HHsearch alignment for GI: 254780461 and conserved domain: PRK08963

>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed.
Probab=99.71  E-value=2.2e-16  Score=121.34  Aligned_cols=264  Identities=24%  Similarity=0.316  Sum_probs=169.3

Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999975341013322223333205632567630145677888751252212320012233235677877631
Q gi|254780461|r   70 QGGTWGHLAMQEAITDSRLQPCEITHERTGLIAGSGGPSTKCIVSAADLTREHCSTRRIGPFAVPKAMSSTASATLSTWF  149 (406)
Q Consensus        70 ~~~~l~l~aa~~Al~dAGl~~~~~~~~r~gv~vgt~~g~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~n~~a~~is~~~  149 (406)
T Consensus        36 ~~~~L~a~~ik~~l~r~~i~p~~Id~----Vi~G~v~~~~~g---------------------------~n~AR~aaL~a   84 (436)
T PRK08963         36 PAVDLGKMVVGELLARSEIDPKLIEQ----LVFGQVVQMPEA---------------------------PNIAREIVLGT   84 (436)
T ss_pred             CHHHHHHHHHHHHHHHCCCCHHHCCE----EEEEECCCCCCC---------------------------CHHHHHHHHHC
T ss_conf             98999999999999982989899998----999836756767---------------------------72999999975


Q ss_pred             CC--CCCCCCCCCCCCCCCCCCCCEECCCCCCEEEEEEEECCCCCCCCCCCC-----------------------CC---
Q ss_conf             22--333333333344443343210011345605578873134566753222-----------------------22---
Q gi|254780461|r  150 KI--RGTSYSISSACATSAHCIGNAAELIQSGKQDIMFAGGQEDLDWTMSNL-----------------------FD---  201 (406)
Q Consensus       150 gl--~Gp~~ti~~acaSgl~Al~~A~~~L~~G~~D~aivGg~d~~~~~~~~~-----------------------f~---  201 (406)
T Consensus        85 Glp~~vp~~TVnr~C~SGl~Ai~~Aa~~I~~G~~dvvlaGGvEsMS~~P~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~  164 (436)
T PRK08963         85 GMNVHTDAYSVSRACATSFQAVANVAESIMAGTIDIGIAGGADSSSVLPIGVSKKLARALVDLNKARTLGQRLKLFSRLR  164 (436)
T ss_pred             CCCCCCCEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCCCCHHHCCCCCCC
T ss_conf             99988862677632235689999999999749997899945122466865556311233100232444001100113455


Q ss_pred             ------------------CCCC----CCCCC-----------------------------------------C----CCC
Q ss_conf             ------------------2122----33467-----------------------------------------8----662
Q gi|254780461|r  202 ------------------AMGA----MSSHF-----------------------------------------N----HDP  214 (406)
Q Consensus       202 ------------------~~~~----ls~~~-----------------------------------------~----~~p  214 (406)
T Consensus       165 ~~d~~~~~~~~~d~~~~~~MG~tAE~~A~~~gIsReeqD~~A~~Sh~rA~~A~~~G~f~~EIvpv~v~~~~~~~~~De~i  244 (436)
T PRK08963        165 LRDLLPVPPAVAEYSTGLRMGDTAEQMAKTYGISREQQDALAHRSHQLAAQAWAEGKLADEVMTAFVPPYKQPLAEDNNI  244 (436)
T ss_pred             CCCCCCCCCHHCCCCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCCCCCCCCCCC
T ss_conf             33356677000255457868999999999959999999999999999999988659751046422536888766515764


Q ss_pred             ------CC--CCCC-CCCCCCCE-------EECCCEEEEECCCHHHHCCCCCCCCCEEEEEEEEC-CCCCCCCCCHHHHH
Q ss_conf             ------23--2223-56666641-------31265144311221320110011232012210102-65212344335778
Q gi|254780461|r  215 ------CS--ASRP-YDSRRDGF-------VISGGAAVIVLEEMERAKARGAKIYAELTGYGSTC-DGDDMVSPSGEGAI  277 (406)
Q Consensus       215 ------~~--~~rP-Fd~~~~G~-------~~gEGa~~~vLe~~~~A~~rGa~i~a~i~g~~~~~-d~~~~~~p~~~g~~  277 (406)
T Consensus       245 R~~tt~E~La~LkP~F~~~-~GtvTAgNss~~~DGAaavll~s~~~a~~~gl~pla~i~~~a~~gvdP~~~---m~~gPv  320 (436)
T PRK08963        245 RGDSTLEDYAKLRPAFDRK-HGTVTAANSTPLTDGAAAVLLMSESRAKALGLTPLGYLRSYAFTAIDVWQD---MLMGPA  320 (436)
T ss_pred             CCCCCHHHHHCCCCEEECC-CCCEECCCCCCCCCCHHHHHHCCHHHHHHCCCCCEEEEEEEEEEEECCCHH---CCCCHH
T ss_conf             8887633440468612168-887776646855653587764269899867998269999989984283320---265779


Q ss_pred             HHHHHHHHHHH---CCCCEEEECCCCCCCCCCCHHHH---HHCC---------CCCC-----CC--CCCCCCC--HHHHH
Q ss_conf             98875421001---00210221024555444200122---2202---------3554-----43--3647521--01323
Q gi|254780461|r  278 RCMRQALSSVE---EPVDYINTHGTATPKGDKKEVEA---IREV---------FKGN-----IP--YIQSTKS--LTGHS  333 (406)
Q Consensus       278 ~~i~~Al~~a~---~~i~~i~~hgtgt~~~D~~E~~a---i~~~---------f~~~-----~~--~v~s~K~--~~GH~  333 (406)
T Consensus       321 ~Ai~k~L~ragl~~~Did~~EinE-------AFAaq~la~~~~l~~~~f~~~~lg~~~~~g~id~~kvN~~GGaIAlGHP  393 (436)
T PRK08963        321 YATPLALERAGLTLADLTLIDMHE-------AFAAQTLANLQMFASDRFAREKLGRSQAIGEVDMSKFNVLGGSIAYGHP  393 (436)
T ss_pred             HHHHHHHHHCCCCHHHCCEEEEHH-------HCHHHHHHHHHHHCCHHHHHHHHCCCCCCCCCCHHHCCCCCCHHHHCCC
T ss_conf             999999998499989998777512-------3578899999985202566775144333355978775888538875788


Q ss_pred             HHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCEEEEEEEEE
Q ss_conf             5899999999999998718407868888897667888737998855883589993556777367999994
Q gi|254780461|r  334 LGAAGAQEAIYCLIMMQERFIGESKNIEEIDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRR  403 (406)
Q Consensus       334 ~gasG~~~~~~~~~~l~~g~ipp~~n~~~~~~~~~~l~~v~~~~~~~~~~~al~~s~GfGG~n~~~vl~~  403 (406)
T Consensus       394 ~GaTGarl~~tl~~~L~~~----------------------------~~~~Gl~s~C~gGG~g~A~liEv  435 (436)
T PRK08963        394 FAATGARMITQTLHELRRR----------------------------GGGLGLTTACAAGGLGAAMVLEV  435 (436)
T ss_pred             CCCCHHHHHHHHHHHHHHH----------------------------CCCEEEEEECCCCCEEEEEEEEE
T ss_conf             1225899999999999980----------------------------99989999633233138999995