AKRYGISKERQDEYGVQSQQRAAAAQAAGRFDDEIVPITVTAGVADKATGRLFTKEVTVSADEGIRPDTTLEGVSKIRSA  235 (392)
T ss_pred             HHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCHHCEEEEEECCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHCCCC
T ss_conf             99969899999999999999999999849731305778732565664435334565468624886877685457415887


Q ss_pred             CCCCCCCEE-------ECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEEC-CCCCCCCCCHHHHHHHHHHHHHHHH---C
Q ss_conf             566666413-------1265144311221320110011232012210102-6521234433577898875421001---0
Q gi|254780461|r  221 YDSRRDGFV-------ISGGAAVIVLEEMERAKARGAKIYAELTGYGSTC-DGDDMVSPSGEGAIRCMRQALSSVE---E  289 (406)
Q Consensus       221 Fd~~~~G~~-------~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~-d~~~~~~p~~~g~~~~i~~Al~~a~---~  289 (406)
T Consensus       236 f-~--~GtvTAgNss~~~DGAAavll~s~~~a~~~gl~p~a~i~~~a~~g~dP~~----m~~~Pv~A~~~~L~ragl~~~  308 (392)
T PRK07108        236 L-P--GGVITAGNASQFSDGAAACVVMNADVAEREGLQPLGVFRGFAVAGCEPDE----MGIGPVFAVPKLLKQAGLKVD  308 (392)
T ss_pred             C-C--CCCEECCCCCCCCCHHHHHHHHCHHHHHHCCCCCEEEEEEEEEEEECHHH----HHHHHHHHHHHHHHHCCCCCC
T ss_conf             8-8--88501576686556899998727999997799866999954688708788----604599999999997599733


Q ss_pred             CCCEEEECCCCCCCCCCCHHHHHHCC-----CCCCCCCCCCCCC--HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             02102210245554442001222202-----3554433647521--0132358999999999999987184078688888
Q gi|254780461|r  290 PVDYINTHGTATPKGDKKEVEAIREV-----FKGNIPYIQSTKS--LTGHSLGAAGAQEAIYCLIMMQERFIGESKNIEE  362 (406)
Q Consensus       290 ~i~~i~~hgtgt~~~D~~E~~ai~~~-----f~~~~~~v~s~K~--~~GH~~gasG~~~~~~~~~~l~~g~ipp~~n~~~  362 (406)
T Consensus       309 Did~~Ein----------EAFA~q~l~~~~~l~id~~kvN~~GGaiAlGHP~GaSGarl~~~l~~~L~~~----------  368 (392)
T PRK07108        309 DIDLWELN----------EAFAVQVLYCRDTLGIPMDRLNVNGGAIAVGHPYGVSGARLTGHALIEGKRR----------  368 (392)
T ss_pred             CCCEEEEC----------HHHHHHHHHHHHHHCCCHHHCCCCCCHHHHCCCCCCCHHHHHHHHHHHHHHH----------
T ss_conf             57734640----------5778889999988298899929986678758881211899999999999970----------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEE
Q ss_conf             97667888737998855883589993556777367999994
Q gi|254780461|r  363 IDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR  403 (406)
Q Consensus       363 ~~~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~  403 (406)
T Consensus       369 ------------------~~~~gl~t~C~ggG~g~A~~iE~  391 (392)
T PRK07108        369 ------------------GAKYVVVTMCIGGGQGAAGLFEV  391 (392)
T ss_pred             ------------------CCCEEEEEECCHHCHHHEEEEEC
T ss_conf             ------------------99989999631023224488971