HHSEARCH alignment of GI: 254780470 and SCOP domain: d1d7qa_

Alignment
>d1d7qa_ b.40.4.5 (A:) Translation initiation factor-1a, eIF1a {Human (Homo sapiens) [TaxId: 9606]}
Probab=98.88  E-value=2.9e-09  Score=72.42  Aligned_cols=67  Identities=19%  Similarity=0.342  Sum_probs=60.1

Q ss_pred             CEEEEEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEE
Q ss_conf             45999789998158981799981667765333233544333445555444555554455568828999912511201647
Q gi|254780470|r    5 ETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISYLDNAVVIAYTAGRMRKHRIR   84 (110)
Q Consensus         5 d~ie~~G~V~E~LPna~FrV~L~~~d~~~~~~~~l~~~~~~~f~~~g~~~g~~g~~~~s~~~~~~VlA~isGKmRk~~IR   84 (110)
                      +--|+-|+|+++|.|++|.|...                                      +|...+|++.||||+ +++
T Consensus        29 ee~e~ya~V~k~lG~~~~~V~~~--------------------------------------dg~~rl~~irgk~r~-r~~   69 (143)
T d1d7qa_          29 EDGQEYAQVIKMLGNGRLEAMCF--------------------------------------DGVKRLCHIRGKLRK-KVW   69 (143)
T ss_dssp             CTTEEEEEEEEECSSSEEEEEET--------------------------------------TTEEEEEECCSGGGG-SCC
T ss_pred             CCCEEEEEEEEECCCCEEEEEEC--------------------------------------CCCEEEEEECCCCEE-EEE
T ss_conf             99808999999739977999978--------------------------------------999999995376514-789


Q ss_pred             EECCCEEEEEECCCCCCCCEEEEEEC
Q ss_conf             70299699997467578435988429
Q gi|254780470|r   85 ISLGDKVKVAMNPYDMTRARITYRFK  110 (110)
Q Consensus        85 Il~GDkV~Ve~SPYDLtkGRItyR~K  110 (110)
                      |.+||-|.|.+.+|+.+|+.|+|+|.
T Consensus        70 i~~Gd~VlV~~rd~e~~K~DIl~~Y~   95 (143)
T d1d7qa_          70 INTSDIILVGLRDYQDNKADVILKYN   95 (143)
T ss_dssp             CCTTCEEEEECSSSSSSCCEEEEEEC
T ss_pred             EECCCEEEEECCCCCCCEEEEEEECC
T ss_conf             81899999942578685799999789


SCOP domain information

class: All beta proteins
fold: OB-fold
superfamily: Nucleic acid-binding proteins
family: Cold shock DNA-binding domain-like
domain: Translation initiation factor-1a, eIF1a
species: Human (Homo sapiens) [TaxId: 9606]