RPSBLAST alignment for GI: 254780461 and conserved domain: KOG1394

>gnl|CDD|36608 KOG1394, KOG1394, KOG1394, 3-oxoacyl-(acyl-carrier-protein) synthase (I and II) [Lipid transport and metabolism, Secondary metabolites biosynthesis, transport and catabolism]. Length = 440
 Score =  320 bits (821), Expect = 5e-88
 Identities = 161/420 (38%), Positives = 230/420 (54%), Gaps = 17/420 (4%)

Query: 1   MRRVAVTGMGIVSSIGNNVSEVAISLREARSGITFSEDFAKFGFRCQVWGK-PLLNAAEL 59
           MRRV +TGMG V+ +GN V     +L    SGI+  E          V GK P  +  + 
Sbjct: 23  MRRVVITGMGAVTPLGNGVHTSWRNLLSGESGISSLEGPDYKSIPFTVAGKIPRFSVEDY 82

Query: 60  IDRKAMRFLSQGGTWGHLAMQEAITDSRLQP---CEITHERTGLIAGSGGPSTKCIVSAA 116
           + +   R +S+       A +EA+ D+ L      E   E+TG++ G+G    + I   A
Sbjct: 83  VSKGDERRMSKFTKLALTAAEEALKDAGLLDVNLSEEDKEKTGVLIGTGMGDLEDIYETA 142

Query: 117 DLTREHCSTRRIGPFAVPKAMSSTASATLSTWFKIRGTSYSISSACATSAHCIGNAAELI 176
               E    RR+ PF VPK +++ A+  +S  + +RG ++S+S+ACAT  HCIG+A   I
Sbjct: 143 QNLSEKGY-RRVSPFFVPKILTNMAAGYVSMKYGLRGPNHSVSTACATGNHCIGDAFNFI 201

Query: 177 QSGKQDIMFAGGQED-LDWTMSNLFDAMGAMSSHFNHDPCSASRPYDSRRDGFVISGGAA 235
           + G  D+M AGG E  ++      F    A+S+  N +P  ASRP+D +RDGFV+  GA 
Sbjct: 202 RLGDADVMLAGGSEACINPLSLAGFSRARALSTR-NDNPQKASRPFDKKRDGFVMGEGAG 260

Query: 236 VIVLEEMERAKARGAKIYAELTGYGSTCDGDDMVSP--SGEGAIRCMRQALSSV---EEP 290
           V+VLEE+E AK RGA IYAE+ GYG + D   + SP   G GA+  M +AL       E 
Sbjct: 261 VLVLEELEHAKKRGAPIYAEVLGYGLSSDAYHITSPDPDGAGAVLAMERALKDAGLSPED 320

Query: 291 VDYINTHGTATPKGDKKEVEAIREVFKGN--IPYIQSTKSLTGHSLGAAGAQEAIYCLIM 348
           +DY+N H T+TP GD  E EAI+ VF  +     + STK   GH LGAAGA EAI+ ++ 
Sbjct: 321 IDYVNAHATSTPLGDAAEAEAIKRVFGEHNIASKVSSTKGAIGHLLGAAGAVEAIFTVLA 380

Query: 349 MQERFIGESKNIEEIDPEF---KGIPIVRKRIDNAKIDTVLSNSFGFGGTNATLVFRRYK 405
           + +  +  + N+E  DP            ++    K+   LSNSFGFGGTNA+L F ++K
Sbjct: 381 INDGVLPPTLNLENPDPGVDLDYVPLKASEKKGGNKVRVALSNSFGFGGTNASLCFAKFK 440