254780462
enoyl-(acyl carrier protein) reductase
| GeneID in NCBI database: | 8209450 | Locus tag: | CLIBASIA_01735 |
| Protein GI in NCBI database: | 254780462 | Protein Accession: | YP_003064875.1 |
| Gene range: | +(380351, 381154) | Protein Length: | 267aa |
| Gene description: | enoyl-(acyl carrier protein) reductase | ||
| COG prediction: | [I] Enoyl-[acyl-carrier-protein] reductase (NADH) | ||
| KEGG prediction: | fabI; enoyl-(acyl carrier protein) reductase (EC:1.3.1.9); K00208 enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9] | ||
| SEED prediction: | Enoyl-[acyl-carrier-protein] reductase [NADH] (EC 1.3.1.9) | ||
| Pathway involved in KEGG: | Fatty acid biosynthesis [PATH:las00061] | ||
| Subsystem involved in SEED: | Fatty Acid Biosynthesis FASII | ||
| sequence | sequence profile | ||
Prediction of Local Sequence Properties
| Source | Summary | Result |
|---|
|
|
Close Homologs Detected by BLAST or PSI-BLAST
Homolog within the Genome Detected by BLAST
Original result of BLAST against C. L. asiaticus genome
| Identity | Alignment graph | Length | Definition | E-value | |
| Target | 267 | enoyl-(acyl carrier protein) reductase [Candidatus Libe | |||
| 254781166 | 284 | enoyl-(acyl carrier protein) reductase [Candidatus | 7e-77 | ||
| 254780535 | 247 | 3-ketoacyl-(acyl-carrier-protein) reductase [Candi | 2e-13 | ||
| 254780337 | 257 | oxidoreductase protein [Candidatus Liberibacter as | 6e-05 |
| >gi|254781166|ref|YP_003065579.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 284 | Back alignment |
|---|
Score = 278 bits (711), Expect = 7e-77, Method: Compositional matrix adjust.
Identities = 131/257 (50%), Positives = 191/257 (74%), Gaps = 1/257 (0%)
Query: 3 NILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMI 62
N++K KRG+++GVAN+ S+AW IAK+ H+AGA++A ++QG++ KR++ L +D
Sbjct: 6 NLMKDKRGIVLGVANNRSLAWSIAKMCHAAGAKVALTWQGDATKKRIEGLVEGMDFFMAG 65
Query: 63 PCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVSCF 122
CNV + ++D +F +++ W T+DF+VH+IAFSDK EL GPY NT+R+NF+ TM VS +
Sbjct: 66 HCNVSNSETIDDVFRNLEKEWGTIDFLVHAIAFSDKAELTGPYINTTRENFLNTMDVSVY 125
Query: 123 SFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGMN- 181
SFT + RA+ LM GG+M+TLTY G+ +V+P+YN M PAK+AL+S+ +YLA D G +
Sbjct: 126 SFTALAARASSLMNKGGSMLTLTYLGADKVMPHYNCMGPAKAALQSAVRYLAMDLGRQSG 185
Query: 182 IRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGVT 241
IR+NA+SAGP +TLA + IS+ R I W++ NSPL R ++ +++ SALYLLS S+GVT
Sbjct: 186 IRVNALSAGPAKTLASSGISDFRYILKWNEYNSPLGRNITHDEVAKSALYLLSDFSSGVT 245
Query: 242 GEIHYVDCGYNIVAMPS 258
GE HYVD GY+IV M +
Sbjct: 246 GECHYVDAGYHIVGMKA 262
|
| >gi|254780535|ref|YP_003064948.1| 3-ketoacyl-(acyl-carrier-protein) reductase [Candidatus Liberibacter asiaticus str. psy62] Length = 247 | Back alignment |
|---|
Score = 67.4 bits (163), Expect = 2e-13, Method: Compositional matrix adjust.
Identities = 70/260 (26%), Positives = 121/260 (46%), Gaps = 26/260 (10%)
Query: 5 LKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDFMIPC 64
L GK+ L+ G + SI IAK+L+ GA + + +++ VD + P
Sbjct: 4 LTGKKALVTGASG--SIGLAIAKILYKQGASVGLHGTSQEKLEKVAKNFDDVDRFLLFPA 61
Query: 65 NVEDPSSMDLLFERIKERWETLDFVVHSIAF-SDKNELRGPYYNTSRDNFIQTMLVSCFS 123
N D S++ L +R+ E +D +V++ D +R Y + D+ + L S F
Sbjct: 62 NFSDRVSVEYLSKRVNEEMGGVDILVNNAGIVRDSLFMRARYEDW--DDVLSVNLTSAFL 119
Query: 124 FTEIVRRAAQLMP-----HGGAMITLT----YGGSMRVVPNYNAMAPAKSALESSTKYLA 174
T QL+P G +I +T + G+ V NY A AKS L TK LA
Sbjct: 120 LTR------QLVPLMIRNRFGRVINITSVVGFTGNAGQV-NYCA---AKSGLTGFTKALA 169
Query: 175 CDYGGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLS 234
+ G N+ +N ++ G + + +++ D + P+KR +++DI + LYL S
Sbjct: 170 QETGRRNVTVNCVAPGFIGSDMTVNLT--EDQKGKIISSIPMKRMGAVDDIAAAVLYLSS 227
Query: 235 YLSNGVTGEIHYVDCGYNIV 254
++ VTG+ +V+ G ++
Sbjct: 228 LEASYVTGQTIHVNGGMAMI 247
|
| >gi|254780337|ref|YP_003064750.1| oxidoreductase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 257 | Back alignment |
|---|
Score = 39.7 bits (91), Expect = 6e-05, Method: Compositional matrix adjust.
Identities = 32/156 (20%), Positives = 68/156 (43%), Gaps = 8/156 (5%)
Query: 41 QGESIGKRLKPLALTVDSDFMIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNE 100
Q E + L+ + +D + ++ D ++++L I +RW LD ++ +
Sbjct: 54 QLEKLKNALQKINKKID---IFAFDLRDSNALELTKTYIAKRWGKLDILIANAGILGS-- 108
Query: 101 LRGPYYNTSRDNFIQTMLVSCFSFTEIVRRAAQLMP--HGGAMITLTYGGSMRVVPNYNA 158
P + +F + V+ + I+R + H G I L+ G + + P + A
Sbjct: 109 -ISPIWQIKEKSFADVISVNVMANWNIMRSFDPWLKKSHCGRAIILSSGAAYKCRPLWGA 167
Query: 159 MAPAKSALESSTKYLACDYGGMNIRINAISAGPVRT 194
+ +K+A+E+ + + + +R+ I GP RT
Sbjct: 168 YSASKAAIEALARTWSKETVNTALRVINIDPGPTRT 203
|
Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations
Original result of PSI-BLAST first 2 iterations
| Identity | Alignment graph | Length | Definition | Round | E-value |
| Target | 267 | enoyl-(acyl carrier protein) reductase [Candidatus Libe | |||
| 315122089 | 265 | enoyl-(acyl carrier protein) reductase [Candidatus Libe | 1 | 1e-124 | |
| 227824078 | 281 | enoyl-(acyl carrier protein) reductase [Sinorhizobium f | 1 | 1e-104 | |
| 15963999 | 268 | enoyl-(acyl carrier protein) reductase [Sinorhizobium m | 1 | 1e-104 | |
| 150398634 | 268 | enoyl-(acyl carrier protein) reductase [Sinorhizobium m | 1 | 1e-103 | |
| 325291591 | 268 | enoyl-acyl carrier protein reductase [Agrobacterium sp. | 1 | 1e-102 | |
| 254505113 | 270 | oxidoreductase, short chain dehydrogenase/reductase fam | 1 | 1e-101 | |
| 307943428 | 270 | enoyl-[acyl-carrier-protein] reductase [NADH] 2 [Roseib | 1 | 1e-101 | |
| 328541688 | 270 | oxidoreductase, short chain dehydrogenase/reductase fam | 1 | 1e-101 | |
| 222147155 | 264 | enoyl-(acyl carrier protein) reductase [Agrobacterium v | 1 | 1e-101 | |
| 118591455 | 270 | enoyl-(acyl carrier protein) reductase [Stappia aggrega | 1 | 1e-100 |
| >gi|315122089|ref|YP_004062578.1| enoyl-(acyl carrier protein) reductase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 265 | Back alignment and organism information |
|---|
Score = 450 bits (1157), Expect = e-124, Method: Compositional matrix adjust.
Identities = 207/264 (78%), Positives = 241/264 (91%)
Query: 1 MINILKGKRGLIMGVANDHSIAWGIAKVLHSAGAQLAFSYQGESIGKRLKPLALTVDSDF 60
M++ILKGKRGLIMG+AN+HSIAWGIAKVL S GAQL+FSYQGE+IGKRLKPLA ++SDF
Sbjct: 1 MVDILKGKRGLIMGIANNHSIAWGIAKVLQSEGAQLSFSYQGEAIGKRLKPLASELNSDF 60
Query: 61 MIPCNVEDPSSMDLLFERIKERWETLDFVVHSIAFSDKNELRGPYYNTSRDNFIQTMLVS 120
IPCNVED +S+D LF +I++RW +L+F+VHSI FSDKNEL+GPY NTSRDNFI+TML+S
Sbjct: 61 TIPCNVEDSASIDSLFAQIQDRWGSLNFIVHSIGFSDKNELKGPYVNTSRDNFIRTMLIS 120
Query: 121 CFSFTEIVRRAAQLMPHGGAMITLTYGGSMRVVPNYNAMAPAKSALESSTKYLACDYGGM 180
CFSFTE+ +RAA+LMPHGGAMITLTYGGS RVVPNYN M AK+ALESS KYLACDYG M
Sbjct: 121 CFSFTEVAKRAAKLMPHGGAMITLTYGGSTRVVPNYNVMGIAKAALESSVKYLACDYGHM 180
Query: 181 NIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRTVSLEDIGNSALYLLSYLSNGV 240
NIR+NAISAGP+RTLAGASI++GRDIA+WS++NSPL+RTVSLEDIGNSALYLLS +SNGV
Sbjct: 181 NIRVNAISAGPIRTLAGASIAHGRDIASWSRDNSPLQRTVSLEDIGNSALYLLSNMSNGV 240
Query: 241 TGEIHYVDCGYNIVAMPSYNKNKV 264
TGEIHYVDCGYNI AMP +NK +
Sbjct: 241 TGEIHYVDCGYNITAMPLHNKKNI 264
|
Species: Candidatus Liberibacter solanacearum Genus: Candidatus Liberibacter Family: Rhizobiaceae Order: Rhizobiales Class: Alphaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|227824078|ref|YP_002828051.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium fredii NGR234] Length = 281 | Back alignment and organism information |
|---|
| >gi|15963999|ref|NP_384352.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium meliloti 1021] Length = 268 | Back alignment and organism information |
|---|
| >gi|150398634|ref|YP_001329101.1| enoyl-(acyl carrier protein) reductase [Sinorhizobium medicae WSM419] Length = 268 | Back alignment and organism information |
|---|
| >gi|325291591|ref|YP_004277455.1| enoyl-acyl carrier protein reductase [Agrobacterium sp. H13-3] Length = 268 | Back alignment and organism information |
|---|
| >gi|254505113|ref|ZP_05117264.1| oxidoreductase, short chain dehydrogenase/reductase family [Labrenzia alexandrii DFL-11] Length = 270 | Back alignment and organism information |
|---|
| >gi|307943428|ref|ZP_07658772.1| enoyl-[acyl-carrier-protein] reductase [NADH] 2 [Roseibium sp. TrichSKD4] Length = 270 | Back alignment and organism information |
|---|
| >gi|328541688|ref|YP_004301797.1| oxidoreductase, short chain dehydrogenase/reductase family [polymorphum gilvum SL003B-26A1] Length = 270 | Back alignment and organism information |
|---|
| >gi|222147155|ref|YP_002548112.1| enoyl-(acyl carrier protein) reductase [Agrobacterium vitis S4] Length = 264 | Back alignment and organism information |
|---|
| >gi|118591455|ref|ZP_01548853.1| enoyl-(acyl carrier protein) reductase [Stappia aggregata IAM 12614] Length = 270 | Back alignment and organism information |
|---|
Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch
Conserved Domains in CDD Database Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
Original result of RPS-BLASTagainst CDD database part II
| Identity | Alignment graph | Length | Definition | E-value |
| Target | 267 | enoyl-(acyl carrier protein) reductase [Candidatus Libe | ||
| PRK06505 | 271 | PRK06505, PRK06505, enoyl-(acyl carrier protein) reduct | 1e-124 | |
| PRK08159 | 272 | PRK08159, PRK08159, enoyl-(acyl carrier protein) reduct | 1e-103 | |
| PRK08415 | 274 | PRK08415, PRK08415, enoyl-(acyl carrier protein) reduct | 4e-85 | |
| PRK07533 | 258 | PRK07533, PRK07533, enoyl-(acyl carrier protein) reduct | 6e-80 | |
| PRK08594 | 257 | PRK08594, PRK08594, enoyl-(acyl carrier protein) reduct | 9e-76 | |
| PRK07370 | 258 | PRK07370, PRK07370, enoyl-(acyl carrier protein) reduct | 2e-75 | |
| PRK06603 | 260 | PRK06603, PRK06603, enoyl-(acyl carrier protein) reduct | 2e-75 | |
| PRK06079 | 252 | PRK06079, PRK06079, enoyl-(acyl carrier protein) reduct | 3e-64 | |
| PRK06997 | 260 | PRK06997, PRK06997, enoyl-(acyl carrier protein) reduct | 7e-64 | |
| PRK07984 | 262 | PRK07984, PRK07984, enoyl-(acyl carrier protein) reduct | 3e-60 | |
| PRK08690 | 261 | PRK08690, PRK08690, enoyl-(acyl carrier protein) reduct | 7e-54 | |
| PRK07889 | 256 | PRK07889, PRK07889, enoyl-(acyl carrier protein) reduct | 1e-43 | |
| PRK06300 | 299 | PRK06300, PRK06300, enoyl-(acyl carrier protein) reduct | 1e-38 | |
| PLN02730 | 303 | PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reduct | 1e-35 | |
| PRK08063 | 250 | PRK08063, PRK08063, enoyl-(acyl carrier protein) reduct | 2e-23 | |
| PRK08416 | 260 | PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenas | 2e-20 | |
| COG1028 | 251 | COG1028, FabG, Dehydrogenases with different specificit | 2e-19 | |
| KOG0725 | 270 | KOG0725, KOG0725, KOG0725, Reductases with broad range | 3e-17 | |
| PRK07231 | 251 | PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 2e-16 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Validate | 1e-14 | |
| PRK12939 | 250 | PRK12939, PRK12939, short chain dehydrogenase; Provisio | 1e-14 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Validate | 3e-14 | |
| PRK06124 | 256 | PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisio | 3e-14 | |
| PRK07856 | 252 | PRK07856, PRK07856, short chain dehydrogenase; Provisio | 3e-14 | |
| PRK05557 | 248 | PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 1e-13 | |
| PRK12829 | 264 | PRK12829, PRK12829, short chain dehydrogenase; Provisio | 1e-13 | |
| PRK12937 | 245 | PRK12937, PRK12937, short chain dehydrogenase; Provisio | 2e-13 | |
| TIGR01830 | 239 | TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-prot | 6e-12 | |
| PRK12826 | 251 | PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) r | 6e-12 | |
| KOG1207 | 245 | KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulos | 7e-12 | |
| PRK06113 | 255 | PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenas | 8e-12 | |
| TIGR01832 | 248 | TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase | 8e-12 | |
| PRK07035 | 252 | PRK07035, PRK07035, short chain dehydrogenase; Provisio | 1e-11 | |
| PRK05653 | 246 | PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 1e-11 | |
| PRK07774 | 250 | PRK07774, PRK07774, short chain dehydrogenase; Provisio | 2e-10 | |
| PRK13394 | 262 | PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Pr | 2e-10 | |
| PRK07890 | 258 | PRK07890, PRK07890, short chain dehydrogenase; Provisio | 3e-10 | |
| PRK08265 | 261 | PRK08265, PRK08265, short chain dehydrogenase; Provisio | 3e-10 | |
| PRK12429 | 258 | PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Pr | 4e-10 | |
| PRK08226 | 263 | PRK08226, PRK08226, short chain dehydrogenase; Provisio | 7e-10 | |
| PRK06128 | 300 | PRK06128, PRK06128, oxidoreductase; Provisional | 8e-09 | |
| PRK05565 | 247 | PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 1e-08 | |
| PRK07097 | 265 | PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisio | 2e-08 | |
| PRK06841 | 255 | PRK06841, PRK06841, short chain dehydrogenase; Provisio | 3e-08 | |
| PRK06463 | 255 | PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 4e-08 | |
| KOG1200 | 256 | KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial bet | 7e-08 | |
| COG4221 | 246 | COG4221, COG4221, Short-chain alcohol dehydrogenase of | 9e-08 | |
| PRK12742 | 237 | PRK12742, PRK12742, oxidoreductase; Provisional | 1e-07 | |
| PRK08213 | 259 | PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisio | 1e-07 | |
| PRK09135 | 249 | PRK09135, PRK09135, pteridine reductase; Provisional | 2e-07 | |
| PRK12747 | 252 | PRK12747, PRK12747, short chain dehydrogenase; Provisio | 4e-07 | |
| PRK06138 | 252 | PRK06138, PRK06138, short chain dehydrogenase; Provisio | 6e-07 | |
| PRK05867 | 253 | PRK05867, PRK05867, short chain dehydrogenase; Provisio | 6e-07 | |
| TIGR01963 | 255 | TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase | 6e-07 | |
| PRK12481 | 251 | PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase | 8e-07 | |
| PRK09186 | 256 | PRK09186, PRK09186, flagellin modification protein A; P | 2e-06 | |
| PRK06701 | 290 | PRK06701, PRK06701, short chain dehydrogenase; Provisio | 3e-06 | |
| PRK07523 | 255 | PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisio | 3e-06 | |
| PRK08628 | 258 | PRK08628, PRK08628, short chain dehydrogenase; Provisio | 6e-06 | |
| PRK12746 | 254 | PRK12746, PRK12746, short chain dehydrogenase; Provisio | 8e-06 | |
| PRK12936 | 245 | PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) r | 2e-05 | |
| PRK06114 | 254 | PRK06114, PRK06114, short chain dehydrogenase; Provisio | 4e-05 | |
| PRK06935 | 258 | PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase | 9e-05 | |
| PRK06523 | 260 | PRK06523, PRK06523, short chain dehydrogenase; Provisio | 1e-04 | |
| PRK09242 | 257 | PRK09242, PRK09242, tropinone reductase; Provisional | 2e-04 | |
| PRK07063 | 260 | PRK07063, PRK07063, short chain dehydrogenase; Provisio | 4e-04 | |
| PRK05786 | 238 | PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 5e-04 | |
| PRK12828 | 239 | PRK12828, PRK12828, short chain dehydrogenase; Provisio | 0.001 | |
| PRK08220 | 252 | PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydroge | 0.001 | |
| COG0623 | 259 | COG0623, FabI, Enoyl-[acyl-carrier-protein] | 1e-101 | |
| PRK05875 | 276 | PRK05875, PRK05875, short chain dehydrogenase; Provisio | 1e-11 | |
| PRK07814 | 263 | PRK07814, PRK07814, short chain dehydrogenase; Provisio | 9e-10 | |
| PRK08324 | 681 | PRK08324, PRK08324, short chain dehydrogenase; Validate | 1e-09 | |
| PRK07985 | 294 | PRK07985, PRK07985, oxidoreductase; Provisional | 6e-09 | |
| PRK12825 | 249 | PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 1e-07 | |
| PRK12827 | 249 | PRK12827, PRK12827, short chain dehydrogenase; Provisio | 5e-06 | |
| PRK06077 | 252 | PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 7e-06 | |
| PRK06398 | 258 | PRK06398, PRK06398, aldose dehydrogenase; Validated | 1e-05 | |
| PRK06172 | 253 | PRK06172, PRK06172, short chain dehydrogenase; Provisio | 7e-05 | |
| PRK08993 | 253 | PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase | 9e-05 | |
| PRK12824 | 245 | PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisio | 4e-04 | |
| PRK07478 | 254 | PRK07478, PRK07478, short chain dehydrogenase; Provisio | 1e-11 | |
| PRK08642 | 253 | PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 4e-09 | |
| PRK07074 | 257 | PRK07074, PRK07074, short chain dehydrogenase; Provisio | 2e-08 | |
| PRK07576 | 264 | PRK07576, PRK07576, short chain dehydrogenase; Provisio | 3e-08 | |
| PRK07060 | 245 | PRK07060, PRK07060, short chain dehydrogenase; Provisio | 3e-07 | |
| PRK08589 | 272 | PRK08589, PRK08589, short chain dehydrogenase; Validate | 4e-07 | |
| PRK06550 | 235 | PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reduc | 3e-06 | |
| PRK05717 | 255 | PRK05717, PRK05717, oxidoreductase; Validated | 1e-05 | |
| TIGR02632 | 676 | TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldol | 6e-05 | |
| PRK07041 | 230 | PRK07041, PRK07041, short chain dehydrogenase; Provisio | 7e-05 | |
| PRK09134 | 258 | PRK09134, PRK09134, short chain dehydrogenase; Provisio | 7e-05 | |
| PRK07677 | 252 | PRK07677, PRK07677, short chain dehydrogenase; Provisio | 1e-04 | |
| PRK07577 | 234 | PRK07577, PRK07577, short chain dehydrogenase; Provisio | 1e-04 | |
| PRK07069 | 251 | PRK07069, PRK07069, short chain dehydrogenase; Validate | 2e-04 | |
| PRK06947 | 248 | PRK06947, PRK06947, glucose-1-dehydrogenase; Provisiona | 3e-04 | |
| PRK06500 | 249 | PRK06500, PRK06500, short chain dehydrogenase; Provisio | 0.001 | |
| PRK12859 | 256 | PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) r | 9e-08 | |
| COG0300 | 265 | COG0300, DltE, Short-chain dehydrogenases of various su | 6e-07 | |
| PRK12748 | 256 | PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) r | 3e-06 | |
| PRK06123 | 248 | PRK06123, PRK06123, short chain dehydrogenase; Provisio | 0.001 |
| >gnl|CDD|180596 PRK06505, PRK06505, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181260 PRK08159, PRK08159, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181020 PRK07533, PRK07533, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181494 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|168626 PRK06603, PRK06603, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180388 PRK06079, PRK06079, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180789 PRK06997, PRK06997, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181187 PRK07984, PRK07984, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169553 PRK08690, PRK08690, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181158 PRK07889, PRK07889, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180521 PRK06300, PRK06300, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178331 PLN02730, PLN02730, enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >gnl|CDD|181217 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|31231 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|35944 KOG0725, KOG0725, KOG0725, Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|180897 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180412 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181148 PRK07856, PRK07856, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180126 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162551 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|36421 KOG1207, KOG1207, KOG1207, Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|130891 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180183 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181112 PRK07774, PRK07774, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181336 PRK08265, PRK08265, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183525 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180133 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180836 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|36414 KOG1200, KOG1200, KOG1200, Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|33946 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|102201 PRK06138, PRK06138, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|162628 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169699 PRK09186, PRK09186, flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180661 PRK06701, PRK06701, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168990 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180819 PRK07063, PRK07063, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180258 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183777 PRK12828, PRK12828, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181299 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|30968 COG0623, FabI, Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181389 PRK08324, PRK08324, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183774 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183776 PRK12827, PRK12827, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168382 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180553 PRK06398, PRK06398, aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181043 PRK07576, PRK07576, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|180804 PRK07041, PRK07041, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181667 PRK09134, PRK09134, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180593 PRK06500, PRK06500, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|30648 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183720 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Conserved Domains in CDD Database Detected by HHsearch
Original result of HHsearch against CDD database
| Identity | Alignment graph | Length | Definition | Probability |
| Target | 267 | enoyl-(acyl carrier protein) reductase [Candidatus Libe | ||
| TIGR01830 | 238 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reducta | 100.0 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK07063 | 259 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07370 | 259 | enoyl-(acyl carrier protein) reductase; Validated | 100.0 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 100.0 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 100.0 | |
| PRK07533 | 254 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK08594 | 256 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 100.0 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05875 | 277 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK07523 | 251 | gluconate 5-dehydrogenase; Provisional | 100.0 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 100.0 | |
| PRK07576 | 260 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12827 | 251 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06124 | 259 | gluconate 5-dehydrogenase; Provisional | 100.0 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 100.0 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 100.0 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 100.0 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 100.0 | |
| PRK06227 | 256 | consensus | 100.0 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06484 | 530 | short chain dehydrogenase; Validated | 100.0 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 100.0 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena | 100.0 | |
| PRK06701 | 289 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09242 | 258 | tropinone reductase; Provisional | 100.0 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06484 | 530 | short chain dehydrogenase; Validated | 100.0 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06114 | 262 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 100.0 | |
| PRK07067 | 256 | sorbitol dehydrogenase; Provisional | 100.0 | |
| PRK07831 | 261 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 100.0 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06463 | 254 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Revie | 100.0 | |
| PRK06198 | 268 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 100.0 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 100.0 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 100.0 | |
| PRK07776 | 252 | consensus | 100.0 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06346 | 251 | consensus | 100.0 | |
| PRK12826 | 253 | 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | 100.0 | |
| PRK07479 | 252 | consensus | 100.0 | |
| PRK12825 | 250 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK06398 | 256 | aldose dehydrogenase; Validated | 100.0 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid | 100.0 | |
| PRK06300 | 298 | enoyl-(acyl carrier protein) reductase; Provisional | 100.0 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 100.0 | |
| PRK07677 | 254 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07231 | 250 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK08643 | 256 | acetoin reductase; Validated | 100.0 | |
| PRK12743 | 253 | acetoin dehydrogenase; Provisional | 100.0 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12859 | 257 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona | 100.0 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 100.0 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 100.0 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 100.0 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid | 100.0 | |
| PRK12745 | 259 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona | 100.0 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 100.0 | |
| PRK12748 | 257 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provisiona | 100.0 | |
| PRK06550 | 237 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07856 | 254 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 100.0 | |
| PRK05717 | 255 | oxidoreductase; Validated | 100.0 | |
| PRK08642 | 254 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| TIGR01963 | 258 | PHB_DH 3-hydroxybutyrate dehydrogenase; InterPro: IPR01 | 100.0 | |
| PRK06947 | 252 | glucose-1-dehydrogenase; Provisional | 100.0 | |
| PRK06123 | 249 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08220 | 253 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 100.0 | |
| TIGR01829 | 244 | AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR | 100.0 | |
| PRK07791 | 285 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06077 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh | 100.0 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 100.0 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09730 | 247 | hypothetical protein; Provisional | 100.0 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase | 100.0 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 100.0 | |
| PRK07074 | 256 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 100.0 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09134 | 256 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK09186 | 255 | flagellin modification protein A; Provisional | 100.0 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08324 | 676 | short chain dehydrogenase; Validated | 100.0 | |
| PRK08261 | 447 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas | 100.0 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07707 | 239 | consensus | 100.0 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 100.0 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07792 | 303 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK07041 | 240 | short chain dehydrogenase; Provisional | 100.0 | |
| TIGR02415 | 258 | 23BDH acetoin reductases; InterPro: IPR014007 One membe | 100.0 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08945 | 245 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07775 | 275 | short chain dehydrogenase; Provisional | 100.0 | |
| TIGR01832 | 249 | kduD 2-deoxy-D-gluconate 3-dehydrogenase; InterPro: IPR | 100.0 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 100.0 | |
| PRK07666 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 100.0 | |
| PRK06483 | 236 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG1200 | 256 | consensus | 100.0 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG0725 | 270 | consensus | 100.0 | |
| PRK06940 | 277 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK10538 | 248 | 3-hydroxy acid dehydrogenase; Provisional | 100.0 | |
| PRK07326 | 235 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK12428 | 261 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 100.0 | |
| PRK05866 | 290 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06139 | 324 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 100.0 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06194 | 301 | hypothetical protein; Provisional | 100.0 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 100.0 | |
| TIGR02632 | 709 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol | 100.0 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 100.0 | |
| PRK07201 | 663 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08219 | 226 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08267 | 258 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 100.0 | |
| PRK07109 | 338 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK09072 | 262 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08264 | 235 | short chain dehydrogenase; Validated | 100.0 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK07024 | 256 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK08017 | 256 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG1207 | 245 | consensus | 100.0 | |
| TIGR02685 | 283 | pter_reduc_Leis pteridine reductase; InterPro: IPR01405 | 100.0 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown specificit | 100.0 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities (relat | 100.0 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06101 | 241 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 100.0 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG1205 | 282 | consensus | 100.0 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 100.0 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substrate sp | 100.0 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, pu | 100.0 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG1199 | 260 | consensus | 100.0 | |
| PRK06196 | 316 | oxidoreductase; Provisional | 100.0 | |
| KOG4169 | 261 | consensus | 100.0 | |
| PRK05854 | 314 | short chain dehydrogenase; Provisional | 100.0 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 100.0 | |
| KOG1209 | 289 | consensus | 100.0 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 99.97 | |
| KOG1208 | 314 | consensus | 99.97 | |
| KOG1204 | 253 | consensus | 99.97 | |
| KOG1210 | 331 | consensus | 99.96 | |
| pfam08643 | 296 | DUF1776 Fungal family of unknown function (DUF1776). Th | 99.94 | |
| TIGR01500 | 267 | sepiapter_red sepiapterin reductase; InterPro: IPR00639 | 99.88 | |
| pfam02719 | 280 | Polysacc_synt_2 Polysaccharide biosynthesis protein. Th | 99.72 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This enzy | 99.69 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases [Cell | 99.65 | |
| PRK07424 | 410 | bifunctional sterol desaturase/short chain dehydrogenas | 99.65 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 99.58 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 99.57 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequences | 99.55 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein; Pro | 99.52 | |
| KOG1502 | 327 | consensus | 99.52 | |
| PRK12367 | 250 | short chain dehydrogenase; Provisional | 99.51 | |
| pfam01073 | 280 | 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase | 99.51 | |
| pfam01370 | 235 | Epimerase NAD dependent epimerase/dehydratase family. T | 99.5 | |
| pfam04321 | 284 | RmlD_sub_bind RmlD substrate binding domain. L-rhamnose | 99.42 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell enve | 99.34 | |
| KOG4022 | 236 | consensus | 99.29 | |
| TIGR01181 | 340 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase; InterPro: | 99.15 | |
| CHL00194 | 319 | ycf39 Ycf39; Provisional | 99.13 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biog | 99.12 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 99.1 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisio | 99.01 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi | 99.01 | |
| TIGR01214 | 317 | rmlD dTDP-4-dehydrorhamnose reductase; InterPro: IPR005 | 98.93 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | 98.92 | |
| pfam05368 | 232 | NmrA NmrA-like family. NmrA is a negative transcription | 98.9 | |
| PRK07201 | 663 | short chain dehydrogenase; Provisional | 98.78 | |
| COG4982 | 866 | 3-oxoacyl-[acyl-carrier protein] | 98.76 | |
| KOG1430 | 361 | consensus | 98.61 | |
| COG1089 | 345 | Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis | 98.55 | |
| TIGR03649 | 285 | ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G | 98.54 | |
| TIGR01746 | 405 | Thioester-redct thioester reductase domain; InterPro: I | 98.42 | |
| TIGR01777 | 307 | yfcH conserved hypothetical protein TIGR01777; InterPro | 98.16 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [Gener | 98.08 | |
| KOG1431 | 315 | consensus | 97.99 | |
| TIGR02197 | 353 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase; | 97.85 | |
| TIGR01472 | 365 | gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368 Th | 97.82 | |
| KOG1429 | 350 | consensus | 97.66 | |
| COG0702 | 275 | Predicted nucleoside-diphosphate-sugar epimerases [Cell | 97.65 | |
| PRK10754 | 327 | quinone oxidoreductase, NADPH-dependent; Provisional | 97.54 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 97.44 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.22 | |
| PRK13771 | 332 | putative alcohol dehydrogenase; Provisional | 97.21 | |
| PRK07531 | 489 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera | 97.03 | |
| PRK08268 | 503 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.93 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog | 96.79 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex subun | 96.67 | |
| COG3007 | 398 | Uncharacterized paraquat-inducible protein B [Function | 96.62 | |
| PRK05396 | 341 | tdh L-threonine 3-dehydrogenase; Validated | 96.32 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP-4-am | 96.16 | |
| KOG1372 | 376 | consensus | 96.15 | |
| PRK10309 | 347 | galactitol-1-phosphate dehydrogenase; Provisional | 95.96 | |
| PRK09422 | 338 | alcohol dehydrogenase; Provisional | 94.96 | |
| TIGR02823 | 330 | oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP f | 94.55 | |
| PRK10083 | 339 | putative dehydrogenase; Provisional | 94.53 | |
| TIGR01085 | 494 | murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP | 93.39 | |
| KOG1196 | 343 | consensus | 92.44 | |
| pfam08659 | 181 | KR KR domain. This enzymatic domain is part of bacteria | 100.0 | |
| KOG1201 | 300 | consensus | 100.0 | |
| pfam00106 | 167 | adh_short short chain dehydrogenase. This family contai | 100.0 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial polyk | 100.0 | |
| KOG1610 | 322 | consensus | 99.97 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alanine es | 99.96 | |
| KOG1014 | 312 | consensus | 99.96 | |
| KOG1611 | 249 | consensus | 99.94 | |
| KOG1478 | 341 | consensus | 99.66 | |
| TIGR01289 | 321 | LPOR light-dependent protochlorophyllide reductase; Int | 99.58 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 99.52 | |
| TIGR01179 | 341 | galE UDP-glucose 4-epimerase; InterPro: IPR005886 Synon | 99.2 | |
| pfam07993 | 245 | NAD_binding_4 Male sterility protein. This family repre | 99.12 | |
| KOG1371 | 343 | consensus | 99.08 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, | 99.06 | |
| TIGR02622 | 361 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase; InterPro: I | 99.04 | |
| TIGR02813 | 2773 | omega_3_PfaA polyketide-type polyunsaturated fatty acid | 98.63 | |
| KOG1202 | 2376 | consensus | 98.34 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional non-ri | 98.27 | |
| PRK13656 | 400 | trans-2-enoyl-CoA reductase; Provisional | 98.27 | |
| PRK08293 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.47 | |
| PRK09260 | 289 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.47 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.47 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 97.17 | |
| PRK07660 | 283 | consensus | 97.16 | |
| KOG1203 | 411 | consensus | 97.16 | |
| PRK06130 | 310 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 97.07 | |
| KOG0747 | 331 | consensus | 96.88 | |
| PRK09117 | 282 | consensus | 96.86 | |
| TIGR02813 | 2773 | omega_3_PfaA polyketide-type polyunsaturated fatty acid | 96.76 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 96.04 | |
| TIGR01139 | 312 | cysK cysteine synthase A; InterPro: IPR005859 This mode | 95.64 | |
| KOG2774 | 366 | consensus | 95.62 | |
| PRK08269 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.71 | |
| PRK11154 | 706 | fadJ multifunctional fatty acid oxidation complex subun | 94.46 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal structu | 93.99 | |
| KOG4039 | 238 | consensus | 93.62 | |
| PRK06720 | 169 | hypothetical protein; Provisional | 100.0 | |
| KOG1221 | 467 | consensus | 97.97 | |
| KOG2865 | 391 | consensus | 97.29 | |
| PRK12320 | 699 | hypothetical protein; Provisional | 97.16 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 97.14 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-dependent ox | 96.78 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 96.77 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 96.6 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism associate | 96.57 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General funct | 96.29 | |
| TIGR02853 | 288 | spore_dpaA dipicolinic acid synthetase, A subunit; Inte | 96.06 | |
| TIGR03201 | 349 | dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh | 95.83 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-dependent de | 95.64 | |
| TIGR00438 | 192 | rrmJ ribosomal RNA large subunit methyltransferase J; I | 95.52 | |
| pfam00107 | 131 | ADH_zinc_N Zinc-binding dehydrogenase. | 95.17 | |
| PTZ00082 | 322 | L-lactate dehydrogenase; Provisional | 94.74 | |
| PRK08181 | 269 | transposase; Validated | 94.48 | |
| PRK09183 | 258 | transposase/IS protein; Provisional | 94.29 | |
| pfam01262 | 150 | AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai | 94.24 | |
| KOG0023 | 360 | consensus | 93.83 | |
| PRK06526 | 254 | transposase; Provisional | 93.16 | |
| PRK05134 | 233 | 3-demethylubiquinone-9 3-methyltransferase; Provisional | 91.83 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport and met | 90.74 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate | 90.63 | |
| TIGR00537 | 183 | hemK_rel_arch methylase, putative; InterPro: IPR004557 | 90.46 | |
| PRK08261 | 447 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 98.98 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene tetr | 98.64 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related proteins [A | 98.06 | |
| PRK08309 | 182 | short chain dehydrogenase; Provisional | 97.86 | |
| TIGR00507 | 286 | aroE shikimate 5-dehydrogenase; InterPro: IPR011342 The | 97.69 | |
| PRK05579 | 392 | bifunctional phosphopantothenoylcysteine decarboxylase/ | 97.44 | |
| pfam03435 | 384 | Saccharop_dh Saccharopine dehydrogenase. This family co | 97.43 | |
| pfam01488 | 134 | Shikimate_DH Shikimate / quinate 5-dehydrogenase. This | 97.41 | |
| KOG2733 | 423 | consensus | 97.36 | |
| PRK09620 | 229 | hypothetical protein; Provisional | 97.34 | |
| PRK02006 | 501 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 97.34 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat | 97.28 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 97.23 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transport an | 97.21 | |
| smart00829 | 288 | PKS_ER Enoylreductase. Enoylreductase in Polyketide syn | 97.21 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 97.09 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 97.06 | |
| pfam04127 | 197 | DFP DNA / pantothenate metabolism flavoprotein. The DNA | 97.02 | |
| PRK06849 | 387 | hypothetical protein; Provisional | 96.97 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/shikima | 96.79 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of gl | 96.69 | |
| KOG1198 | 347 | consensus | 96.66 | |
| PRK00258 | 275 | aroE shikimate 5-dehydrogenase; Reviewed | 96.65 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 96.63 | |
| PRK09496 | 455 | trkA potassium transporter peripheral membrane componen | 96.48 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [Inorg | 96.48 | |
| PRK13265 | 157 | glycine/sarcosine/betaine reductase complex protein A; | 96.31 | |
| PRK13982 | 476 | bifunctional SbtC-like/phosphopantothenoylcysteine deca | 96.3 | |
| PRK09496 | 455 | trkA potassium transporter peripheral membrane componen | 96.16 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 96.13 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 96.04 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 95.95 | |
| TIGR02021 | 224 | BchM-ChlM magnesium protoporphyrin O-methyltransferase; | 95.91 | |
| TIGR02114 | 253 | coaB_strep phosphopantothenate--cysteine ligase; InterP | 95.85 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 95.69 | |
| pfam02254 | 115 | TrkA_N TrkA-N domain. This domain is found in a wide va | 95.47 | |
| TIGR02824 | 334 | quinone_pig3 putative NAD(P)H quinone oxidoreductase, P | 95.47 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo | 95.31 | |
| COG3268 | 382 | Uncharacterized conserved protein [Function unknown] | 95.24 | |
| PRK06732 | 228 | phosphopantothenate--cysteine ligase; Validated | 95.21 | |
| PRK00141 | 476 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 95.13 | |
| PRK09424 | 510 | pntA NAD(P) transhydrogenase subunit alpha; Provisional | 94.88 | |
| pfam04723 | 150 | GRDA Glycine reductase complex selenoprotein A. Found i | 94.83 | |
| pfam00670 | 162 | AdoHcyase_NAD S-adenosyl-L-homocysteine hydrolase, NAD | 94.53 | |
| PRK12490 | 298 | 6-phosphogluconate dehydrogenase-like protein; Reviewed | 94.3 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Reviewed | 93.91 | |
| COG0027 | 394 | PurT Formate-dependent phosphoribosylglycinamide formyl | 93.12 | |
| KOG0024 | 354 | consensus | 92.94 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General functio | 92.85 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabol | 92.64 | |
| pfam00148 | 398 | Oxidored_nitro Nitrogenase component 1 type Oxidoreduct | 92.56 | |
| PRK12767 | 325 | carbamoyl phosphate synthase-like protein; Provisional | 92.22 | |
| TIGR01915 | 233 | npdG NADPH-dependent F420 reductase; InterPro: IPR01018 | 91.55 | |
| PRK11559 | 295 | garR tartronate semialdehyde reductase; Provisional | 91.47 | |
| PRK05476 | 427 | S-adenosyl-L-homocysteine hydrolase; Provisional | 91.17 | |
| PRK04663 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 91.16 | |
| PRK00257 | 379 | erythronate-4-phosphate dehydrogenase; Validated | 91.05 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 90.97 | |
| KOG2250 | 514 | consensus | 90.93 | |
| pfam05221 | 430 | AdoHcyase S-adenosyl-L-homocysteine hydrolase. | 90.74 | |
| PTZ00075 | 476 | S-adenosyl-L-homocysteine hydrolase; Provisional | 90.57 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function predic | 90.46 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycas | 90.24 | |
| PRK00045 | 429 | hemA glutamyl-tRNA reductase; Reviewed | 97.18 | |
| TIGR01035 | 436 | hemA glutamyl-tRNA reductase; InterPro: IPR000343 Tetra | 96.51 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 96.31 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related dehydro | 94.57 | |
| PRK13581 | 524 | D-3-phosphoglycerate dehydrogenase; Provisional | 93.05 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin | 96.77 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.62 | |
| PRK03369 | 487 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 96.56 | |
| PRK01390 | 457 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 96.55 | |
| PRK02472 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 96.47 | |
| PRK01438 | 481 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 96.36 | |
| KOG0069 | 336 | consensus | 96.29 | |
| pfam02737 | 180 | 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do | 96.03 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 95.86 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of amino a | 95.32 | |
| pfam00208 | 237 | ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine de | 95.22 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferrochelat | 95.14 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta | 95.05 | |
| pfam02826 | 176 | 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen | 94.97 | |
| PRK03806 | 438 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 94.85 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 94.84 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 94.77 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogenases [ | 94.64 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce | 94.62 | |
| PRK07819 | 284 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.55 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 94.08 | |
| PTZ00079 | 469 | NADP-specific glutamate dehydrogenase; Provisional | 94.01 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain o | 93.98 | |
| COG0334 | 411 | GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami | 93.94 | |
| pfam01210 | 159 | NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd | 93.88 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 93.86 | |
| PRK03803 | 448 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 93.8 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 93.76 | |
| pfam03446 | 163 | NAD_binding_2 NAD binding domain of 6-phosphogluconate | 93.69 | |
| PRK08655 | 441 | prephenate dehydrogenase; Provisional | 93.61 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de | 93.53 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | 93.45 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methy | 93.33 | |
| pfam02882 | 159 | THF_DHG_CYH_C Tetrahydrofolate dehydrogenase/cyclohydro | 93.13 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 93.13 | |
| TIGR02817 | 338 | adh_fam_1 zinc-binding alcohol dehydrogenase family pro | 92.93 | |
| TIGR02352 | 357 | thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 | 92.51 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 92.47 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 92.47 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 92.4 | |
| pfam01695 | 178 | IstB IstB-like ATP binding protein. This protein contai | 92.34 | |
| PRK12409 | 410 | D-amino acid dehydrogenase small subunit; Provisional | 92.26 | |
| TIGR02356 | 210 | adenyl_thiF thiazole biosynthesis adenylyltransferase T | 92.09 | |
| PRK09414 | 446 | glutamate dehydrogenase; Provisional | 91.83 | |
| PRK00421 | 459 | murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona | 91.79 | |
| PRK06522 | 307 | 2-dehydropantoate 2-reductase; Reviewed | 91.56 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 91.09 | |
| PRK08644 | 209 | thiamine biosynthesis protein ThiF; Provisional | 91.05 | |
| pfam03807 | 93 | F420_oxidored NADP oxidoreductase coenzyme F420-depende | 90.74 | |
| KOG1370 | 434 | consensus | 90.53 | |
| PRK01368 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta | 90.53 | |
| PRK06019 | 377 | phosphoribosylaminoimidazole carboxylase ATPase subunit | 90.35 | |
| PRK12475 | 337 | thiamine/molybdopterin biosynthesis MoeB-like protein; | 90.2 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy product | 90.17 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot | 90.15 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like | 90.08 | |
| TIGR01283 | 470 | nifE nitrogenase MoFe cofactor biosynthesis protein Nif | 94.86 | |
| cd01976 | 421 | Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitro | 91.89 | |
| cd01968 | 410 | Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of th | 93.5 | |
| PRK10792 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehydrogen | 90.67 | |
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Meth | 92.78 |
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase; InterPro: IPR011284 This entry represents 3-oxoacyl-[ACP] reductase, also called 3-ketoacyl-acyl carrier protein reductase, an enzyme of fatty acid biosynthesis found in many plant and bacterial species | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|