HHsearch alignment for GI: 254780470 and conserved domain: PRK00276

>PRK00276 infA translation initiation factor IF-1; Validated.
Probab=100.00  E-value=8.2e-35  Score=223.49  Aligned_cols=72  Identities=54%  Similarity=0.864  Sum_probs=70.1

Q ss_pred             CCCCCEEEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEE
Q ss_conf             97564599978999815898179998166776533323354433344555544455555445556882899991251120
Q gi|254780470|r    1 MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRK   80 (110)
Q Consensus         1 M~Ked~ie~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmRk   80 (110)
T Consensus         1 maKed~i~~~G~V~e~lpn~~F~V~Le--------------------------------------ng~~v~a~~sGKmR~   42 (72)
T PRK00276          1 MAKEDVIEMEGTVLETLPNAMFRVELE--------------------------------------NGHEVLAHISGKMRK   42 (72)
T ss_pred             CCCCCEEEEEEEEEEECCCCEEEEEEC--------------------------------------CCCEEEEEECHHEEE
T ss_conf             996554999999999859988999978--------------------------------------999999997413110


Q ss_pred             EEEEEECCCEEEEEECCCCCCCCEEEEEEC
Q ss_conf             164770299699997467578435988429
Q gi|254780470|r   81 HRIRISLGDKVKVAMNPYDMTRARITYRFK  110 (110)
Q Consensus        81 ~~IRIl~GDkV~Ve~SPYDLtkGRItyR~K  110 (110)
T Consensus        43 ~~Iril~GD~V~vE~spYDltkGRIv~R~k   72 (72)
T PRK00276         43 NYIRILPGDKVTVELSPYDLTKGRITYRYK   72 (72)
T ss_pred             EEEEECCCCEEEEEECCCCCCCEEEEEECC
T ss_conf             169975899899998866799578999749