HHsearch results for GI: 254780464 and protein with PDBid: 2fge_A

>2fge_A Atprep2;, zinc metalloprotease (insulinase family); peptidasome, protease-peptide complex, hydrolase, plant protein; 2.10A {Arabidopsis thaliana} SCOP: d.185.1.1 d.185.1.1 d.185.1.1 d.185.1.1
Probab=100.00  E-value=0  Score=364.88  Aligned_cols=393  Identities=14%  Similarity=0.133  Sum_probs=297.9

Q ss_pred             CCCCCEEEEECCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHCCCCCCCHHH-HHHHHHH-HCCEEEEEECCCEEE
Q ss_conf             79871999985899879999998331144888898348999989733568889889-9999997-087679975322379
Q gi|254780464|r    8 TSSGITVITEVMPIDSAFVKVNIRAGSRNERQEEHGMAHFLEHMLFKGTTKRTAKE-IVEEIEK-VGGDINAYTSLEHTS   85 (424)
Q Consensus         8 L~NGl~v~~~~~~~~~~~i~~~~~~Gs~~e~~~~~G~ah~lehl~~~gt~~~~~~~-~~~~l~~-~G~~~na~t~~d~~~   85 (424)
                      -++|++|++.+++.+--.+++.|    +.+|.+..|+||+||||+|+||++||..+ +.+.+.. +|+.+||+|+.|+|+
T Consensus        43 ~~tg~~~~~~~~~d~~~~f~i~f----~T~p~d~~G~aH~lEHm~f~GS~kyp~~~~~~~~~~~~~g~~~NA~T~~d~T~  118 (995)
T 2fge_A           43 KKTGCEVMSVSNEDENKVFGVVF----RTPPKDSTGIPHILQHSVLCGSRKYPVKEPFVELLKGSLHTFLNAFTYPDRTC  118 (995)
T ss_dssp             TTTCCEEEEEECSCSSEEEEEEE----ECCCSSSSCHHHHHHHHTTSCBTTBCSSCHHHHHHHHCCEEEECCEECSSEEE
T ss_pred             CCCCCEEEEEECCCCCCEEEEEE----CCCCCCCCCCHHHHHHHHHCCCCCCCCCCHHHHHHHHCCCCCCCCCCCCCEEE
T ss_conf             47897899984289777689995----78996898617999986718999989997599999970399823544897578


Q ss_pred             EEEECCC-CCCCCCHHHHHHHHHCCCCCC-----------------CHHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCC
Q ss_conf             9961266-565210012223221035662-----------------0011245567666651133211100000012222
Q gi|254780464|r   86 YHAWVLK-EHVPLALEIIGDMLSNSSFNP-----------------SDIERERNVVLEEIGMSEDDSWDFLDARFSEMVW  147 (424)
Q Consensus        86 ~~~~~~~-~~~~~~l~ll~~~~~~p~~~~-----------------~~~~~ek~~v~~e~~~~~~~p~~~~~~~~~~~~f  147 (424)
                      |+++++. +++..+|+++.|.+.+|.+.+                 +...+||++|.+|+++..++|.+++++.+.+.+|
T Consensus       119 Y~~~~~~~~~~~~~l~v~~d~~~~p~~~~~~~~f~~E~~~~~~~~~~~~~~e~gvV~~E~~~~~~~~~~~~~~~~~~~l~  198 (995)
T 2fge_A          119 YPVASTNTKDFYNLVDVYLDAVFFPKCVDDAHTFQQEGWHYELNDPSEDISYKGVVFNEMKGVYSQPDNILGRIAQQALS  198 (995)
T ss_dssp             EEEEESSHHHHHHHHHHHHHHHHSBGGGTSSHHHHHHTCEEECSCTTSCCEEECHHHHHHHHHTTSHHHHHHHHHHHHHC
T ss_pred             EEEECCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHC
T ss_conf             98723898899998999999875866203467898877653036815767766199999986528999999999999847


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCC----CCCCCC
Q ss_conf             2222222222103442000166776420112456630000025455122112211012358777788664----223322
Q gi|254780464|r  148 KDQIIGRPILGKPETISSFTPEKIISFVSRNYTADRMYVVCVGAVDHEFCVSQVESYFNVCSVAKIKESM----KPAVYV  223 (424)
Q Consensus       148 ~~~~~~~~~~g~~~~i~~lt~~~l~~f~~~~y~p~n~~l~i~Gd~~~~~~~~~i~~~f~~~~~~~~~~~~----~p~~~~  223 (424)
                      ++|||+++++|++++|++++.++|++||++||+|+||+|+|+||+|++++.++|+++|+.|+..+.+...    .+....
T Consensus       199 ~~~~y~~~~~G~~~~I~~lt~e~l~~fy~~~Y~P~n~~lvi~Gd~d~~~~~~~i~~~f~~~~~~~~~~~~~~~~~~~~~~  278 (995)
T 2fge_A          199 PENTYGVDSGGDPKDIPNLTFEEFKEFHRQYYHPSNARIWFYGDDDPVHRLRVLSEYLDMFEASPSPNSSKIKFQKLFSE  278 (995)
T ss_dssp             TTSGGGSCTTCCTTTGGGCCHHHHHHHHHHHSSGGGEEEEEEESSCHHHHHHHHHHHHTTCCCCSHHHHSCCCCCCCCSS
T ss_pred             CCCCCCCCCCCCHHHHHHCCHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
T ss_conf             99989889998988871079999999999848825569999869999999999999862477688887666788877778


Q ss_pred             CEEEEE-------CCCCCCCEEEECCCCC--CCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCC
Q ss_conf             102330-------3684321023010000--1352113568998777624876532222000268621013332221012
Q gi|254780464|r  224 GGEYIQ-------KRDLAEEHMMLGFNGC--AYQSRDFYLTNILASILGDGMSSRLFQEVREKRGLCYSISAHHENFSDN  294 (424)
Q Consensus       224 ~~~~~~-------~~~~~~~~i~~~~~~~--~~~~~d~~al~ll~~iLg~g~sSrL~~~lRe~~glaY~v~s~~~~~~~~  294 (424)
                      ......       .....+..+.++|..+  +.+.++.+++.+++.+|+++.+|+|++.++++...++.+.+++......
T Consensus       279 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~vl~~lL~~~~~s~l~~~l~~~~~~~~~~~~~~~~~~~~  358 (995)
T 2fge_A          279 PVRLVEKYPAGRDGDLKKKHMLCVNWLLSEKPLDLQTQLALGFLDHLMLGTPASPLRKILLESGLGEALVSSGLSDELLQ  358 (995)
T ss_dssp             CEEEEEEEECCSSSCGGGCEEEEEEEECCSSCCCHHHHHHHHHHHHHHHSSTTSHHHHHHHHTTSCSEECSCEEECSSSS
T ss_pred             CEEEEEECCCCCCCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             73689834655545445305899996069887688999999999987247863127999986046723777302333457


Q ss_pred             CCEEEEE-ECCCCHHHHHHHHHHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHCCCH----HHHHHHHHHHHHHCCCCCC
Q ss_conf             2013444-2583024777877899998531-48998999999999999998513898----9999999999996898479
Q gi|254780464|r  295 GVLYIAS-ATAKENIMALTSSIVEVVQSLL-ENIEQREIDKECAKIHAKLIKSQERS----YLRALEISKQVMFCGSILC  368 (424)
Q Consensus       295 g~~~i~~-~~~~~~~~~~~~~i~~~i~~l~-~~i~~~el~~ak~~~~~~~~~~~~~~----~~~a~~l~~~~~~~~~~~~  368 (424)
                      +.|.+.. .+.+++..++.+.+.++++++. .|++++++++++++++.++....++.    ...+..+...+.+++++..
T Consensus       359 ~~~~i~~~~~~~~~~~~~~~~i~~~l~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  438 (995)
T 2fge_A          359 PQFGIGLKGVSEENVQKVEELIMDTLKKLAEEGFDNDAVEASMNTIEFSLRENNTGSFPRGLSLMLQSISKWIYDMDPFE  438 (995)
T ss_dssp             CEEEEEEEEECGGGHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCTTSCHHHHHHHHHHHHHTTTSCSSG
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHH
T ss_conf             52799996377212899999999999999965998799999999999999976315654047999999974104699047


Q ss_pred             ---HHHHHHHHHC-----CCHHHHHHHHHHHCCCCC-EEEEEECC
Q ss_conf             ---8999998872-----798999999998627787-79998166
Q gi|254780464|r  369 ---SEKIIDTISA-----ITCEDIVGVAKKIFSSTP-TLAILGPP  404 (424)
Q Consensus       369 ---~~~~~~~i~~-----vt~~di~~~~~~~l~~~~-~i~~vgp~  404 (424)
                         .....+.+.+     +....++..+++|+-.++ .++++..|
T Consensus       439 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~p  483 (995)
T 2fge_A          439 PLKYTEPLKALKTRIAEEGSKAVFSPLIEKLILNNSHRVTIEMQP  483 (995)
T ss_dssp             GGCCHHHHHHHHHHHHHHCHHHHHHHHHHHHTTTCCCEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECC
T ss_conf             899899999999999987468889989988512687348998456