>TIGR02110 PQQ_syn_pqqF coenzyme PQQ biosynthesis protein PqqF; InterPro: IPR011844 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site . The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases . Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. This family of metallopeptidases belong to MEROPS peptidase family M16, subfamily M16A (clan ME). In the subset of species that make coenzyme PQQ (pyrrolo-quinoline-quinone), this peptidase is found in the PQQ biosynthesis region and is thought to act as a protease on PqqA (IPR011725 from INTERPRO), a probable peptide precursor of the coenzyme. PQQ is required for some glucose dehydrogenases and alcohol dehydrogenases .; GO: 0008234 cysteine-type peptidase activity, 0008270 zinc ion binding, 0018189 pyrroloquinoline quinone biosynthetic process.

Probab=99.93 E-value=3.6e-28 Score=207.90 Aligned_cols=389 Identities=20% Similarity=0.215 Sum_probs=267.7 Q ss_pred EEEECCC------CCEEEE-ECCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHH-HHHHHHHHCCEE Q ss_conf 8998798------719999-85899879999998331144888898348999989733568889889-999999708767 Q gi|254780464|r 4 RISKTSS------GITVIT-EVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE-IVEEIEKVGGDI 75 (424) Q Consensus 4 ~~~~L~N------Gl~v~~-~~~~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~-~~~~l~~~G~~~ 75 (424) T Consensus 1 R~~TL~nhWrPCqGLr~~L~H~P~a~RaAA~lRVAAGSHDeP~awPGLAHfLEHLlFlG~ErF~~d~rLM~wvQ~qGGQV 80 (737) T TIGR02110 1 RRITLANHWRPCQGLRVHLVHDPAAKRAAALLRVAAGSHDEPSAWPGLAHFLEHLLFLGGERFQGDDRLMPWVQRQGGQV 80 (737) T ss_pred CEEECCCCCCCCCCCCEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCHHHHHCCCCC T ss_conf 90205888864523210014670357999999975166664014665488999997303111457666208986238851 Q ss_pred EEEECCCEEEEEEECCCCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCC Q ss_conf 99753223799961266565210012223221035662001124556766665113321110000001222222222222 Q gi|254780464|r 76 NAYTSLEHTSYHAWVLKEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRP 155 (424) Q Consensus 76 na~t~~d~~~~~~~~~~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~ 155 (424) T Consensus 81 NA~T~~r~t~fFFElpA~Ala~Gl~RL~~MLA~Pll~~~dq~REreVl~AEy~a~~~da~~~~~aAl~~~~~a~hplRrF 160 (737) T TIGR02110 81 NASTLERTTDFFFELPAEALAAGLARLCDMLARPLLTIEDQQREREVLEAEYIAWQADAQTRREAALLDALSAAHPLRRF 160 (737) T ss_pred CCCHHCCCCHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCHH T ss_conf 00020134203455799999867999999864203129999887999999999985056579999998357877611011 Q ss_pred CCCHHHHHH----HHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCEE---EE Q ss_conf 221034420----00166776420112456630000025455122112211012358777788664223322102---33 Q gi|254780464|r 156 ILGKPETIS----SFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESMKPAVYVGGE---YI 228 (424) Q Consensus 156 ~~g~~~~i~----~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~~p~~~~~~~---~~ 228 (424) T Consensus 161 ~aG~R~sL~~~~~Af-Q~AL~~FH~~~Y~A~~M~LwLqGPQsL~ELe~LA~R~ga~L~~G~~~~~~~P~~L~~~~~~~l~ 239 (737) T TIGR02110 161 HAGSRDSLALPNDAF-QQALRDFHRRHYQAGNMQLWLQGPQSLDELEELAARFGASLAAGEELAQAAPAPLLKFAALTLA 239 (737) T ss_pred HCCCHHHCCCCHHHH-HHHHHHHHHHHHHHHCCEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHH T ss_conf 023515316984899-9999999998404430403048798778999999998201447788788878555612689987 Q ss_pred ECCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHHHC-CCCCCCCCCCCCCCCCCCHHHHHH-HHHHCCCCEEEEE---EC Q ss_conf 036843210230100001352113568998777624-876532222000268621013332-2210122013444---25 Q gi|254780464|r 229 QKRDLAEEHMMLGFNGCAYQSRDFYLTNILASILGD-GMSSRLFQEVREKRGLCYSISAHH-ENFSDNGVLYIAS---AT 303 (424) Q Consensus 229 ~~~~~~~~~i~~~~~~~~~~~~d~~al~ll~~iLg~-g~sSrL~~~lRe~~glaY~v~s~~-~~~~~~g~~~i~~---~~ 303 (424) T Consensus 240 ~~~~~P-~~l~L~fa~~~l~~~~~~~V~~L~~~L~d~~PGg-LlA~L~~-r~L~es~~a~~Lyqd~~QaLLaL~F~~~~~ 316 (737) T TIGR02110 240 ERSEGP-ERLWLLFALEALPAAAEDAVTLLCEFLQDEAPGG-LLAELRE-RGLAESLAATWLYQDAGQALLALEFEARSV 316 (737) T ss_pred HHCCCC-HHHHHHHHHHHCHHHHHHHHHHHHHHHHCCCCHH-HHHHHHH-HHHHCCHHCCHHHHHHHHHHHHHHHHHCCC T ss_conf 414782-1467888865133117999999999863148711-6899987-652100202000125556889988752467 Q ss_pred CCCHHHHHHHHHHHHHHHHCC----------CCCHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCCCCCCHHHHH Q ss_conf 830247778778999985314----------8998999999999999998513898999999999999689847989999 Q gi|254780464|r 304 AKENIMALTSSIVEVVQSLLE----------NIEQREIDKECAKIHAKLIKSQERSYLRALEISKQVMFCGSILCSEKII 373 (424) Q Consensus 304 ~~~~~~~~~~~i~~~i~~l~~----------~i~~~el~~ak~~~~~~~~~~~~~~~~~a~~l~~~~~~~~~~~~~~~~~ 373 (424) T Consensus 317 SA~~a~~~~~~~~~WL~al~~~a~sllaarrPlwa~~~~~Y~~L~qR~l~~~--~~~~L~~l~~R~~~~~l~~~~~~~l~ 394 (737) T TIGR02110 317 SAAAAEQVEELLTEWLGALKEQAASLLAARRPLWAELLEEYERLEQRRLQLA--ALLPLAQLDARALGFALGEALPAALK 394 (737) T ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHH--HCCCHHHHHHHHHHCCCCCCCHHHHH T ss_conf 8453689999999999999998999987304667436658988877776543--04876677777420266757637899 Q ss_pred HHHHCCCHHHHHHHHHHH-CCCCCEE Q ss_conf 988727989999999986-2778779 Q gi|254780464|r 374 DTISAITCEDIVGVAKKI-FSSTPTL 398 (424) Q Consensus 374 ~~i~~vt~~di~~~~~~~-l~~~~~i 398 (424) T Consensus 395 ~~~~~L~~~p~~~l~~q~~~pg~p~~ 420 (737) T TIGR02110 395 DFLAALQDAPSVRLATQTRLPGAPFA 420 (737) T ss_pred HHHHHCCHHHHHHHHHCCCCCCHHHH T ss_conf 99984222245565530458704778

HHsearch alignment for GI: 254780464 and conserved domain: TIGR02110