RPSBLAST alignment for GI: 254780461 and conserved domain: PRK07103

>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated. Length = 410
 Score =  239 bits (611), Expect = 1e-63
 Identities = 139/423 (32%), Positives = 196/423 (46%), Gaps = 33/423 (7%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK--PLLNA-- 56
           M  V VTG+G+VS+IG      A +L   R          +        G     + A  
Sbjct: 1   MDEVVVTGVGVVSAIGQGRPSFAAALLAGRHAFGVMRRPGRQVPDDAGAGLASAFIGAEL 60

Query: 57  -----AELIDRKAMRFLSQGGTWGHLAMQEAITDSRLQPCEITHERTGLI-AGSGGPSTK 110
                 E +D K +R  S        A +EA  D+ L P  +  +R GL+  GS      
Sbjct: 61  DSLALPERLDAKLLRRASLSAQAALAAAREAWRDAALGP--VDPDRIGLVVGGSN----- 113

Query: 111 CIVSAADLTREHCSTRRIGPFAVPKA----MSSTASATLSTWFKIRGTSYSISSACATSA 166
             +   +    H + R    F  P      M +      S  F IRG  +++  A A+  
Sbjct: 114 --LQQREQALVHETYRDRPAFLRPSYGLSFMDTDLVGLCSEQFGIRGEGFTVGGASASGQ 171

Query: 167 HCIGNAAELIQSGKQDIMFA-GGQEDLDWTMSNLFDAMGAM-SSHFNHDPCSASRPYDSR 224
             +  AA L+QSG  D   A G   DL +       ++GAM S  F  +P +A RP+D  
Sbjct: 172 LAVIQAARLVQSGSVDACIAVGALMDLSYWECQALRSLGAMGSDRFADEPEAACRPFDQD 231

Query: 225 RDGFVISGGAAVIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSPSGEGAIRCMRQAL 284
           RDGF+       +VLE  E A+ RGA+ YA+L G+    D +    PS EG +R +R AL
Sbjct: 232 RDGFIYGEACGAVVLESAESARRRGARPYAKLLGWSMRLDANRGPDPSLEGEMRVIRAAL 291

Query: 285 SSVE---EPVDYINTHGTATPKGDKKEVEAIREVFKGNIPYIQSTKSLTGHSLGAAGAQE 341
                  E +DY+N HGT +P GD+ E+ A+      +  +I +TKSLTGH L AAG  E
Sbjct: 292 RRAGLGPEDIDYVNPHGTGSPLGDETELAALFASGLAH-AWINATKSLTGHGLSAAGIVE 350

Query: 342 AIYCLIMMQERFIGESKNIEE-IDPEFKGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLV 400
            I  L+ M+  F+  S+N++E ID  F+    V    ++A+I   LS SFGFGG N  LV
Sbjct: 351 LIATLLQMRAGFLHPSRNLDEPIDERFR---WVGSTAESARIRYALSLSFGFGGINTALV 407

Query: 401 FRR 403
             R
Sbjct: 408 LER 410