HHsearch alignment of GI: 254780470 and MMDB domain: 3i4o_A_

>3i4o_A (A:) Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis}
Probab=99.93  E-value=5.3e-27  Score=177.71  Aligned_cols=72  Identities=47%  Similarity=0.794  Sum_probs=68.2

Q ss_pred             CCC-CCEEEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEE
Q ss_conf             975-6459997899981589817999816677653332335443334455554445555544555688289999125112
Q gi|254780470|r    1 MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMR   79 (110)
Q Consensus         1 M~K-ed~ie~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmR   79 (110)
                      |+| |+.+|++|+|+|+|||++|+|+|                                      +||+.++||++||||
T Consensus         7 m~kke~~~e~~G~V~~~L~~~~f~V~l--------------------------------------~dg~~~~~~i~GKmr   48 (79)
T 3i4o_A            7 MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------------ENGHKVLAHISGKMR   48 (79)
T ss_dssp             -----CCSEEEEEEEEEETTTEEEEEE--------------------------------------TTSCEEEEEECHHHH
T ss_pred             CCCCCCEEEEEEEEEEECCCCEEEEEE--------------------------------------CCCCEEEEECCCCEE
T ss_conf             666325499999999988998899997--------------------------------------899999997145035


Q ss_pred             EEEEEEECCCEEEEEECCCCCCCCEEEEEEC
Q ss_conf             0164770299699997467578435988429
Q gi|254780470|r   80 KHRIRISLGDKVKVAMNPYDMTRARITYRFK  110 (110)
Q Consensus        80 k~~IRIl~GDkV~Ve~SPYDLtkGRItyR~K  110 (110)
                      +++|+|++||+|.||+||||+|||||+||||
T Consensus        49 k~rI~I~~GD~V~Ve~~~yd~~kg~Ii~Ryr   79 (79)
T 3i4o_A           49 QHYIRILPEDRVVVELSPYDLSRGRIVYRYK   79 (79)
T ss_dssp             HTTCCCCTTCEEEEEEETTEEEEEEEEEECC
T ss_pred             EEEEEECCCCEEEEEECCCCCCCEEEEEECC
T ss_conf             7579944999999996777788588999839