HHsearch results for GI: 254780470 and protein with PDBid: 2dgy_A

>2dgy_A MGC11102 protein; EIF-1A, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}
Probab=97.63  E-value=0.00019  Score=45.71  Aligned_cols=64  Identities=19%  Similarity=0.138  Sum_probs=54.6

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEEEEC
Q ss_conf             99789998158981799981667765333233544333445555444555554455568828999912511201647702
Q gi|254780470|r    8 EFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRKHRIRISL   87 (110)
Q Consensus         8 e~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmRk~~IRIl~   87 (110)
                      +.=+.|+.+|-|.+|.|...                                      ||...+|.+.||||+ ++.|-.
T Consensus        16 q~ia~V~~~~G~~~~~V~c~--------------------------------------dg~~rl~~ipgKfRk-r~wi~~   56 (111)
T 2dgy_A           16 QQIVRVLRTPGNNLHEVETA--------------------------------------QGQRFLVSMPSKYRK-NIWIKR   56 (111)
T ss_dssp             CEEEEEEECCSSSEEEEECT--------------------------------------TSCEEEEECCTTCCS-CCCCCS
T ss_pred             CEEEEEEEECCCCEEEEECC--------------------------------------CCCEEEEEECHHHHC-CEEECC
T ss_conf             69999987039946999969--------------------------------------999999997057334-600007


Q ss_pred             CCEEEEEE-CCCCCCCCEEEEEEC
Q ss_conf             99699997-467578435988429
Q gi|254780470|r   88 GDKVKVAM-NPYDMTRARITYRFK  110 (110)
Q Consensus        88 GDkV~Ve~-SPYDLtkGRItyR~K  110 (110)
                      ||-|.|.. ..++-.|+-|+|+|.
T Consensus        57 Gd~VLV~~~~~~~~~K~DIi~~y~   80 (111)
T 2dgy_A           57 GDFLIVDPIEEGEKVKAEISFVLC   80 (111)
T ss_dssp             SCEEEEEECSSCSSCCEEEEEECC
T ss_pred             CCEEEEEECCCCCCCEEEEEEECC
T ss_conf             999999862027883499999849