HHsearch alignment for GI: 254780470 and conserved domain: pfam01176

>pfam01176 eIF-1a Translation initiation factor 1A / IF-1. This family includes both the eukaryotic translation factor eIF-1A and the bacterial translation initiation factor IF-1.
Probab=99.72  E-value=2.5e-17  Score=121.91  Aligned_cols=64  Identities=42%  Similarity=0.609  Sum_probs=59.7

Q ss_pred             EEEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEE
Q ss_conf             59997899981589817999816677653332335443334455554445555544555688289999125112016477
Q gi|254780470|r    6 TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRKHRIRI   85 (110)
Q Consensus         6 ~ie~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmRk~~IRI   85 (110)
T Consensus         2 e~e~~g~V~~~lg~~~~~V~~--------------------------------------~dg~~~l~~i~GK~r-kriwi   42 (65)
T pfam01176         2 EGEMIGQVTEMLGNGRFEVEL--------------------------------------EDGHERLAHIPGKRR-KRIWI   42 (65)
T ss_pred             CCEEEEEEEEECCCCEEEEEE--------------------------------------CCCCEEEEEECCCEE-EEEEE
T ss_conf             986999999982998899997--------------------------------------999999999822054-57997


Q ss_pred             ECCCEEEEEECCCCCCCCEEEEE
Q ss_conf             02996999974675784359884
Q gi|254780470|r   86 SLGDKVKVAMNPYDMTRARITYR  108 (110)
Q Consensus        86 l~GDkV~Ve~SPYDLtkGRItyR  108 (110)
T Consensus        43 ~~GD~VlV~~~~~~~~kg~Ii~r   65 (65)
T pfam01176        43 LRGDFVLVELSPYDKVKGRIIYR   65 (65)
T ss_pred             CCCCEEEEEECCCCCCEEEEEEC
T ss_conf             49999999967877863999969