BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] (63 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780469|ref|YP_003064882.1| zinc-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 63 Score = 131 bits (330), Expect = 2e-33, Method: Compositional matrix adjust. Identities = 63/63 (100%), Positives = 63/63 (100%) Query: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK Sbjct: 1 MQTSDFRSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWLHGEYVIAAVEDEKSEEEVK 60 Query: 61 DIL 63 DIL Sbjct: 61 DIL 63 >gi|254780848|ref|YP_003065261.1| co-chaperonin GroES [Candidatus Liberibacter asiaticus str. psy62] Length = 111 Score = 23.5 bits (49), Expect = 0.70, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 18/35 (51%) Query: 7 RSLKSICPECRKGSMVEFYPFCSTQCRSIDLSRWL 41 +S K I PE KG +V F + T+ + D +L Sbjct: 59 QSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYL 93 >gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 23.1 bits (48), Expect = 1.1, Method: Compositional matrix adjust. Identities = 9/30 (30%), Positives = 17/30 (56%), Gaps = 6/30 (20%) Query: 14 PECRKGSMVEFYPFCSTQCRSIDLSRWLHG 43 P+C G +++ YP R++D ++ LH Sbjct: 75 PDCDSGFILDGYP------RTVDQAKSLHA 98 >gi|254780716|ref|YP_003065129.1| 6-phosphogluconate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 475 Score = 21.9 bits (45), Expect = 2.2, Method: Composition-based stats. Identities = 8/12 (66%), Positives = 9/12 (75%) Query: 27 FCSTQCRSIDLS 38 FC TQ RS+ LS Sbjct: 107 FCDTQIRSLQLS 118 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.133 0.409 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,028 Number of Sequences: 1233 Number of extensions: 1011 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 63 length of database: 328,796 effective HSP length: 34 effective length of query: 29 effective length of database: 286,874 effective search space: 8319346 effective search space used: 8319346 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.4 bits) S2: 31 (16.5 bits)