RPSBLAST alignment of GI: 254780468 and protein with PDBid: 3hvw

>3hvw_A Diguanylate-cyclase (DGC); alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.70A {Pseudomonas aeruginosa} Length = 176
 Score =  103 bits (258), Expect = 2e-22
 Identities = 27/160 (16%), Positives = 54/160 (33%), Gaps = 5/160 (3%)

Query: 534 FQDNLTGIPNRQSFLDRLTTILDLSATDDNLRPTVMVIDIDKYKKINDVLGIAVGDDVLV 593
             D  TG+ NR    + ++  L        +     ++ +     I   LG    +D+++
Sbjct: 1   MIDEPTGLYNRLRLQEDVSLRLQRDGALTVI--AADLLPLALLNTIIRTLGYPFSNDLML 58

Query: 594 SLTRRIGELLKFPDILARLSGNRFGIILISENNSLKIADFAIAMRKSIAMPINLLEREIT 653
               RI   L     L ++S  RFG++L       +     + + ++   P+      I 
Sbjct: 59  EARDRIRAEL-PDFTLYKISPTRFGLLL-PRQQQEETESVCLRLLRAFESPVVCRGIPIK 116

Query: 654 VTASIGFASWTSSKITSSE-MLKNAELAMYHAKHRGGNHV 692
               +G        +   +  L+    A   A+ RG    
Sbjct: 117 ANVGLGVLPLADDTLDGDQDWLRLVVSAADDARDRGVGWA 156