HHsearch alignment for GI: 254780464 and conserved domain: pfam00675

>pfam00675 Peptidase_M16 Insulinase (Peptidase family M16).
Probab=100.00  E-value=1.2e-32  Score=237.88  Aligned_cols=147  Identities=41%  Similarity=0.650  Sum_probs=142.1

Q ss_pred             EEEEECC-CCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHHHHHHHHHHCCEEEEEECCCEEEEEEECC
Q ss_conf             9999858-998799999983311448888983489999897335688898899999997087679975322379996126
Q gi|254780464|r   13 TVITEVM-PIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKEIVEEIEKVGGDINAYTSLEHTSYHAWVL   91 (424)
Q Consensus        13 ~v~~~~~-~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~~~~~l~~~G~~~na~t~~d~~~~~~~~~   91 (424)
T Consensus         1 rVv~~~~~~~p~~si~l~v~~Gs~~E~~~~~Glahlle~~~f~Gt~~~~~~~i~~~~e~~G~~~na~t~~d~t~~~~~~l   80 (149)
T pfam00675         1 RVALEHDPPADTSAVGLWVDAGSRYEPDDNNGLAHFLEHMAFKGTKKYPSNELEEELEKLGGSLNAYTSREHTVYYVEVL   80 (149)
T ss_pred             CEEEEECCCCCEEEEEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCEEEEEECC
T ss_conf             98999769999799999977036888999722999999997289988982689999998496687641578569996066


Q ss_pred             CCCCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCCCCCCCCCCCCCH
Q ss_conf             65652100122232210356620011245567666651133211100000012222222222222210
Q gi|254780464|r   92 KEHVPLALEIIGDMLSNSSFNPSDIERERNVVLEEIGMSEDDSWDFLDARFSEMVWKDQIIGRPILGK  159 (424)
Q Consensus        92 ~~~~~~~l~ll~~~~~~p~~~~~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f~~~~~~~~~~g~  159 (424)
T Consensus        81 ~~~~~~~l~ll~d~l~~p~f~~~e~e~ek~~v~~e~~~~~~~p~~~~~~~l~~~~f~~hpyg~p~~G~  148 (149)
T pfam00675        81 NDDLPKAVDRLADFFLNPLFSPSEVERERLVVEYEVEAVDAEPQEVLLDNLHAAAYRGTPLGRSLLGP  148 (149)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCC
T ss_conf             88999999999998518899999999999999999998876989999999999852999899998789