BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780470|ref|YP_003064883.1| translation initiation factor
IF-1 [Candidatus Liberibacter asiaticus str. psy62]
         (110 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780470|ref|YP_003064883.1| translation initiation factor IF-1 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040147|gb|ACT56943.1| translation initiation factor IF-1 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 110

 Score =  136 bits (342), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 110/110 (100%), Positives = 110/110 (100%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD
Sbjct: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
           PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK
Sbjct: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110


>gi|83312438|ref|YP_422702.1| translation initiation factor 1 [Magnetospirillum magneticum AMB-1]
 gi|82947279|dbj|BAE52143.1| Translation initiation factor 1 [Magnetospirillum magneticum AMB-1]
          Length = 128

 Score =  127 bits (319), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 57  MAKEDVIEFSGTVTELLPNAMFRVKLD--------------------------------- 83

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+R+K
Sbjct: 84  -----NDHEILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRYK 128


>gi|23492404|dbj|BAC17378.1| putative translation initiation factor IF-1 [Corynebacterium
           efficiens YS-314]
          Length = 119

 Score =  124 bits (310), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G V E LPNA FRV+L                                  
Sbjct: 48  MAKEGAIEVEGRVVEPLPNAMFRVELD--------------------------------- 74

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 75  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 119


>gi|108804951|ref|YP_644888.1| translation initiation factor 1 [Rubrobacter xylanophilus DSM 9941]
 gi|119371108|sp|Q1AU52|IF1_RUBXD RecName: Full=Translation initiation factor IF-1
 gi|108766194|gb|ABG05076.1| bacterial translation initiation factor 1 (bIF-1) [Rubrobacter
           xylanophilus DSM 9941]
          Length = 73

 Score =  121 bits (304), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVTEALPNTQFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GD+VKV ++PYD++R RITYR++
Sbjct: 28  -----NGHNVLAHISGKMRMNYIRILPGDRVKVELSPYDLSRGRITYRYR 72


>gi|212637977|ref|YP_002314497.1| translation initiation factor IF-1 [Anoxybacillus flavithermus WK1]
 gi|239825716|ref|YP_002948340.1| translation initiation factor IF-1 [Geobacillus sp. WCH70]
 gi|295401897|ref|ZP_06811860.1| translation initiation factor IF-1 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312109284|ref|YP_003987600.1| translation initiation factor IF-1 [Geobacillus sp. Y4.1MC1]
 gi|212559457|gb|ACJ32512.1| Translation initiation factor 1 (IF-1) [Anoxybacillus flavithermus
           WK1]
 gi|239806009|gb|ACS23074.1| translation initiation factor IF-1 [Geobacillus sp. WCH70]
 gi|294976027|gb|EFG51642.1| translation initiation factor IF-1 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311214385|gb|ADP72989.1| translation initiation factor IF-1 [Geobacillus sp. Y4.1MC1]
          Length = 72

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVEGTVVETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|218779740|ref|YP_002431058.1| translation initiation factor IF-1 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218761124|gb|ACL03590.1| translation initiation factor IF-1 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 72

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDAIEVQGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENKHQVLAHISGKMRMHFIKILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|138893807|ref|YP_001124260.1| translation initiation factor IF-1 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196251001|ref|ZP_03149683.1| translation initiation factor IF-1 [Geobacillus sp. G11MC16]
 gi|190359701|sp|A4IJL1|IF1_GEOTN RecName: Full=Translation initiation factor IF-1
 gi|134265320|gb|ABO65515.1| Initiation factor 1 [Geobacillus thermodenitrificans NG80-2]
 gi|196209473|gb|EDY04250.1| translation initiation factor IF-1 [Geobacillus sp. G11MC16]
          Length = 72

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVEGTVIETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|309389911|gb|ADO77791.1| bacterial translation initiation factor 1 (bIF-1) [Halanaerobium
           praevalens DSM 2228]
          Length = 74

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDPIEVQGTVVEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENGHKVLAHVSGKMRMNFIRILPGDKVTVELSPYDLSRGRITYRHK 72


>gi|172056163|ref|YP_001812623.1| translation initiation factor IF-1 [Exiguobacterium sibiricum
           255-15]
 gi|171988684|gb|ACB59606.1| translation initiation factor IF-1 [Exiguobacterium sibiricum
           255-15]
          Length = 72

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKQDVIEVEGTVIEPLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|56418664|ref|YP_145982.1| translation initiation factor IF-1 [Geobacillus kaustophilus
           HTA426]
 gi|261417630|ref|YP_003251312.1| translation initiation factor IF-1 [Geobacillus sp. Y412MC61]
 gi|297528505|ref|YP_003669780.1| translation initiation factor IF-1 [Geobacillus sp. C56-T3]
 gi|319765288|ref|YP_004130789.1| translation initiation factor IF-1 [Geobacillus sp. Y412MC52]
 gi|73920040|sp|Q5L3R6|IF1_GEOKA RecName: Full=Translation initiation factor IF-1
 gi|56378506|dbj|BAD74414.1| translation initiation factor IF-I [Geobacillus kaustophilus
           HTA426]
 gi|261374087|gb|ACX76830.1| translation initiation factor IF-1 [Geobacillus sp. Y412MC61]
 gi|297251757|gb|ADI25203.1| translation initiation factor IF-1 [Geobacillus sp. C56-T3]
 gi|317110154|gb|ADU92646.1| translation initiation factor IF-1 [Geobacillus sp. Y412MC52]
          Length = 72

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVEGTVIETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDRVTVELSPYDLTRGRITYRYK 72


>gi|52078633|ref|YP_077424.1| translation initiation factor IF-1 [Bacillus licheniformis ATCC
           14580]
 gi|52783995|ref|YP_089824.1| translation initiation factor IF-1 [Bacillus licheniformis ATCC
           14580]
 gi|319649092|ref|ZP_08003300.1| translation initiation factor IF-1 [Bacillus sp. BT1B_CT2]
 gi|59797515|sp|Q65P83|IF1_BACLD RecName: Full=Translation initiation factor IF-1
 gi|52001844|gb|AAU21786.1| initiation factor IF-I [Bacillus licheniformis ATCC 14580]
 gi|52346497|gb|AAU39131.1| InfA [Bacillus licheniformis ATCC 14580]
 gi|317388792|gb|EFV69611.1| translation initiation factor IF-1 [Bacillus sp. BT1B_CT2]
          Length = 72

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|294497008|ref|YP_003560708.1| translation initiation factor IF-1 [Bacillus megaterium QM B1551]
 gi|295702373|ref|YP_003595448.1| translation initiation factor IF-1 [Bacillus megaterium DSM 319]
 gi|294346945|gb|ADE67274.1| translation initiation factor IF-1 [Bacillus megaterium QM B1551]
 gi|294800032|gb|ADF37098.1| translation initiation factor IF-1 [Bacillus megaterium DSM 319]
          Length = 72

 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVAETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|157690923|ref|YP_001485385.1| translation initiation factor IF-1 [Bacillus pumilus SAFR-032]
 gi|194017576|ref|ZP_03056187.1| translation initiation factor IF-1 [Bacillus pumilus ATCC 7061]
 gi|190359571|sp|A8F9A8|IF1_BACP2 RecName: Full=Translation initiation factor IF-1
 gi|157679681|gb|ABV60825.1| initiation factor IF1 [Bacillus pumilus SAFR-032]
 gi|194010848|gb|EDW20419.1| translation initiation factor IF-1 [Bacillus pumilus ATCC 7061]
          Length = 72

 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVAETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|311029073|ref|ZP_07707163.1| translation initiation factor IF-1 [Bacillus sp. m3-13]
          Length = 72

 Score =  120 bits (302), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVIETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|23097596|ref|NP_691062.1| translation initiation factor IF-1 [Oceanobacillus iheyensis
           HTE831]
 gi|29427476|sp|Q8ETW2|IF1_OCEIH RecName: Full=Translation initiation factor IF-1
 gi|22775819|dbj|BAC12097.1| translation initiation factor IF-1 [Oceanobacillus iheyensis
           HTE831]
          Length = 72

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V++ LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVTDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|56961955|ref|YP_173677.1| translation initiation factor IF-1 [Bacillus clausii KSM-K16]
 gi|59797492|sp|Q5WLN9|IF1_BACSK RecName: Full=Translation initiation factor IF-1
 gi|56908189|dbj|BAD62716.1| translation initiation factor IF-I [Bacillus clausii KSM-K16]
          Length = 72

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHKILAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|295694861|ref|YP_003588099.1| translation initiation factor IF-1 [Bacillus tusciae DSM 2912]
 gi|295410463|gb|ADG04955.1| translation initiation factor IF-1 [Bacillus tusciae DSM 2912]
          Length = 72

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 27  ----QNGHKILAHVSGKIRMHYIRILPGDRVTVELSPYDLTRGRITYRYK 72


>gi|15612721|ref|NP_241024.1| translation initiation factor IF-1 [Bacillus halodurans C-125]
 gi|288554749|ref|YP_003426684.1| translation initiation factor IF-1 [Bacillus pseudofirmus OF4]
 gi|317126885|ref|YP_004093167.1| translation initiation factor IF-1 [Bacillus cellulosilyticus DSM
           2522]
 gi|3913888|sp|O50630|IF1_BACHD RecName: Full=Translation initiation factor IF-1
 gi|2760181|dbj|BAA24190.1| initiation factor IF-I [Bacillus halodurans]
 gi|4512427|dbj|BAA75294.1| infA homologue (identity of 90% to B. subtilis ) [Bacillus
           halodurans]
 gi|10172770|dbj|BAB03877.1| translation initiation factor IF-1 [Bacillus halodurans C-125]
 gi|288545909|gb|ADC49792.1| translation initiation factor IF-1 [Bacillus pseudofirmus OF4]
 gi|315471833|gb|ADU28436.1| translation initiation factor IF-1 [Bacillus cellulosilyticus DSM
           2522]
          Length = 72

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHKILAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|229917335|ref|YP_002885981.1| translation initiation factor IF-1 [Exiguobacterium sp. AT1b]
 gi|229468764|gb|ACQ70536.1| translation initiation factor IF-1 [Exiguobacterium sp. AT1b]
          Length = 73

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 2   MAKQDVIEVEGTVVEPLPNAMFKVEL---------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 28  ----ENGHTVLAHVSGKIRMHYIRILPGDRVTVELSPYDLTRGRITYRYK 73


>gi|260886898|ref|ZP_05898161.1| translation initiation factor IF-1 [Selenomonas sputigena ATCC
           35185]
 gi|260863497|gb|EEX77997.1| translation initiation factor IF-1 [Selenomonas sputigena ATCC
           35185]
          Length = 95

 Score =  120 bits (301), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 24  MSKQDVIEVEGKVLEALPNAMFQVEL---------------------------------- 49

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + + PYD+TR RITYRFK
Sbjct: 50  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTIELTPYDLTRGRITYRFK 95


>gi|313884471|ref|ZP_07818232.1| translation initiation factor IF-1 [Eremococcus coleocola
           ACS-139-V-Col8]
 gi|312620255|gb|EFR31683.1| translation initiation factor IF-1 [Eremococcus coleocola
           ACS-139-V-Col8]
          Length = 72

 Score =  120 bits (300), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDMIEVEGTVLETLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTKGRITYRFK 72


>gi|226309831|ref|YP_002769725.1| translation initiation factor IF-1 [Brevibacillus brevis NBRC
           100599]
 gi|226092779|dbj|BAH41221.1| translation initiation factor IF-1 [Brevibacillus brevis NBRC
           100599]
          Length = 72

 Score =  120 bits (300), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHKVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|89100325|ref|ZP_01173190.1| translation initiation factor IF-1 [Bacillus sp. NRRL B-14911]
 gi|89084946|gb|EAR64082.1| translation initiation factor IF-1 [Bacillus sp. NRRL B-14911]
          Length = 72

 Score =  120 bits (300), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTVIETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|327438300|dbj|BAK14665.1| translation initiation factor 1 [Solibacillus silvestris StLB046]
          Length = 72

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVLETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV + ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTIELSPYDLTRGRITYRFK 72


>gi|16077207|ref|NP_388020.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|154684657|ref|YP_001419818.1| translation initiation factor IF-1 [Bacillus amyloliquefaciens
           FZB42]
 gi|221307952|ref|ZP_03589799.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221312273|ref|ZP_03594078.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221317207|ref|ZP_03598501.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221321470|ref|ZP_03602764.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296333136|ref|ZP_06875590.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305672839|ref|YP_003864510.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|308172030|ref|YP_003918735.1| initiation factor IF-I [Bacillus amyloliquefaciens DSM 7]
 gi|311070787|ref|YP_003975710.1| translation initiation factor IF-1 [Bacillus atrophaeus 1942]
 gi|321313811|ref|YP_004206098.1| translation initiation factor IF-1 [Bacillus subtilis BSn5]
 gi|124193|sp|P20458|IF1_BACSU RecName: Full=Translation initiation factor IF-1
 gi|190359568|sp|A7Z0R1|IF1_BACA2 RecName: Full=Translation initiation factor IF-1
 gi|142459|gb|AAA22213.1| initiation factor 1 [Bacillus subtilis]
 gi|1044987|gb|AAB06822.1| initiation factor IF-1 [Bacillus subtilis]
 gi|2632406|emb|CAB11915.1| initiation factor IF-I [Bacillus subtilis subsp. subtilis str. 168]
 gi|154350508|gb|ABS72587.1| InfA [Bacillus amyloliquefaciens FZB42]
 gi|296149752|gb|EFG90647.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305411082|gb|ADM36200.1| translation initiation factor IF-1 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|307604894|emb|CBI41265.1| initiation factor IF-I [Bacillus amyloliquefaciens DSM 7]
 gi|310871304|gb|ADP34779.1| translation initiation factor IF-1 [Bacillus atrophaeus 1942]
 gi|320020085|gb|ADV95071.1| translation initiation factor IF-1 [Bacillus subtilis BSn5]
 gi|328551840|gb|AEB22332.1| translation initiation factor IF-1 [Bacillus amyloliquefaciens
           TA208]
          Length = 72

 Score =  120 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTIVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|15925218|ref|NP_372752.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|15927808|ref|NP_375341.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus N315]
 gi|21283876|ref|NP_646964.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49484444|ref|YP_041668.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49487010|ref|YP_044231.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57650812|ref|YP_187027.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus COL]
 gi|73661994|ref|YP_300775.1| translation initiation factor IF-1 [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|82751817|ref|YP_417558.1| translation initiation factor IF-1 [Staphylococcus aureus RF122]
 gi|87161079|ref|YP_494817.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|88196140|ref|YP_500957.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|148268668|ref|YP_001247611.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus JH9]
 gi|150394733|ref|YP_001317408.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|151222342|ref|YP_001333164.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156980543|ref|YP_001442802.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|161510432|ref|YP_001576091.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221140170|ref|ZP_03564663.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|222150467|ref|YP_002559620.1| translation initiation factor IF-1 [Macrococcus caseolyticus
           JCSC5402]
 gi|224477198|ref|YP_002634804.1| translation initiation factor IF-1 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|253316989|ref|ZP_04840202.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253729894|ref|ZP_04864059.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253734363|ref|ZP_04868528.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|255007008|ref|ZP_05145609.2| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|257423713|ref|ZP_05600142.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257426391|ref|ZP_05602793.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257429030|ref|ZP_05605417.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257431676|ref|ZP_05608039.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257434637|ref|ZP_05610688.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus M876]
 gi|257794574|ref|ZP_05643553.1| translation initiation factor IF-1 [Staphylococcus aureus A9781]
 gi|258408824|ref|ZP_05681108.1| translation initiation factor IF-1 [Staphylococcus aureus A9763]
 gi|258422675|ref|ZP_05685580.1| translation initiation factor IF-1 [Staphylococcus aureus A9635]
 gi|258439812|ref|ZP_05690558.1| translation initiation factor IF-1 [Staphylococcus aureus A9299]
 gi|258442632|ref|ZP_05691192.1| translation initiation factor IF-1 [Staphylococcus aureus A8115]
 gi|258446669|ref|ZP_05694824.1| translation initiation factor IF-1 [Staphylococcus aureus A6300]
 gi|258450213|ref|ZP_05698305.1| translation initiation factor IF-1 [Staphylococcus aureus A6224]
 gi|258450776|ref|ZP_05698835.1| translation initiation factor IF-1 [Staphylococcus aureus A5948]
 gi|258455415|ref|ZP_05703375.1| translation initiation factor IF-1 [Staphylococcus aureus A5937]
 gi|262048495|ref|ZP_06021379.1| translation initiation factor IF-1 [Staphylococcus aureus D30]
 gi|262052020|ref|ZP_06024231.1| translation initiation factor IF-1 [Staphylococcus aureus 930918-3]
 gi|269203861|ref|YP_003283130.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ED98]
 gi|282893666|ref|ZP_06301898.1| translation initiation factor IF-1 [Staphylococcus aureus A8117]
 gi|282902131|ref|ZP_06310024.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C160]
 gi|282906571|ref|ZP_06314419.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282909541|ref|ZP_06317352.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282911788|ref|ZP_06319584.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282915077|ref|ZP_06322854.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282917573|ref|ZP_06325325.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus D139]
 gi|282920803|ref|ZP_06328521.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282922097|ref|ZP_06329793.1| translation initiation factor IF-1 [Staphylococcus aureus A9765]
 gi|282925708|ref|ZP_06333356.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282926774|ref|ZP_06334401.1| translation initiation factor IF-1 [Staphylococcus aureus A10102]
 gi|283767320|ref|ZP_06340235.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283959006|ref|ZP_06376447.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|284025254|ref|ZP_06379652.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 132]
 gi|293497481|ref|ZP_06665335.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|293511056|ref|ZP_06669753.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus M809]
 gi|293549662|ref|ZP_06672334.1| conserved domain protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|294848761|ref|ZP_06789506.1| translation initiation factor IF-1 [Staphylococcus aureus A9754]
 gi|295404904|ref|ZP_06814717.1| translation initiation factor IF-1 [Staphylococcus aureus A8819]
 gi|295428811|ref|ZP_06821435.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296275981|ref|ZP_06858488.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297209959|ref|ZP_06926355.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297243962|ref|ZP_06927852.1| translation initiation factor IF-1 [Staphylococcus aureus A8796]
 gi|297589703|ref|ZP_06948344.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MN8]
 gi|300910971|ref|ZP_07128421.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|304379412|ref|ZP_07362147.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|319893178|ref|YP_004150053.1| Translation initiation factor 1 [Staphylococcus pseudintermedius
           HKU10-03]
 gi|54037369|sp|P65119|IF1_STAAN RecName: Full=Translation initiation factor IF-1
 gi|54037370|sp|P65120|IF1_STAAW RecName: Full=Translation initiation factor IF-1
 gi|54041103|sp|P65118|IF1_STAAM RecName: Full=Translation initiation factor IF-1
 gi|56748906|sp|Q6G793|IF1_STAAS RecName: Full=Translation initiation factor IF-1
 gi|56748917|sp|Q6GEK5|IF1_STAAR RecName: Full=Translation initiation factor IF-1
 gi|71152147|sp|Q5HDY0|IF1_STAAC RecName: Full=Translation initiation factor IF-1
 gi|119371121|sp|Q2FER1|IF1_STAA3 RecName: Full=Translation initiation factor IF-1
 gi|119371122|sp|Q2FW28|IF1_STAA8 RecName: Full=Translation initiation factor IF-1
 gi|119371123|sp|Q2YYL9|IF1_STAAB RecName: Full=Translation initiation factor IF-1
 gi|119371125|sp|Q49ZE6|IF1_STAS1 RecName: Full=Translation initiation factor IF-1
 gi|190359708|sp|A7X5D0|IF1_STAA1 RecName: Full=Translation initiation factor IF-1
 gi|190359709|sp|A6U3V3|IF1_STAA2 RecName: Full=Translation initiation factor IF-1
 gi|190359710|sp|A5IV12|IF1_STAA9 RecName: Full=Translation initiation factor IF-1
 gi|190359711|sp|A6QJ70|IF1_STAAE RecName: Full=Translation initiation factor IF-1
 gi|190359712|sp|A8Z335|IF1_STAAT RecName: Full=Translation initiation factor IF-1
 gi|13702028|dbj|BAB43320.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus N315]
 gi|14248001|dbj|BAB58390.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Mu50]
 gi|21205318|dbj|BAB96012.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MW2]
 gi|49242573|emb|CAG41294.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MRSA252]
 gi|49245453|emb|CAG43930.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MSSA476]
 gi|57284998|gb|AAW37092.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus COL]
 gi|72494509|dbj|BAE17830.1| translation initiation factor IF-1 [Staphylococcus saprophyticus
           subsp. saprophyticus ATCC 15305]
 gi|82657348|emb|CAI81789.1| translation initiation factor IF-1 [Staphylococcus aureus RF122]
 gi|87127053|gb|ABD21567.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus USA300_FPR3757]
 gi|87203698|gb|ABD31508.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|147741737|gb|ABQ50035.1| bacterial translation initiation factor 1 (bIF-1) [Staphylococcus
           aureus subsp. aureus JH9]
 gi|149947185|gb|ABR53121.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus JH1]
 gi|150375142|dbj|BAF68402.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus str. Newman]
 gi|156722678|dbj|BAF79095.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Mu3]
 gi|160369241|gb|ABX30212.1| protein-synthesizing GTPase [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|222119589|dbj|BAH16924.1| translation initiation factor IF-1 [Macrococcus caseolyticus
           JCSC5402]
 gi|222421805|emb|CAL28619.1| translation initiation factor IF-1 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|253726341|gb|EES95070.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253727680|gb|EES96409.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257272731|gb|EEV04833.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 55/2053]
 gi|257276022|gb|EEV07473.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 65-1322]
 gi|257279511|gb|EEV10098.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 68-397]
 gi|257282555|gb|EEV12687.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257285233|gb|EEV15349.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus M876]
 gi|257788546|gb|EEV26886.1| translation initiation factor IF-1 [Staphylococcus aureus A9781]
 gi|257840507|gb|EEV64967.1| translation initiation factor IF-1 [Staphylococcus aureus A9763]
 gi|257847086|gb|EEV71095.1| translation initiation factor IF-1 [Staphylococcus aureus A9635]
 gi|257847588|gb|EEV71590.1| translation initiation factor IF-1 [Staphylococcus aureus A9299]
 gi|257851753|gb|EEV75687.1| translation initiation factor IF-1 [Staphylococcus aureus A8115]
 gi|257854737|gb|EEV77685.1| translation initiation factor IF-1 [Staphylococcus aureus A6300]
 gi|257856305|gb|EEV79214.1| translation initiation factor IF-1 [Staphylococcus aureus A6224]
 gi|257861559|gb|EEV84361.1| translation initiation factor IF-1 [Staphylococcus aureus A5948]
 gi|257862626|gb|EEV85394.1| translation initiation factor IF-1 [Staphylococcus aureus A5937]
 gi|259160075|gb|EEW45108.1| translation initiation factor IF-1 [Staphylococcus aureus 930918-3]
 gi|259163353|gb|EEW47911.1| translation initiation factor IF-1 [Staphylococcus aureus D30]
 gi|262076151|gb|ACY12124.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ED98]
 gi|269941817|emb|CBI50227.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TW20]
 gi|282312537|gb|EFB42941.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C101]
 gi|282315218|gb|EFB45602.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C427]
 gi|282318535|gb|EFB48893.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus D139]
 gi|282320798|gb|EFB51132.1| conserved domain protein [Staphylococcus aureus subsp. aureus M899]
 gi|282323484|gb|EFB53800.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus WBG10049]
 gi|282326520|gb|EFB56822.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus WW2703/97]
 gi|282329470|gb|EFB58991.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus Btn1260]
 gi|282591225|gb|EFB96298.1| translation initiation factor IF-1 [Staphylococcus aureus A10102]
 gi|282593565|gb|EFB98558.1| translation initiation factor IF-1 [Staphylococcus aureus A9765]
 gi|282596590|gb|EFC01549.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus C160]
 gi|282763724|gb|EFC03852.1| translation initiation factor IF-1 [Staphylococcus aureus A8117]
 gi|283461199|gb|EFC08283.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus H19]
 gi|283471450|emb|CAQ50661.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ST398]
 gi|283788598|gb|EFC27425.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus A017934/97]
 gi|285817890|gb|ADC38377.1| Translation initiation factor IF-1 [Staphylococcus aureus 04-02981]
 gi|290918709|gb|EFD95785.1| conserved domain protein [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291096412|gb|EFE26670.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 58-424]
 gi|291466043|gb|EFF08572.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus M809]
 gi|294824140|gb|EFG40564.1| translation initiation factor IF-1 [Staphylococcus aureus A9754]
 gi|294969849|gb|EFG45867.1| translation initiation factor IF-1 [Staphylococcus aureus A8819]
 gi|295127160|gb|EFG56802.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus EMRSA16]
 gi|296885632|gb|EFH24569.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ATCC 51811]
 gi|297178740|gb|EFH37985.1| translation initiation factor IF-1 [Staphylococcus aureus A8796]
 gi|297578214|gb|EFH96927.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MN8]
 gi|298695484|gb|ADI98706.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ED133]
 gi|300887951|gb|EFK83146.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TCH70]
 gi|302333864|gb|ADL24057.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus JKD6159]
 gi|302752101|gb|ADL66278.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus str. JKD6008]
 gi|304341944|gb|EFM07848.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ATCC BAA-39]
 gi|312437361|gb|ADQ76432.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus TCH60]
 gi|312830577|emb|CBX35419.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315129692|gb|EFT85683.1| protein-synthesizing GTPase [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315193480|gb|EFU23876.1| protein-synthesizing GTPase [Staphylococcus aureus subsp. aureus
           CGS00]
 gi|315198242|gb|EFU28573.1| protein-synthesizing GTPase [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|317162874|gb|ADV06417.1| Translation initiation factor 1 [Staphylococcus pseudintermedius
           HKU10-03]
 gi|320140234|gb|EFW32093.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MRSA131]
 gi|320143504|gb|EFW35285.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus MRSA177]
 gi|323440092|gb|EGA97807.1| translation initiation factor IF-1 [Staphylococcus aureus O11]
 gi|323442766|gb|EGB00392.1| translation initiation factor IF-1 [Staphylococcus aureus O46]
 gi|323463774|gb|ADX75927.1| translation initiation factor IF-1 [Staphylococcus pseudintermedius
           ED99]
 gi|329314911|gb|AEB89324.1| Translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329723417|gb|EGG59946.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 21172]
 gi|329730107|gb|EGG66497.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 21193]
 gi|329732006|gb|EGG68361.1| translation initiation factor IF-1 [Staphylococcus aureus subsp.
           aureus 21189]
          Length = 72

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKQDVIELEGTVLDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+TR RITYR+K
Sbjct: 27  ----ENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTRGRITYRYK 72


>gi|218887222|ref|YP_002436543.1| translation initiation factor IF-1 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218758176|gb|ACL09075.1| translation initiation factor IF-1 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 72

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEDAIEVDGVVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 27  ----ENGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRMK 72


>gi|116749013|ref|YP_845700.1| translation initiation factor IF-1 [Syntrophobacter fumaroxidans
           MPOB]
 gi|190359717|sp|A0LIL3|IF1_SYNFM RecName: Full=Translation initiation factor IF-1
 gi|116698077|gb|ABK17265.1| bacterial translation initiation factor 1 (bIF-1) [Syntrophobacter
           fumaroxidans MPOB]
          Length = 73

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDAIEVEGTVVETLPNAMFRVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H IRI  GDKV V ++PYD+ R RITYR K
Sbjct: 28  -----NGHRILAHISGKMRMHFIRILPGDKVTVELSPYDLNRGRITYRSK 72


>gi|323490645|ref|ZP_08095850.1| translation initiation factor IF-1 [Planococcus donghaensis MPA1U2]
 gi|323395737|gb|EGA88578.1| translation initiation factor IF-1 [Planococcus donghaensis MPA1U2]
          Length = 72

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTILAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|297582473|ref|YP_003698253.1| translation initiation factor IF-1 [Bacillus selenitireducens
           MLS10]
 gi|297140930|gb|ADH97687.1| translation initiation factor IF-1 [Bacillus selenitireducens
           MLS10]
          Length = 72

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGKVIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 28  -----NGHKILAHVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRYK 72


>gi|332970788|gb|EGK09768.1| translation initiation factor IF-1 [Desmospora sp. 8437]
          Length = 72

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD++R RITYR+K
Sbjct: 27  ----ENGHKVLAHVSGKIRMHFIRILPGDRVTVQLSPYDLSRGRITYRYK 72


>gi|326803054|ref|YP_004320872.1| translation initiation factor IF-1 [Aerococcus urinae
           ACS-120-V-Col10a]
 gi|326651357|gb|AEA01540.1| translation initiation factor IF-1 [Aerococcus urinae
           ACS-120-V-Col10a]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKEDMIEVEGTVTESLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GD+VKV M+PYD+++ RITYRFK
Sbjct: 27  ----ENGFEVLAHISGKMRVNYIRILPGDRVKVEMSPYDLSKGRITYRFK 72


>gi|117924028|ref|YP_864645.1| translation initiation factor 1 [Magnetococcus sp. MC-1]
 gi|190359648|sp|A0L5J6|IF1_MAGSM RecName: Full=Translation initiation factor IF-1
 gi|117607784|gb|ABK43239.1| bacterial translation initiation factor 1 (bIF-1) [Magnetococcus
           sp. MC-1]
          Length = 87

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 16  LSKEDVIEMEGTVLENLPNAMFKVEL---------------------------------- 41

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +GRMRK+ IRI  GDKV V + PYD+T+ RI+YR K
Sbjct: 42  ----ENKHSLLCHISGRMRKNYIRILPGDKVTVQLTPYDLTKGRISYRHK 87


>gi|124514420|gb|EAY55933.1| translation initiation factor 1 (IF-1) [Leptospirillum rubarum]
 gi|206602698|gb|EDZ39179.1| Translation initiation factor 1 (IF-1) [Leptospirillum sp. Group II
           '5-way CG']
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MPKEDIIEVQGTVLETLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV + ++PYD+TR RITYRFK
Sbjct: 28  -----NGHKVLAHISGKMRMHYIKILPGDKVTLELSPYDLTRGRITYRFK 72


>gi|283850620|ref|ZP_06367907.1| translation initiation factor IF-1 [Desulfovibrio sp. FW1012B]
 gi|283573863|gb|EFC21836.1| translation initiation factor IF-1 [Desulfovibrio sp. FW1012B]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVDGVVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 27  ----ENGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRLK 72


>gi|229542181|ref|ZP_04431241.1| translation initiation factor IF-1 [Bacillus coagulans 36D1]
 gi|229326601|gb|EEN92276.1| translation initiation factor IF-1 [Bacillus coagulans 36D1]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIVSE LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGIVSETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|220928231|ref|YP_002505140.1| translation initiation factor IF-1 [Clostridium cellulolyticum H10]
 gi|326203872|ref|ZP_08193734.1| translation initiation factor IF-1 [Clostridium papyrosolvens DSM
           2782]
 gi|219998559|gb|ACL75160.1| translation initiation factor IF-1 [Clostridium cellulolyticum H10]
 gi|325985970|gb|EGD46804.1| translation initiation factor IF-1 [Clostridium papyrosolvens DSM
           2782]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVIEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNFIRILPGDKVTLELSPYDLTRGRITWRAK 72


>gi|30018402|ref|NP_830033.1| translation initiation factor IF-1 [Bacillus cereus ATCC 14579]
 gi|30260324|ref|NP_842701.1| translation initiation factor IF-1 [Bacillus anthracis str. Ames]
 gi|42779214|ref|NP_976461.1| translation initiation factor IF-1 [Bacillus cereus ATCC 10987]
 gi|47525389|ref|YP_016738.1| translation initiation factor IF-1 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49183167|ref|YP_026419.1| translation initiation factor IF-1 [Bacillus anthracis str. Sterne]
 gi|49476717|ref|YP_034485.1| translation initiation factor IF-1 [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52145086|ref|YP_081744.1| translation initiation factor IF-1 [Bacillus cereus E33L]
 gi|118475902|ref|YP_893053.1| translation initiation factor IF-1 [Bacillus thuringiensis str. Al
           Hakam]
 gi|152973979|ref|YP_001373496.1| translation initiation factor IF-1 [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|163938141|ref|YP_001643025.1| translation initiation factor IF-1 [Bacillus weihenstephanensis
           KBAB4]
 gi|206972263|ref|ZP_03233210.1| translation initiation factor IF-1 [Bacillus cereus AH1134]
 gi|217957708|ref|YP_002336252.1| translation initiation factor IF-1 [Bacillus cereus AH187]
 gi|218235846|ref|YP_002364982.1| translation initiation factor IF-1 [Bacillus cereus B4264]
 gi|218895268|ref|YP_002443679.1| translation initiation factor IF-1 [Bacillus cereus G9842]
 gi|218901338|ref|YP_002449172.1| translation initiation factor IF-1 [Bacillus cereus AH820]
 gi|222093903|ref|YP_002527953.1| translation initiation factor if-1 [Bacillus cereus Q1]
 gi|225862185|ref|YP_002747563.1| translation initiation factor IF-1 [Bacillus cereus 03BB102]
 gi|227812806|ref|YP_002812815.1| translation initiation factor IF-1 [Bacillus anthracis str. CDC
           684]
 gi|228898886|ref|ZP_04063168.1| Translation initiation factor IF-1 [Bacillus thuringiensis IBL
           4222]
 gi|228905930|ref|ZP_04069827.1| Translation initiation factor IF-1 [Bacillus thuringiensis IBL 200]
 gi|228912872|ref|ZP_04076519.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228919083|ref|ZP_04082462.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228925386|ref|ZP_04088482.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228931635|ref|ZP_04094541.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228937436|ref|ZP_04100082.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228943938|ref|ZP_04106323.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228950681|ref|ZP_04112815.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228956574|ref|ZP_04118370.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228963233|ref|ZP_04124402.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228970322|ref|ZP_04130981.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976892|ref|ZP_04137304.1| Translation initiation factor IF-1 [Bacillus thuringiensis Bt407]
 gi|228983388|ref|ZP_04143601.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228989341|ref|ZP_04149332.1| Translation initiation factor IF-1 [Bacillus pseudomycoides DSM
           12442]
 gi|228995524|ref|ZP_04155192.1| Translation initiation factor IF-1 [Bacillus mycoides Rock3-17]
 gi|229003149|ref|ZP_04160995.1| Translation initiation factor IF-1 [Bacillus mycoides Rock1-4]
 gi|229009642|ref|ZP_04166868.1| Translation initiation factor IF-1 [Bacillus mycoides DSM 2048]
 gi|229015534|ref|ZP_04172531.1| Translation initiation factor IF-1 [Bacillus cereus AH1273]
 gi|229021744|ref|ZP_04178325.1| Translation initiation factor IF-1 [Bacillus cereus AH1272]
 gi|229027981|ref|ZP_04184134.1| Translation initiation factor IF-1 [Bacillus cereus AH1271]
 gi|229041038|ref|ZP_04189801.1| Translation initiation factor IF-1 [Bacillus cereus AH676]
 gi|229053979|ref|ZP_04195413.1| Translation initiation factor IF-1 [Bacillus cereus AH603]
 gi|229067898|ref|ZP_04201215.1| Translation initiation factor IF-1 [Bacillus cereus F65185]
 gi|229074194|ref|ZP_04207240.1| Translation initiation factor IF-1 [Bacillus cereus Rock4-18]
 gi|229077433|ref|ZP_04210084.1| Translation initiation factor IF-1 [Bacillus cereus Rock4-2]
 gi|229083453|ref|ZP_04215801.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-44]
 gi|229089264|ref|ZP_04220545.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-42]
 gi|229094855|ref|ZP_04225860.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-29]
 gi|229100932|ref|ZP_04231736.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-28]
 gi|229107819|ref|ZP_04237455.1| Translation initiation factor IF-1 [Bacillus cereus Rock1-15]
 gi|229113809|ref|ZP_04243244.1| Translation initiation factor IF-1 [Bacillus cereus Rock1-3]
 gi|229119795|ref|ZP_04249056.1| Translation initiation factor IF-1 [Bacillus cereus 95/8201]
 gi|229125650|ref|ZP_04254682.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-Cer4]
 gi|229131141|ref|ZP_04260053.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST196]
 gi|229136979|ref|ZP_04265606.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST26]
 gi|229142939|ref|ZP_04271380.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST24]
 gi|229148542|ref|ZP_04276798.1| Translation initiation factor IF-1 [Bacillus cereus m1550]
 gi|229153911|ref|ZP_04282041.1| Translation initiation factor IF-1 [Bacillus cereus ATCC 4342]
 gi|229159306|ref|ZP_04287330.1| Translation initiation factor IF-1 [Bacillus cereus R309803]
 gi|229165121|ref|ZP_04292916.1| Translation initiation factor IF-1 [Bacillus cereus AH621]
 gi|229170984|ref|ZP_04298585.1| Translation initiation factor IF-1 [Bacillus cereus MM3]
 gi|229176733|ref|ZP_04304137.1| Translation initiation factor IF-1 [Bacillus cereus 172560W]
 gi|229182527|ref|ZP_04309778.1| Translation initiation factor IF-1 [Bacillus cereus BGSC 6E1]
 gi|229188418|ref|ZP_04315466.1| Translation initiation factor IF-1 [Bacillus cereus ATCC 10876]
 gi|229194523|ref|ZP_04321326.1| Translation initiation factor IF-1 [Bacillus cereus m1293]
 gi|229600577|ref|YP_002864784.1| translation initiation factor IF-1 [Bacillus anthracis str. A0248]
 gi|254686632|ref|ZP_05150491.1| translation initiation factor IF-1 [Bacillus anthracis str.
           CNEVA-9066]
 gi|254726288|ref|ZP_05188070.1| translation initiation factor IF-1 [Bacillus anthracis str. A1055]
 gi|254735293|ref|ZP_05193001.1| translation initiation factor IF-1 [Bacillus anthracis str. Western
           North America USA6153]
 gi|254739485|ref|ZP_05197183.1| translation initiation factor IF-1 [Bacillus anthracis str. Kruger
           B]
 gi|254751243|ref|ZP_05203281.1| translation initiation factor IF-1 [Bacillus anthracis str. Vollum]
 gi|254756848|ref|ZP_05208876.1| translation initiation factor IF-1 [Bacillus anthracis str.
           Australia 94]
 gi|296500966|ref|YP_003662666.1| translation initiation factor IF-1 [Bacillus thuringiensis BMB171]
 gi|300119554|ref|ZP_07057098.1| translation initiation factor IF-1 [Bacillus cereus SJ1]
 gi|301051870|ref|YP_003790081.1| translation initiation factor IF-1 [Bacillus anthracis CI]
 gi|38372268|sp|Q814C3|IF1_BACCR RecName: Full=Translation initiation factor IF-1
 gi|38372272|sp|Q81VQ7|IF1_BACAN RecName: Full=Translation initiation factor IF-1
 gi|48428194|sp|P61684|IF1_BACC1 RecName: Full=Translation initiation factor IF-1
 gi|59797508|sp|Q63H67|IF1_BACCZ RecName: Full=Translation initiation factor IF-1
 gi|59797559|sp|Q6HPN5|IF1_BACHK RecName: Full=Translation initiation factor IF-1
 gi|190359569|sp|A0R8K3|IF1_BACAH RecName: Full=Translation initiation factor IF-1
 gi|190359570|sp|A7GK43|IF1_BACCN RecName: Full=Translation initiation factor IF-1
 gi|29893942|gb|AAP07234.1| Bacterial Protein Translation Initiation Factor 1 (IF-1) [Bacillus
           cereus ATCC 14579]
 gi|30253645|gb|AAP24187.1| translation initiation factor IF-1 [Bacillus anthracis str. Ames]
 gi|42735129|gb|AAS39069.1| translation initiation factor IF-1 [Bacillus cereus ATCC 10987]
 gi|47500537|gb|AAT29213.1| translation initiation factor IF-1 [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49177094|gb|AAT52470.1| translation initiation factor IF-1 [Bacillus anthracis str. Sterne]
 gi|49328273|gb|AAT58919.1| protein-synthesizing GTPase (initiation factor IF-I) [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51978555|gb|AAU20105.1| protein-synthesizing GTPase (initiation factor IF-I) [Bacillus
           cereus E33L]
 gi|118415127|gb|ABK83546.1| bacterial translation initiation factor 1 (bIF-1) [Bacillus
           thuringiensis str. Al Hakam]
 gi|152022731|gb|ABS20501.1| translation initiation factor IF-1 [Bacillus cytotoxicus NVH
           391-98]
 gi|163860338|gb|ABY41397.1| translation initiation factor IF-1 [Bacillus weihenstephanensis
           KBAB4]
 gi|206732837|gb|EDZ50012.1| translation initiation factor IF-1 [Bacillus cereus AH1134]
 gi|217064420|gb|ACJ78670.1| translation initiation factor IF-1 [Bacillus cereus AH187]
 gi|218163803|gb|ACK63795.1| translation initiation factor IF-1 [Bacillus cereus B4264]
 gi|218539747|gb|ACK92145.1| translation initiation factor IF-1 [Bacillus cereus AH820]
 gi|218543359|gb|ACK95753.1| translation initiation factor IF-1 [Bacillus cereus G9842]
 gi|221237951|gb|ACM10661.1| protein-synthesizing GTPase (initiation factor IF-I) [Bacillus
           cereus Q1]
 gi|225786298|gb|ACO26515.1| translation initiation factor IF-1 [Bacillus cereus 03BB102]
 gi|227002676|gb|ACP12419.1| translation initiation factor IF-1 [Bacillus anthracis str. CDC
           684]
 gi|228588989|gb|EEK47004.1| Translation initiation factor IF-1 [Bacillus cereus m1293]
 gi|228595092|gb|EEK52863.1| Translation initiation factor IF-1 [Bacillus cereus ATCC 10876]
 gi|228600982|gb|EEK58551.1| Translation initiation factor IF-1 [Bacillus cereus BGSC 6E1]
 gi|228606776|gb|EEK64193.1| Translation initiation factor IF-1 [Bacillus cereus 172560W]
 gi|228612524|gb|EEK69745.1| Translation initiation factor IF-1 [Bacillus cereus MM3]
 gi|228618384|gb|EEK75414.1| Translation initiation factor IF-1 [Bacillus cereus AH621]
 gi|228624198|gb|EEK81000.1| Translation initiation factor IF-1 [Bacillus cereus R309803]
 gi|228629592|gb|EEK86289.1| Translation initiation factor IF-1 [Bacillus cereus ATCC 4342]
 gi|228634958|gb|EEK91531.1| Translation initiation factor IF-1 [Bacillus cereus m1550]
 gi|228640560|gb|EEK96949.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST24]
 gi|228646517|gb|EEL02724.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST26]
 gi|228652354|gb|EEL08279.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-ST196]
 gi|228657842|gb|EEL13648.1| Translation initiation factor IF-1 [Bacillus cereus BDRD-Cer4]
 gi|228663696|gb|EEL19275.1| Translation initiation factor IF-1 [Bacillus cereus 95/8201]
 gi|228669680|gb|EEL25087.1| Translation initiation factor IF-1 [Bacillus cereus Rock1-3]
 gi|228675668|gb|EEL30876.1| Translation initiation factor IF-1 [Bacillus cereus Rock1-15]
 gi|228682511|gb|EEL36584.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-28]
 gi|228688598|gb|EEL42471.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-29]
 gi|228694103|gb|EEL47785.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-42]
 gi|228699886|gb|EEL52523.1| Translation initiation factor IF-1 [Bacillus cereus Rock3-44]
 gi|228705883|gb|EEL58218.1| Translation initiation factor IF-1 [Bacillus cereus Rock4-2]
 gi|228708964|gb|EEL61091.1| Translation initiation factor IF-1 [Bacillus cereus Rock4-18]
 gi|228715257|gb|EEL67116.1| Translation initiation factor IF-1 [Bacillus cereus F65185]
 gi|228721397|gb|EEL72918.1| Translation initiation factor IF-1 [Bacillus cereus AH603]
 gi|228727335|gb|EEL78529.1| Translation initiation factor IF-1 [Bacillus cereus AH676]
 gi|228733369|gb|EEL84198.1| Translation initiation factor IF-1 [Bacillus cereus AH1271]
 gi|228739553|gb|EEL89968.1| Translation initiation factor IF-1 [Bacillus cereus AH1272]
 gi|228745757|gb|EEL95762.1| Translation initiation factor IF-1 [Bacillus cereus AH1273]
 gi|228751664|gb|EEM01464.1| Translation initiation factor IF-1 [Bacillus mycoides DSM 2048]
 gi|228758112|gb|EEM07311.1| Translation initiation factor IF-1 [Bacillus mycoides Rock1-4]
 gi|228764253|gb|EEM13132.1| Translation initiation factor IF-1 [Bacillus mycoides Rock3-17]
 gi|228770419|gb|EEM18992.1| Translation initiation factor IF-1 [Bacillus pseudomycoides DSM
           12442]
 gi|228776378|gb|EEM24731.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           tochigiensis BGSC 4Y1]
 gi|228782862|gb|EEM31028.1| Translation initiation factor IF-1 [Bacillus thuringiensis Bt407]
 gi|228789431|gb|EEM37351.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228796491|gb|EEM43930.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228803139|gb|EEM49961.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228809032|gb|EEM55517.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|228815771|gb|EEM62007.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228822269|gb|EEM68251.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228828063|gb|EEM73791.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228834308|gb|EEM79849.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228840608|gb|EEM85870.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228846808|gb|EEM91813.1| Translation initiation factor IF-1 [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228853745|gb|EEM98505.1| Translation initiation factor IF-1 [Bacillus thuringiensis IBL 200]
 gi|228860786|gb|EEN05164.1| Translation initiation factor IF-1 [Bacillus thuringiensis IBL
           4222]
 gi|229264985|gb|ACQ46622.1| translation initiation factor IF-1 [Bacillus anthracis str. A0248]
 gi|296322018|gb|ADH04946.1| translation initiation factor IF-1 [Bacillus thuringiensis BMB171]
 gi|298723026|gb|EFI63924.1| translation initiation factor IF-1 [Bacillus cereus SJ1]
 gi|300374039|gb|ADK02943.1| translation initiation factor IF-1 [Bacillus cereus biovar
           anthracis str. CI]
 gi|324324124|gb|ADY19384.1| translation initiation factor IF-1 [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326937928|gb|AEA13824.1| translation initiation factor IF-1 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVLETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV V ++PYD+ R RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTVELSPYDLNRGRITYRFK 72


>gi|317050550|ref|YP_004111666.1| translation initiation factor IF-1 [Desulfurispirillum indicum S5]
 gi|316945634|gb|ADU65110.1| translation initiation factor IF-1 [Desulfurispirillum indicum S5]
          Length = 72

 Score =  119 bits (298), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGTVVEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV + ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHRVLAHISGKMRMHFIKILPGDKVTIELSPYDLTRGRITYRFK 72


>gi|332685685|ref|YP_004455459.1| translation initiation factor 1 [Melissococcus plutonius ATCC
           35311]
 gi|332369694|dbj|BAK20650.1| translation initiation factor 1 [Melissococcus plutonius ATCC
           35311]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDMIEIEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHEVLAHVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|218289983|ref|ZP_03494160.1| translation initiation factor IF-1 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|258512647|ref|YP_003186081.1| translation initiation factor IF-1 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|218239968|gb|EED07155.1| translation initiation factor IF-1 [Alicyclobacillus acidocaldarius
           LAA1]
 gi|257479373|gb|ACV59692.1| translation initiation factor IF-1 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H I+I  GD+V V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGHKVLAHVSGKIRMHYIKILPGDRVTVELSPYDLTRGRITYRYK 72


>gi|220930988|ref|YP_002507896.1| translation initiation factor IF-1 [Halothermothrix orenii H 168]
 gi|219992298|gb|ACL68901.1| translation initiation factor IF-1 [Halothermothrix orenii H 168]
          Length = 75

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEAIEVQGTVVEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GDKV V ++PYD++R RI YR K
Sbjct: 28  -----NGHKVLAHVSGKMRMNYIRILPGDKVTVELSPYDLSRGRIIYRHK 72


>gi|27468719|ref|NP_765356.1| translation initiation factor IF-1 [Staphylococcus epidermidis ATCC
           12228]
 gi|57867679|ref|YP_189372.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           RP62A]
 gi|70725825|ref|YP_252739.1| translation initiation factor IF-1 [Staphylococcus haemolyticus
           JCSC1435]
 gi|223042283|ref|ZP_03612332.1| translation initiation factor IF-1 [Staphylococcus capitis SK14]
 gi|228474799|ref|ZP_04059530.1| translation initiation factor IF-1 [Staphylococcus hominis SK119]
 gi|239636211|ref|ZP_04677215.1| translation initiation factor IF-1 [Staphylococcus warneri L37603]
 gi|242243969|ref|ZP_04798412.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           W23144]
 gi|242371875|ref|ZP_04817449.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           M23864:W1]
 gi|251812069|ref|ZP_04826542.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875364|ref|ZP_06284237.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           SK135]
 gi|289550165|ref|YP_003471069.1| Translation initiation factor 1 [Staphylococcus lugdunensis
           HKU09-01]
 gi|293368455|ref|ZP_06615079.1| translation initiation factor IF1 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|314934275|ref|ZP_07841634.1| translation initiation factor IF-1 [Staphylococcus caprae C87]
 gi|314935854|ref|ZP_07843206.1| translation initiation factor IF-1 [Staphylococcus hominis subsp.
           hominis C80]
 gi|315659205|ref|ZP_07912069.1| translation initiation factor IF-1 [Staphylococcus lugdunensis
           M23590]
 gi|29427434|sp|Q8CRI1|IF1_STAES RecName: Full=Translation initiation factor IF-1
 gi|71152148|sp|Q5HM21|IF1_STAEQ RecName: Full=Translation initiation factor IF-1
 gi|119371124|sp|Q4L892|IF1_STAHJ RecName: Full=Translation initiation factor IF-1
 gi|27316267|gb|AAO05442.1|AE016750_47 translation initiation factor IF-1 [Staphylococcus epidermidis ATCC
           12228]
 gi|57638337|gb|AAW55125.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           RP62A]
 gi|68446549|dbj|BAE04133.1| translation initiation factor IF-1 [Staphylococcus haemolyticus
           JCSC1435]
 gi|222443946|gb|EEE50042.1| translation initiation factor IF-1 [Staphylococcus capitis SK14]
 gi|228271462|gb|EEK12830.1| translation initiation factor IF-1 [Staphylococcus hominis SK119]
 gi|239598227|gb|EEQ80720.1| translation initiation factor IF-1 [Staphylococcus warneri L37603]
 gi|242232602|gb|EES34914.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           W23144]
 gi|242350382|gb|EES41983.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           M23864:W1]
 gi|251804403|gb|EES57060.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281296129|gb|EFA88650.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           SK135]
 gi|289179697|gb|ADC86942.1| Translation initiation factor 1 [Staphylococcus lugdunensis
           HKU09-01]
 gi|291317413|gb|EFE57835.1| translation initiation factor IF1 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|313652205|gb|EFS15968.1| translation initiation factor IF-1 [Staphylococcus caprae C87]
 gi|313656419|gb|EFS20159.1| translation initiation factor IF-1 [Staphylococcus hominis subsp.
           hominis C80]
 gi|315495630|gb|EFU83961.1| translation initiation factor IF-1 [Staphylococcus lugdunensis
           M23590]
 gi|319400603|gb|EFV88828.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           FRI909]
 gi|329731209|gb|EGG67579.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           VCU144]
 gi|329736500|gb|EGG72768.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           VCU028]
 gi|329737039|gb|EGG73294.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           VCU045]
 gi|330685128|gb|EGG96792.1| translation initiation factor IF-1 [Staphylococcus epidermidis
           VCU121]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKQDVIELEGTVLDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD++R RITYR+K
Sbjct: 27  ----ENGHEILAHVSGKIRMNYIRILPGDKVTVEMSPYDLSRGRITYRYK 72


>gi|209964946|ref|YP_002297861.1| translation initiation factor IF-1 [Rhodospirillum centenum SW]
 gi|209958412|gb|ACI99048.1| translation initiation factor IF-1 InfA [Rhodospirillum centenum
           SW]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEDLIEFSGTVTELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +N  V+A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NNHEVLAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|116334247|ref|YP_795774.1| translation initiation factor 1 [Lactobacillus brevis ATCC 367]
 gi|122269071|sp|Q03PX9|IF1_LACBA RecName: Full=Translation initiation factor IF-1
 gi|116099594|gb|ABJ64743.1| bacterial translation initiation factor 1 (bIF-1) [Lactobacillus
           brevis ATCC 367]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V+E LPNA FRV+L                                  
Sbjct: 1   MAKSDVIEVEGKVTETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V M+PYD+++ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIRILPGDRVTVEMSPYDLSKGRITYRFK 72


>gi|328958706|ref|YP_004376092.1| translation initiation factor IF-1 [Carnobacterium sp. 17-4]
 gi|328675030|gb|AEB31076.1| translation initiation factor IF-1 [Carnobacterium sp. 17-4]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R H IRI  GDKV V ++PYD++R RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMHYIRILPGDKVTVELSPYDLSRGRITYRFK 72


>gi|319654892|ref|ZP_08008967.1| translation initiation factor IF-1 [Bacillus sp. 2_A_57_CT2]
 gi|317393455|gb|EFV74218.1| translation initiation factor IF-1 [Bacillus sp. 2_A_57_CT2]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTVVDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|303245481|ref|ZP_07331765.1| translation initiation factor IF-1 [Desulfovibrio fructosovorans
           JJ]
 gi|302493330|gb|EFL53192.1| translation initiation factor IF-1 [Desulfovibrio fructosovorans
           JJ]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVDGKVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 27  ----ENGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRLK 72


>gi|126654305|ref|ZP_01726075.1| translation initiation factor IF-1 [Bacillus sp. B14905]
 gi|169830008|ref|YP_001700166.1| translation initiation factor IF-1 [Lysinibacillus sphaericus
           C3-41]
 gi|299541954|ref|ZP_07052277.1| translation initiation factor IF-1 [Lysinibacillus fusiformis ZC1]
 gi|126589234|gb|EAZ83397.1| translation initiation factor IF-1 [Bacillus sp. B14905]
 gi|168994496|gb|ACA42036.1| Translation initiation factor IF-1 [Lysinibacillus sphaericus
           C3-41]
 gi|298725692|gb|EFI66333.1| translation initiation factor IF-1 [Lysinibacillus fusiformis ZC1]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G++R H IRI  GDKV + ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHVILAHVSGKIRMHFIRILPGDKVTIELSPYDLTRGRITYRFK 72


>gi|167771243|ref|ZP_02443296.1| hypothetical protein ANACOL_02601 [Anaerotruncus colihominis DSM
           17241]
 gi|167666494|gb|EDS10624.1| hypothetical protein ANACOL_02601 [Anaerotruncus colihominis DSM
           17241]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEDVIEIEGTVVESLPNAQFRVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV + M+PYD+T+ RIT+R K
Sbjct: 28  -----NGHQLLAHISGKLRMNFIRILPGDKVTLEMSPYDLTKGRITWRSK 72


>gi|229823514|ref|ZP_04449583.1| hypothetical protein GCWU000282_00812 [Catonella morbi ATCC 51271]
 gi|229786958|gb|EEP23072.1| hypothetical protein GCWU000282_00812 [Catonella morbi ATCC 51271]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVIETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV + ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMNYIRILPGDKVTIELSPYDLTRGRITYRFK 72


>gi|205372046|ref|ZP_03224863.1| translation initiation factor IF-1 [Bacillus coahuilensis m4-4]
          Length = 72

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDNVIEIEGTVLETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHTVLAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|257440245|ref|ZP_05616000.1| conserved domain protein [Faecalibacterium prausnitzii A2-165]
 gi|257197279|gb|EEU95563.1| conserved domain protein [Faecalibacterium prausnitzii A2-165]
          Length = 134

 Score =  119 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 27/110 (24%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  GIV E +PNA F+V++++ D ++                           
Sbjct: 52  LSKEDVIEIEGIVREAMPNAIFKVEMLSEDKNTGKL------------------------ 87

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +++A+ +G++R + IRI  GDKV V M+PYD+++ RIT+R K
Sbjct: 88  ---TPSGHILLAHISGKLRTNFIRILPGDKVTVEMSPYDLSKGRITWRSK 134


>gi|295398310|ref|ZP_06808352.1| translation initiation factor IF-1 [Aerococcus viridans ATCC 11563]
 gi|294973449|gb|EFG49234.1| translation initiation factor IF-1 [Aerococcus viridans ATCC 11563]
          Length = 72

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MSKEDMIEIEGTVTETLPNAMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GD+VKV M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGYEVLAHISGKMRVNYIRILPGDRVKVEMSPYDLTKGRITYRFK 72


>gi|312144225|ref|YP_003995671.1| translation initiation factor IF-1 [Halanaerobium sp.
           'sapolanicus']
 gi|311904876|gb|ADQ15317.1| translation initiation factor IF-1 [Halanaerobium sp.
           'sapolanicus']
          Length = 74

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MGKEDPIEVQGTVVEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENGHKVLAHVSGKMRMNFIRILPGDKVTVELSPYDLSRGRITYRHK 72


>gi|29374873|ref|NP_814026.1| translation initiation factor IF-1 [Enterococcus faecalis V583]
 gi|227520014|ref|ZP_03950063.1| translation initiation factor IF-1 [Enterococcus faecalis TX0104]
 gi|227555875|ref|ZP_03985922.1| translation initiation factor IF-1 [Enterococcus faecalis HH22]
 gi|255971731|ref|ZP_05422317.1| translation initiation factor IF-1 [Enterococcus faecalis T1]
 gi|255974731|ref|ZP_05425317.1| translation initiation factor IF-1 [Enterococcus faecalis T2]
 gi|256618358|ref|ZP_05475204.1| translation initiation factor IF-1 [Enterococcus faecalis ATCC
           4200]
 gi|256762026|ref|ZP_05502606.1| translation initiation factor IF-1 [Enterococcus faecalis T3]
 gi|256855185|ref|ZP_05560546.1| translation initiation factor IF-1 [Enterococcus faecalis T8]
 gi|256956840|ref|ZP_05561011.1| translation initiation factor IF-1 [Enterococcus faecalis DS5]
 gi|256960647|ref|ZP_05564818.1| translation initiation factor IF-1 [Enterococcus faecalis Merz96]
 gi|256964154|ref|ZP_05568325.1| translation initiation factor IF-1 [Enterococcus faecalis HIP11704]
 gi|257078510|ref|ZP_05572871.1| translation initiation factor IF-1 [Enterococcus faecalis JH1]
 gi|257081519|ref|ZP_05575880.1| translation initiation factor IF-1 [Enterococcus faecalis E1Sol]
 gi|257084167|ref|ZP_05578528.1| translation initiation factor IF-1 [Enterococcus faecalis Fly1]
 gi|257087994|ref|ZP_05582355.1| translation initiation factor IF-1 [Enterococcus faecalis D6]
 gi|257088671|ref|ZP_05583032.1| translation initiation factor IF-1 [Enterococcus faecalis CH188]
 gi|257417598|ref|ZP_05594592.1| translation initiation factor IF-1 [Enterococcus faecalis AR01/DG]
 gi|257418677|ref|ZP_05595671.1| translation initiation factor IF-1 [Enterococcus faecalis T11]
 gi|257421522|ref|ZP_05598512.1| translation initiation factor IF-1 [Enterococcus faecalis X98]
 gi|293388081|ref|ZP_06632609.1| translation initiation factor IF-1 [Enterococcus faecalis S613]
 gi|294781073|ref|ZP_06746424.1| translation initiation factor IF-1 [Enterococcus faecalis PC1.1]
 gi|300862009|ref|ZP_07108089.1| translation initiation factor IF-1 [Enterococcus faecalis TUSoD
           Ef11]
 gi|307269109|ref|ZP_07550470.1| translation initiation factor IF-1 [Enterococcus faecalis TX4248]
 gi|307274193|ref|ZP_07555401.1| translation initiation factor IF-1 [Enterococcus faecalis TX0855]
 gi|307276418|ref|ZP_07557541.1| translation initiation factor IF-1 [Enterococcus faecalis TX2134]
 gi|307278628|ref|ZP_07559698.1| translation initiation factor IF-1 [Enterococcus faecalis TX0860]
 gi|307291667|ref|ZP_07571542.1| translation initiation factor IF-1 [Enterococcus faecalis TX0411]
 gi|312909221|ref|ZP_07768078.1| translation initiation factor IF-1 [Enterococcus faecalis DAPTO
           516]
 gi|312952629|ref|ZP_07771493.1| translation initiation factor IF-1 [Enterococcus faecalis TX0102]
 gi|44888013|sp|Q839E2|IF1_ENTFA RecName: Full=Translation initiation factor IF-1
 gi|29342331|gb|AAO80097.1| translation initiation factor IF-1 [Enterococcus faecalis V583]
 gi|227072562|gb|EEI10525.1| translation initiation factor IF-1 [Enterococcus faecalis TX0104]
 gi|227175042|gb|EEI56014.1| translation initiation factor IF-1 [Enterococcus faecalis HH22]
 gi|255962749|gb|EET95225.1| translation initiation factor IF-1 [Enterococcus faecalis T1]
 gi|255967603|gb|EET98225.1| translation initiation factor IF-1 [Enterococcus faecalis T2]
 gi|256597885|gb|EEU17061.1| translation initiation factor IF-1 [Enterococcus faecalis ATCC
           4200]
 gi|256683277|gb|EEU22972.1| translation initiation factor IF-1 [Enterococcus faecalis T3]
 gi|256709698|gb|EEU24745.1| translation initiation factor IF-1 [Enterococcus faecalis T8]
 gi|256947336|gb|EEU63968.1| translation initiation factor IF-1 [Enterococcus faecalis DS5]
 gi|256951143|gb|EEU67775.1| translation initiation factor IF-1 [Enterococcus faecalis Merz96]
 gi|256954650|gb|EEU71282.1| translation initiation factor IF-1 [Enterococcus faecalis HIP11704]
 gi|256986540|gb|EEU73842.1| translation initiation factor IF-1 [Enterococcus faecalis JH1]
 gi|256989549|gb|EEU76851.1| translation initiation factor IF-1 [Enterococcus faecalis E1Sol]
 gi|256992197|gb|EEU79499.1| translation initiation factor IF-1 [Enterococcus faecalis Fly1]
 gi|256996024|gb|EEU83326.1| translation initiation factor IF-1 [Enterococcus faecalis D6]
 gi|256997483|gb|EEU84003.1| translation initiation factor IF-1 [Enterococcus faecalis CH188]
 gi|257159426|gb|EEU89386.1| translation initiation factor IF-1 [Enterococcus faecalis ARO1/DG]
 gi|257160505|gb|EEU90465.1| translation initiation factor IF-1 [Enterococcus faecalis T11]
 gi|257163346|gb|EEU93306.1| translation initiation factor IF-1 [Enterococcus faecalis X98]
 gi|291082532|gb|EFE19495.1| translation initiation factor IF-1 [Enterococcus faecalis S613]
 gi|294451876|gb|EFG20327.1| translation initiation factor IF-1 [Enterococcus faecalis PC1.1]
 gi|300848534|gb|EFK76291.1| translation initiation factor IF-1 [Enterococcus faecalis TUSoD
           Ef11]
 gi|306497286|gb|EFM66828.1| translation initiation factor IF-1 [Enterococcus faecalis TX0411]
 gi|306504688|gb|EFM73888.1| translation initiation factor IF-1 [Enterococcus faecalis TX0860]
 gi|306506898|gb|EFM76045.1| translation initiation factor IF-1 [Enterococcus faecalis TX2134]
 gi|306509155|gb|EFM78217.1| translation initiation factor IF-1 [Enterococcus faecalis TX0855]
 gi|306514589|gb|EFM83143.1| translation initiation factor IF-1 [Enterococcus faecalis TX4248]
 gi|310629417|gb|EFQ12700.1| translation initiation factor IF-1 [Enterococcus faecalis TX0102]
 gi|311290463|gb|EFQ69019.1| translation initiation factor IF-1 [Enterococcus faecalis DAPTO
           516]
 gi|315031161|gb|EFT43093.1| translation initiation factor IF-1 [Enterococcus faecalis TX0017]
 gi|315145358|gb|EFT89374.1| translation initiation factor IF-1 [Enterococcus faecalis TX2141]
 gi|315151093|gb|EFT95109.1| translation initiation factor IF-1 [Enterococcus faecalis TX0012]
 gi|315156233|gb|EFU00250.1| translation initiation factor IF-1 [Enterococcus faecalis TX0043]
 gi|315160750|gb|EFU04767.1| translation initiation factor IF-1 [Enterococcus faecalis TX0645]
 gi|315168122|gb|EFU12139.1| translation initiation factor IF-1 [Enterococcus faecalis TX1341]
 gi|315573536|gb|EFU85727.1| translation initiation factor IF-1 [Enterococcus faecalis TX0309B]
 gi|315579348|gb|EFU91539.1| translation initiation factor IF-1 [Enterococcus faecalis TX0630]
 gi|323479444|gb|ADX78883.1| translation initiation factor IF-1 [Enterococcus faecalis 62]
 gi|327534026|gb|AEA92860.1| translation initiation factor IF-1 [Enterococcus faecalis OG1RF]
          Length = 72

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDMIEVEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|304347694|ref|YP_003856777.1| translation initiation factor IF-1 [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 72

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEDAIEVDGVVQEALPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RI YR K
Sbjct: 28  -----NGHPVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRIIYRMK 72


>gi|296131859|ref|YP_003639106.1| translation initiation factor IF-1 [Thermincola sp. JR]
 gi|296030437|gb|ADG81205.1| translation initiation factor IF-1 [Thermincola potens JR]
          Length = 72

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKQDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 27  ----ENGHRVLAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRIVYRYK 72


>gi|315640139|ref|ZP_07895261.1| translation initiation factor IF-1 [Enterococcus italicus DSM
           15952]
 gi|315484116|gb|EFU74590.1| translation initiation factor IF-1 [Enterococcus italicus DSM
           15952]
          Length = 94

 Score =  118 bits (296), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPNA F+V+L                                   
Sbjct: 24  AKEDMIEVEGTVVETLPNAMFKVEL----------------------------------- 48

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   V+A  +G++R H IRI  GDKV V ++PYD+ R RITYRFK
Sbjct: 49  ---ENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLNRGRITYRFK 94


>gi|260881646|ref|ZP_05404934.2| translation initiation factor IF-1 [Mitsuokella multacida DSM
           20544]
 gi|260848077|gb|EEX68084.1| translation initiation factor IF-1 [Mitsuokella multacida DSM
           20544]
          Length = 88

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 17  MSKQDVIEVEGKVLEALPNAMFQVEL---------------------------------- 42

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + + PYD+TR RITYRFK
Sbjct: 43  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTIELTPYDLTRGRITYRFK 88


>gi|317486256|ref|ZP_07945089.1| translation initiation factor IF-1 [Bilophila wadsworthia 3_1_6]
 gi|316922502|gb|EFV43755.1| translation initiation factor IF-1 [Bilophila wadsworthia 3_1_6]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA F V+L                                  
Sbjct: 1   MAKEDAIEVDGVVQEALPNAMFLVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 27  ----ENGHTVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRMK 72


>gi|227509953|ref|ZP_03940002.1| initiation factor IF1 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|227512886|ref|ZP_03942935.1| initiation factor IF1 [Lactobacillus buchneri ATCC 11577]
 gi|227523014|ref|ZP_03953063.1| initiation factor IF1 [Lactobacillus hilgardii ATCC 8290]
 gi|331702058|ref|YP_004399017.1| translation initiation factor IF-1 [Lactobacillus buchneri NRRL
           B-30929]
 gi|227083886|gb|EEI19198.1| initiation factor IF1 [Lactobacillus buchneri ATCC 11577]
 gi|227089832|gb|EEI25144.1| initiation factor IF1 [Lactobacillus hilgardii ATCC 8290]
 gi|227190559|gb|EEI70626.1| initiation factor IF1 [Lactobacillus brevis subsp. gravesensis ATCC
           27305]
 gi|329129401|gb|AEB73954.1| Translation initiation factor IF-1 [Lactobacillus buchneri NRRL
           B-30929]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDNVIEVEGKVVETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRFK 72


>gi|303230128|ref|ZP_07316897.1| translation initiation factor IF-1 [Veillonella atypica
           ACS-134-V-Col7a]
 gi|303231197|ref|ZP_07317935.1| translation initiation factor IF-1 [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302514104|gb|EFL56108.1| translation initiation factor IF-1 [Veillonella atypica
           ACS-049-V-Sch6]
 gi|302515189|gb|EFL57162.1| translation initiation factor IF-1 [Veillonella atypica
           ACS-134-V-Col7a]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIEVEGTVVEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G+MR + IRI  GDKV + + PYD+ R RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKMRMNFIRILPGDKVTMELTPYDLNRGRITYRFK 72


>gi|302390980|ref|YP_003826800.1| bacterial translation initiation factor 1 (bIF-1) [Acetohalobium
           arabaticum DSM 5501]
 gi|302203057|gb|ADL11735.1| bacterial translation initiation factor 1 (bIF-1) [Acetohalobium
           arabaticum DSM 5501]
          Length = 73

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEDPIEVEGTVVEPLPNAKFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GDKV V ++PYD+ R RITYR K
Sbjct: 28  -----NGHKVLAHVSGKMRMNFIRILPGDKVTVELSPYDLDRGRITYRHK 72


>gi|330839304|ref|YP_004413884.1| Translation initiation factor IF-1 [Selenomonas sputigena ATCC
           35185]
 gi|329747068|gb|AEC00425.1| Translation initiation factor IF-1 [Selenomonas sputigena ATCC
           35185]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKQDVIEVEGKVLEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + + PYD+TR RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTIELTPYDLTRGRITYRFK 72


>gi|125975408|ref|YP_001039318.1| translation initiation factor IF-1 [Clostridium thermocellum ATCC
           27405]
 gi|256005305|ref|ZP_05430271.1| translation initiation factor IF-1 [Clostridium thermocellum DSM
           2360]
 gi|281419370|ref|ZP_06250385.1| translation initiation factor IF-1 [Clostridium thermocellum JW20]
 gi|190359630|sp|A3DJJ6|IF1_CLOTH RecName: Full=Translation initiation factor IF-1
 gi|125715633|gb|ABN54125.1| bacterial translation initiation factor 1 (bIF-1) [Clostridium
           thermocellum ATCC 27405]
 gi|255990741|gb|EEU00857.1| translation initiation factor IF-1 [Clostridium thermocellum DSM
           2360]
 gi|281406990|gb|EFB37253.1| translation initiation factor IF-1 [Clostridium thermocellum JW20]
 gi|316939524|gb|ADU73558.1| translation initiation factor IF-1 [Clostridium thermocellum DSM
           1313]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKEDVIEVEGKVVEALPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|238018646|ref|ZP_04599072.1| hypothetical protein VEIDISOL_00481 [Veillonella dispar ATCC 17748]
 gi|269798527|ref|YP_003312427.1| translation initiation factor IF-1 [Veillonella parvula DSM 2008]
 gi|282849887|ref|ZP_06259270.1| translation initiation factor IF-1 [Veillonella parvula ATCC 17745]
 gi|294792817|ref|ZP_06757964.1| translation initiation factor IF-1 [Veillonella sp. 6_1_27]
 gi|294794571|ref|ZP_06759707.1| translation initiation factor IF-1 [Veillonella sp. 3_1_44]
 gi|313892972|ref|ZP_07826549.1| translation initiation factor IF-1 [Veillonella sp. oral taxon 158
           str. F0412]
 gi|237865117|gb|EEP66407.1| hypothetical protein VEIDISOL_00481 [Veillonella dispar ATCC 17748]
 gi|269095156|gb|ACZ25147.1| translation initiation factor IF-1 [Veillonella parvula DSM 2008]
 gi|282580324|gb|EFB85724.1| translation initiation factor IF-1 [Veillonella parvula ATCC 17745]
 gi|294454901|gb|EFG23274.1| translation initiation factor IF-1 [Veillonella sp. 3_1_44]
 gi|294456716|gb|EFG25079.1| translation initiation factor IF-1 [Veillonella sp. 6_1_27]
 gi|313442325|gb|EFR60740.1| translation initiation factor IF-1 [Veillonella sp. oral taxon 158
           str. F0412]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIEVEGTVVEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G+MR + IRI  GDKV + + PYD+ R RITYRFK
Sbjct: 27  ----ENGHIVLAHVSGKMRMNFIRILPGDKVTMELTPYDLNRGRITYRFK 72


>gi|291533605|emb|CBL06718.1| bacterial translation initiation factor 1 (bIF-1) [Megamonas
           hypermegale ART12/1]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKQDVIEVEGKVLEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + + PYD+TR RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTIELTPYDLTRGRITYRFK 72


>gi|39996849|ref|NP_952800.1| translation initiation factor IF-1 [Geobacter sulfurreducens PCA]
 gi|48428196|sp|P61688|IF1_GEOSL RecName: Full=Translation initiation factor IF-1
 gi|39983737|gb|AAR35127.1| translation initiation factor IF-1 [Geobacter sulfurreducens PCA]
 gi|298505864|gb|ADI84587.1| translation initiation factor IF-1 [Geobacter sulfurreducens KN400]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G+MRK+ I+I  GDKV V ++PYD+TR RITYR K
Sbjct: 27  ----ENGHVVLAHISGKMRKYFIKILPGDKVTVELSPYDLTRGRITYRAK 72


>gi|259047533|ref|ZP_05737934.1| translation initiation factor IF-1 [Granulicatella adiacens ATCC
           49175]
 gi|260584438|ref|ZP_05852185.1| translation initiation factor IF-1 [Granulicatella elegans ATCC
           700633]
 gi|259035724|gb|EEW36979.1| translation initiation factor IF-1 [Granulicatella adiacens ATCC
           49175]
 gi|260157956|gb|EEW93025.1| translation initiation factor IF-1 [Granulicatella elegans ATCC
           700633]
          Length = 72

 Score =  118 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIV+E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEIEGIVNETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H I+I  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHEVLAHVSGKIRMHYIKILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|167036824|ref|YP_001664402.1| translation initiation factor IF-1 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039543|ref|YP_001662528.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X514]
 gi|256752655|ref|ZP_05493507.1| translation initiation factor IF-1 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300915206|ref|ZP_07132521.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X561]
 gi|307725130|ref|YP_003904881.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X513]
 gi|320115246|ref|YP_004185405.1| translation initiation factor IF-1 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
 gi|166853783|gb|ABY92192.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X514]
 gi|166855658|gb|ABY94066.1| translation initiation factor IF-1 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748475|gb|EEU61527.1| translation initiation factor IF-1 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300888930|gb|EFK84077.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X561]
 gi|307582191|gb|ADN55590.1| translation initiation factor IF-1 [Thermoanaerobacter sp. X513]
 gi|319928337|gb|ADV79022.1| translation initiation factor IF-1 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEALPNAMFQVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD++R RI +R K
Sbjct: 28  -----NGHKVLAHVSGKLRMNFIRILPGDRVTVELSPYDLSRGRIVWRGK 72


>gi|77919013|ref|YP_356828.1| translation initiation factor IF-1 [Pelobacter carbinolicus DSM
           2380]
 gi|119371087|sp|Q3A4P9|IF1_PELCD RecName: Full=Translation initiation factor IF-1
 gi|77545096|gb|ABA88658.1| bacterial translation initiation factor 1 (bIF-1) [Pelobacter
           carbinolicus DSM 2380]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEEAIEVEGKVVEPLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MRK  IRI  GD+V V ++PYD+TR RITYR K
Sbjct: 28  -----NGHTILAHISGKMRKFYIRILPGDRVTVELSPYDLTRGRITYREK 72


>gi|90962384|ref|YP_536300.1| translation initiation factor IF-1 [Lactobacillus salivarius
           UCC118]
 gi|227891566|ref|ZP_04009371.1| protein translation initiation factor 1 [Lactobacillus salivarius
           ATCC 11741]
 gi|301300250|ref|ZP_07206462.1| translation initiation factor IF-1 [Lactobacillus salivarius
           ACS-116-V-Col5a]
 gi|119371072|sp|Q1WSB2|IF1_LACS1 RecName: Full=Translation initiation factor IF-1
 gi|90821578|gb|ABE00217.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Lactobacillus salivarius UCC118]
 gi|227866713|gb|EEJ74134.1| protein translation initiation factor 1 [Lactobacillus salivarius
           ATCC 11741]
 gi|300852191|gb|EFK79863.1| translation initiation factor IF-1 [Lactobacillus salivarius
           ACS-116-V-Col5a]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTIKETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRFK 72


>gi|95930681|ref|ZP_01313415.1| translation initiation factor IF-1 [Desulfuromonas acetoxidans DSM
           684]
 gi|95133333|gb|EAT14998.1| translation initiation factor IF-1 [Desulfuromonas acetoxidans DSM
           684]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEEAIEVEGTVIEPLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ VV+A+ +G+MRK  IRI  GD+V V ++PYD+TR RITYR K
Sbjct: 28  -----NDHVVLAHISGKMRKFYIRILPGDRVTVELSPYDLTRGRITYREK 72


>gi|24213461|ref|NP_710942.1| translation initiation factor IF-1 [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45658681|ref|YP_002767.1| translation initiation factor IF-1 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|116327246|ref|YP_796966.1| translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116327286|ref|YP_797006.1| translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116332100|ref|YP_801818.1| translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
 gi|7387795|sp|Q9XD14|IF1_LEPIN RecName: Full=Translation initiation factor IF-1
 gi|48428198|sp|P61690|IF1_LEPIC RecName: Full=Translation initiation factor IF-1
 gi|122280170|sp|Q04PW0|IF1_LEPBJ RecName: Full=Translation initiation factor IF-1
 gi|122284907|sp|Q055C2|IF1_LEPBL RecName: Full=Translation initiation factor IF-1
 gi|5163226|gb|AAD40605.1|AF115283_24 initiation factor IF1 [Leptospira interrogans]
 gi|24194231|gb|AAN47960.1| translation initiation factor IF-1 [Leptospira interrogans serovar
           Lai str. 56601]
 gi|45601925|gb|AAS71404.1| translation initiation factor IF-1 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|116119990|gb|ABJ78033.1| Translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116120030|gb|ABJ78073.1| Translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116125789|gb|ABJ77060.1| Translation initiation factor 1, IF-1 [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEAITVDGTVLEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GDKV V ++PYD+++ RITYR K
Sbjct: 27  ----ENGHKVLAHISGKMRMHYIRILPGDKVTVELSPYDLSKGRITYRKK 72


>gi|317054790|ref|YP_004103257.1| translation initiation factor IF-1 [Ruminococcus albus 7]
 gi|315447059|gb|ADU20623.1| translation initiation factor IF-1 [Ruminococcus albus 7]
          Length = 72

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ LE  G V E LPNA F+V+L                                  
Sbjct: 1   MSKEDVLEVEGTVVEALPNATFQVELT--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+T+ RIT+R K
Sbjct: 28  -----NGHKILAHISGKLRMNYIRIVPGDKVTVEMSPYDLTKGRITWRAK 72


>gi|239906710|ref|YP_002953451.1| translation initiation factor IF-1 [Desulfovibrio magneticus RS-1]
 gi|239796576|dbj|BAH75565.1| translation initiation factor IF-1 [Desulfovibrio magneticus RS-1]
          Length = 82

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G+V E LPNA FRV+L                                  
Sbjct: 11  MAKEGAIEVDGVVQEALPNAMFRVEL---------------------------------- 36

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 37  ----ENGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRLK 82


>gi|189911418|ref|YP_001962973.1| translation initiation factor IF-1 [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
 gi|167776094|gb|ABZ94395.1| Translation initiation factor 1, IF-1 [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Ames)']
          Length = 72

 Score =  117 bits (293), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEAITIDGTVLEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GDKV V ++PYD+T+ RITYR K
Sbjct: 27  ----ENGHKVLAHISGKMRMHYIRILPGDKVTVELSPYDLTKGRITYRKK 72


>gi|78043777|ref|YP_361095.1| translation initiation factor IF-1 [Carboxydothermus
           hydrogenoformans Z-2901]
 gi|119370847|sp|Q3A9T9|IF1_CARHZ RecName: Full=Translation initiation factor IF-1
 gi|77995892|gb|ABB14791.1| translation initiation factor IF-1 [Carboxydothermus
           hydrogenoformans Z-2901]
          Length = 72

 Score =  117 bits (293), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKDDVIEVEGTVVEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI YR K
Sbjct: 28  -----NGHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLTRGRIIYRHK 72


>gi|116495925|ref|YP_807659.1| translation initiation factor IF-1 [Lactobacillus casei ATCC 334]
 gi|191639407|ref|YP_001988573.1| translation initiation factor IF-1 [Lactobacillus casei BL23]
 gi|199598854|ref|ZP_03212265.1| Translation initiation factor 1 (IF-1) [Lactobacillus rhamnosus
           HN001]
 gi|239630329|ref|ZP_04673360.1| translation initiation factor IF-1 [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|258509460|ref|YP_003172211.1| translation initiation factor IF-1 [Lactobacillus rhamnosus GG]
 gi|258540658|ref|YP_003175157.1| translation initiation factor IF-1 [Lactobacillus rhamnosus Lc 705]
 gi|301067481|ref|YP_003789504.1| translation initiation factor 1 [Lactobacillus casei str. Zhang]
 gi|122262675|sp|Q035A5|IF1_LACC3 RecName: Full=Translation initiation factor IF-1
 gi|116106075|gb|ABJ71217.1| bacterial translation initiation factor 1 (bIF-1) [Lactobacillus
           casei ATCC 334]
 gi|190713709|emb|CAQ67715.1| Translation initiation factor IF-1 [Lactobacillus casei BL23]
 gi|199590266|gb|EDY98361.1| Translation initiation factor 1 (IF-1) [Lactobacillus rhamnosus
           HN001]
 gi|239527941|gb|EEQ66942.1| translation initiation factor IF-1 [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|257149387|emb|CAR88360.1| Translation initiation factor IF-1 [Lactobacillus rhamnosus GG]
 gi|257152334|emb|CAR91306.1| Translation initiation factor IF-1 [Lactobacillus rhamnosus Lc 705]
 gi|259650739|dbj|BAI42901.1| translation initiation factor IF-1 [Lactobacillus rhamnosus GG]
 gi|300439888|gb|ADK19654.1| Translation initiation factor 1 (IF-1) [Lactobacillus casei str.
           Zhang]
 gi|327383495|gb|AEA54971.1| Translation initiation factor IF-1 [Lactobacillus casei LC2W]
 gi|327386688|gb|AEA58162.1| Translation initiation factor IF-1 [Lactobacillus casei BD-II]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V++ LPNA F+VKL                                  
Sbjct: 1   MAKDDVIEIQGTVTDTLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R H IRI  GDKV V ++PYD+T+ RITYRFK
Sbjct: 27  ----ENGAEILAHVSGKIRMHYIRILPGDKVTVELSPYDLTKGRITYRFK 72


>gi|260893349|ref|YP_003239446.1| translation initiation factor IF-1 [Ammonifex degensii KC4]
 gi|260865490|gb|ACX52596.1| translation initiation factor IF-1 [Ammonifex degensii KC4]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKQDVIEVEGTVIEPLPNAMFRVELA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RI YRFK
Sbjct: 28  -----NGHKVLAHVSGKIRMHFIRILPGDRVLVELSPYDLTRGRIVYRFK 72


>gi|121534656|ref|ZP_01666477.1| translation initiation factor IF-1 [Thermosinus carboxydivorans
           Nor1]
 gi|121306676|gb|EAX47597.1| translation initiation factor IF-1 [Thermosinus carboxydivorans
           Nor1]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKQDVIEVEGTVIEALPNAMFQVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GD+V V + PYD+ R RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMNFIRILPGDRVTVELTPYDLKRGRITYRFK 72


>gi|332703396|ref|ZP_08423484.1| Translation initiation factor IF-1 [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553545|gb|EGJ50589.1| Translation initiation factor IF-1 [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKE+ +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MPKEDAIEVDGVVQEALPNAMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD VKV ++PYD+TR RITYR K
Sbjct: 28  -----NGHDVLAHISGKMRKFYIRILPGDSVKVELSPYDLTRGRITYRMK 72


>gi|323340396|ref|ZP_08080653.1| translation initiation factor IF-1 [Lactobacillus ruminis ATCC
           25644]
 gi|323092172|gb|EFZ34787.1| translation initiation factor IF-1 [Lactobacillus ruminis ATCC
           25644]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGTIKETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIRILPGDRVTVEMSPYDLTKGRITYRFK 72


>gi|299820977|ref|ZP_07052866.1| translation initiation factor IF-1 [Listeria grayi DSM 20601]
 gi|299817998|gb|EFI85233.1| translation initiation factor IF-1 [Listeria grayi DSM 20601]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGVVQETLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHKVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|325288600|ref|YP_004264781.1| bacterial translation initiation factor 1 (bIF-1) [Syntrophobotulus
           glycolicus DSM 8271]
 gi|324964001|gb|ADY54780.1| bacterial translation initiation factor 1 (bIF-1) [Syntrophobotulus
           glycolicus DSM 8271]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEDVIEVEGKVLEPLPNAMFRVELT--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RI YRFK
Sbjct: 28  -----NGHKVLAHVSGKIRMHFIRILPGDRVTVELSPYDLTRGRIVYRFK 72


>gi|51894187|ref|YP_076878.1| translation initiation factor IF-1 [Symbiobacterium thermophilum
           IAM 14863]
 gi|59797714|sp|Q67JW6|IF12_SYMTH RecName: Full=Translation initiation factor IF-1 2
 gi|51857876|dbj|BAD42034.1| translation initiation factor IF-1 [Symbiobacterium thermophilum
           IAM 14863]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKDDVIEVEGTVVENLPNAMFRVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHRVLAHVSGKIRMHFIRILPGDRVTVELSPYDLTRGRIVYRYK 72


>gi|78223044|ref|YP_384791.1| translation initiation factor IF-1 [Geobacter metallireducens
           GS-15]
 gi|119370868|sp|Q39UK8|IF1_GEOMG RecName: Full=Translation initiation factor IF-1
 gi|78194299|gb|ABB32066.1| bacterial translation initiation factor 1 (bIF-1) [Geobacter
           metallireducens GS-15]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G+MRK+ I+I  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENGHVVLAHISGKMRKYFIKILPGDKVTVELSPYDLSRGRITYRAK 72


>gi|69247191|ref|ZP_00604253.1| Translation initiation factor IF-1 [Enterococcus faecium DO]
 gi|257866551|ref|ZP_05646204.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC30]
 gi|257870539|ref|ZP_05650192.1| translation initiation factor IF-1 [Enterococcus gallinarum EG2]
 gi|257872934|ref|ZP_05652587.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC10]
 gi|257876155|ref|ZP_05655808.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC20]
 gi|257878747|ref|ZP_05658400.1| translation initiation factor IF-1 [Enterococcus faecium 1,230,933]
 gi|257881388|ref|ZP_05661041.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,502]
 gi|257885656|ref|ZP_05665309.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,501]
 gi|257887999|ref|ZP_05667652.1| translation initiation factor IF-1 [Enterococcus faecium 1,141,733]
 gi|257890606|ref|ZP_05670259.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,410]
 gi|257893196|ref|ZP_05672849.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,408]
 gi|257896382|ref|ZP_05676035.1| translation initiation factor IF-1 [Enterococcus faecium Com12]
 gi|257899356|ref|ZP_05679009.1| translation initiation factor IF-1 [Enterococcus faecium Com15]
 gi|258615189|ref|ZP_05712959.1| translation initiation factor IF-1 [Enterococcus faecium DO]
 gi|260558309|ref|ZP_05830505.1| translation initiation factor IF-1 [Enterococcus faecium C68]
 gi|261207015|ref|ZP_05921704.1| translation initiation factor IF-1 [Enterococcus faecium TC 6]
 gi|289565350|ref|ZP_06445800.1| translation initiation factor IF-1 [Enterococcus faecium D344SRF]
 gi|293379468|ref|ZP_06625612.1| translation initiation factor IF-1 [Enterococcus faecium PC4.1]
 gi|293553901|ref|ZP_06674507.1| translation initiation factor IF-1 [Enterococcus faecium E1039]
 gi|293562968|ref|ZP_06677435.1| translation initiation factor IF-1 [Enterococcus faecium E1162]
 gi|293567909|ref|ZP_06679250.1| translation initiation factor IF-1 [Enterococcus faecium E1071]
 gi|293570706|ref|ZP_06681756.1| translation initiation factor IF-1 [Enterococcus faecium E980]
 gi|294615371|ref|ZP_06695244.1| translation initiation factor IF-1 [Enterococcus faecium E1636]
 gi|294618298|ref|ZP_06697879.1| translation initiation factor IF-1 [Enterococcus faecium E1679]
 gi|294621101|ref|ZP_06700292.1| translation initiation factor IF-1 [Enterococcus faecium U0317]
 gi|325567354|ref|ZP_08144021.1| translation initiation factor IF-1 [Enterococcus casseliflavus ATCC
           12755]
 gi|68194956|gb|EAN09424.1| Translation initiation factor IF-1 [Enterococcus faecium DO]
 gi|257800509|gb|EEV29537.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC30]
 gi|257804703|gb|EEV33525.1| translation initiation factor IF-1 [Enterococcus gallinarum EG2]
 gi|257807098|gb|EEV35920.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC10]
 gi|257810321|gb|EEV39141.1| translation initiation factor IF-1 [Enterococcus casseliflavus
           EC20]
 gi|257812975|gb|EEV41733.1| translation initiation factor IF-1 [Enterococcus faecium 1,230,933]
 gi|257817046|gb|EEV44374.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,502]
 gi|257821512|gb|EEV48642.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,501]
 gi|257824053|gb|EEV50985.1| translation initiation factor IF-1 [Enterococcus faecium 1,141,733]
 gi|257826966|gb|EEV53592.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,410]
 gi|257829575|gb|EEV56182.1| translation initiation factor IF-1 [Enterococcus faecium 1,231,408]
 gi|257832947|gb|EEV59368.1| translation initiation factor IF-1 [Enterococcus faecium Com12]
 gi|257837268|gb|EEV62342.1| translation initiation factor IF-1 [Enterococcus faecium Com15]
 gi|260075483|gb|EEW63789.1| translation initiation factor IF-1 [Enterococcus faecium C68]
 gi|260078643|gb|EEW66345.1| translation initiation factor IF-1 [Enterococcus faecium TC 6]
 gi|289162840|gb|EFD10690.1| translation initiation factor IF-1 [Enterococcus faecium D344SRF]
 gi|291589494|gb|EFF21301.1| translation initiation factor IF-1 [Enterococcus faecium E1071]
 gi|291591745|gb|EFF23381.1| translation initiation factor IF-1 [Enterococcus faecium E1636]
 gi|291595392|gb|EFF26704.1| translation initiation factor IF-1 [Enterococcus faecium E1679]
 gi|291599337|gb|EFF30363.1| translation initiation factor IF-1 [Enterococcus faecium U0317]
 gi|291601953|gb|EFF32199.1| translation initiation factor IF-1 [Enterococcus faecium E1039]
 gi|291605094|gb|EFF34561.1| translation initiation factor IF-1 [Enterococcus faecium E1162]
 gi|291609178|gb|EFF38450.1| translation initiation factor IF-1 [Enterococcus faecium E980]
 gi|292641991|gb|EFF60157.1| translation initiation factor IF-1 [Enterococcus faecium PC4.1]
 gi|325158787|gb|EGC70933.1| translation initiation factor IF-1 [Enterococcus casseliflavus ATCC
           12755]
          Length = 72

 Score =  117 bits (293), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDMIEVEGTVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R H IRI  GDKV V ++PYD+ R RITYRFK
Sbjct: 27  ----ENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLNRGRITYRFK 72


>gi|323141378|ref|ZP_08076269.1| translation initiation factor IF-1 [Phascolarctobacterium sp. YIT
           12067]
 gi|322414127|gb|EFY04955.1| translation initiation factor IF-1 [Phascolarctobacterium sp. YIT
           12067]
          Length = 72

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L+                                 
Sbjct: 1   MSKQDVIEVEGTILEALPNAMFQVQLV--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + I+I  GDKV V + PYD+ R RITYR+K
Sbjct: 28  -----NGHTILAHISGKIRMNFIKILPGDKVTVELTPYDLNRGRITYRYK 72


>gi|297618360|ref|YP_003703519.1| translation initiation factor IF-1 [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297146197|gb|ADI02954.1| translation initiation factor IF-1 [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 72

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGKVVESLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + IRI  GD+V V ++PYD+ R RI YRFK
Sbjct: 28  -----NGHKVLAHISGKMRMNFIRILPGDRVMVELSPYDLNRGRIIYRFK 72


>gi|302036688|ref|YP_003797010.1| translation initiation factor IF-1 [Candidatus Nitrospira defluvii]
 gi|300604752|emb|CBK41084.1| Translation initiation factor IF-1 [Candidatus Nitrospira defluvii]
          Length = 72

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKE+ +E +G V+E LPNA FRV+L                                  
Sbjct: 1   MPKEDVIEVTGTVAETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G+MR H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----EHGHRILAHISGKMRMHFIRILPGDKVTVQLSPYDLTRGRITYRFK 72


>gi|212704827|ref|ZP_03312955.1| hypothetical protein DESPIG_02892 [Desulfovibrio piger ATCC 29098]
 gi|220903775|ref|YP_002479087.1| translation initiation factor IF-1 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|303326528|ref|ZP_07356971.1| translation initiation factor IF-1 [Desulfovibrio sp. 3_1_syn3]
 gi|212671789|gb|EEB32272.1| hypothetical protein DESPIG_02892 [Desulfovibrio piger ATCC 29098]
 gi|219868074|gb|ACL48409.1| translation initiation factor IF-1 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|302864444|gb|EFL87375.1| translation initiation factor IF-1 [Desulfovibrio sp. 3_1_syn3]
          Length = 72

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE ++E  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEGSIEVDGVVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+TR RITYR K
Sbjct: 27  ----ENGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRMK 72


>gi|298531115|ref|ZP_07018516.1| translation initiation factor IF-1 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509138|gb|EFI33043.1| translation initiation factor IF-1 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 72

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G+V E LPNA FR+KL                                  
Sbjct: 1   MAKEESIEVEGVVEEALPNAMFRIKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MRK  IRI  GD+VKV ++PYD+TR RITYRFK
Sbjct: 28  -----NGHEVLGHISGKMRKFYIRILPGDRVKVELSPYDLTRGRITYRFK 72


>gi|52424709|ref|YP_087846.1| translation initiation factor IF-1 [Mannheimia succiniciproducens
           MBEL55E]
 gi|52306761|gb|AAU37261.1| InfA protein [Mannheimia succiniciproducens MBEL55E]
          Length = 113

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 42  MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 67

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV + M PYD+ + RI +R +
Sbjct: 68  ----ENGHVVTAHISGKMRKNYIRILTGDKVTIEMTPYDLNKGRIIFRSR 113


>gi|218245120|ref|YP_002370491.1| translation initiation factor IF-1 [Cyanothece sp. PCC 8801]
 gi|257058145|ref|YP_003136033.1| translation initiation factor IF-1 [Cyanothece sp. PCC 8802]
 gi|218165598|gb|ACK64335.1| translation initiation factor IF-1 [Cyanothece sp. PCC 8801]
 gi|256588311|gb|ACU99197.1| translation initiation factor IF-1 [Cyanothece sp. PCC 8802]
          Length = 75

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+++ RITYR K
Sbjct: 28  -----NGHNVLAHISGKIRRNYIKILPGDRVKVELTPYDLSKGRITYRLK 72


>gi|46578431|ref|YP_009239.1| translation initiation factor IF-1 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120603987|ref|YP_968387.1| translation initiation factor IF-1 [Desulfovibrio vulgaris DP4]
 gi|48428304|sp|P61686|IF11_DESVH RecName: Full=Translation initiation factor IF-1 1
 gi|190359541|sp|A1VHP4|IF12_DESVV RecName: Full=Translation initiation factor IF-1 2
 gi|46447842|gb|AAS94498.1| translation initiation factor IF-1 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|120564216|gb|ABM29960.1| bacterial translation initiation factor 1 (bIF-1) [Desulfovibrio
           vulgaris DP4]
 gi|311232362|gb|ADP85216.1| translation initiation factor IF-1 [Desulfovibrio vulgaris RCH1]
          Length = 72

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEDAIEVDGVVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GD+VKV ++PYD+ R RITYR K
Sbjct: 27  ----QNGHEVLAHISGKMRKFYIRILPGDRVKVELSPYDLKRGRITYRMK 72


>gi|159027082|emb|CAO89267.1| infA [Microcystis aeruginosa PCC 7806]
          Length = 76

 Score =  117 bits (292), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|288962442|ref|YP_003452737.1| translation initiation factor IF-1 [Azospirillum sp. B510]
 gi|288914708|dbj|BAI76193.1| translation initiation factor IF-1 [Azospirillum sp. B510]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V ELLPNA FRVKL                                  
Sbjct: 1   MAKEDLIEFSGTVVELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  V+A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NDHEVLAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|23014499|ref|ZP_00054312.1| COG0361: Translation initiation factor 1 (IF-1) [Magnetospirillum
           magnetotacticum MS-1]
 gi|119371074|sp|Q2W1Y2|IF1_MAGMM RecName: Full=Translation initiation factor IF-1
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEDVIEFSGTVTELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+R+K
Sbjct: 28  -----NDHEILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRYK 72


>gi|289449612|ref|YP_003475760.1| translation initiation factor IF-1 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
 gi|289184159|gb|ADC90584.1| translation initiation factor IF-1 [Clostridiales genomosp. BVAB3
           str. UPII9-5]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIVS+ LPNA F+VKL                                  
Sbjct: 1   MSKEDVIEVEGIVSDALPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R++ I+I  GDKV + ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHQILAHISGKLRQNYIKILPGDKVTLELSPYDLTRGRITWRAK 72


>gi|83591252|ref|YP_431261.1| translation initiation factor 1 [Moorella thermoacetica ATCC 39073]
 gi|119371077|sp|Q2RFS1|IF1_MOOTA RecName: Full=Translation initiation factor IF-1
 gi|83574166|gb|ABC20718.1| bacterial translation initiation factor 1 (bIF-1) [Moorella
           thermoacetica ATCC 39073]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGKVIEPLPNAMFRVELA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+ R RI YR+K
Sbjct: 28  -----NGHRVLAHVSGKIRMNFIRILPGDRVTVELSPYDLNRGRIVYRYK 72


>gi|227499173|ref|ZP_03929308.1| translation initiation factor IF-1 [Acidaminococcus sp. D21]
 gi|284049235|ref|YP_003399574.1| translation initiation factor IF-1 [Acidaminococcus fermentans DSM
           20731]
 gi|226904620|gb|EEH90538.1| translation initiation factor IF-1 [Acidaminococcus sp. D21]
 gi|283953456|gb|ADB48259.1| translation initiation factor IF-1 [Acidaminococcus fermentans DSM
           20731]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRVKL                                  
Sbjct: 1   MSKQDAIEVEGTVLESLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+ +G++R + I+I  GDKV V + PYD+ R RITYRFK
Sbjct: 27  ----ENDHEILAHISGKIRMNFIKILPGDKVTVELTPYDLNRGRITYRFK 72


>gi|303240948|ref|ZP_07327459.1| translation initiation factor IF-1 [Acetivibrio cellulolyticus CD2]
 gi|302591534|gb|EFL61271.1| translation initiation factor IF-1 [Acetivibrio cellulolyticus CD2]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKEDVIEVEGKVVEALPNAMFEVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV + ++PYD+TR RIT+R K
Sbjct: 28  -----NGHKILAHISGKLRMNFIRILPGDKVTLELSPYDLTRGRITWRAK 72


>gi|289579119|ref|YP_003477746.1| translation initiation factor IF-1 [Thermoanaerobacter italicus
           Ab9]
 gi|297545306|ref|YP_003677608.1| translation initiation factor IF-1 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|307266991|ref|ZP_07548507.1| translation initiation factor IF-1 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|326390638|ref|ZP_08212193.1| translation initiation factor IF-1 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|289528832|gb|ADD03184.1| translation initiation factor IF-1 [Thermoanaerobacter italicus
           Ab9]
 gi|296843081|gb|ADH61597.1| translation initiation factor IF-1 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|306917976|gb|EFN48234.1| translation initiation factor IF-1 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|325993316|gb|EGD51753.1| translation initiation factor IF-1 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVIEALPNAMFQVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD++R RI +R K
Sbjct: 28  -----NGHKVLAHVSGKLRMNFIRILPGDRVTVELSPYDLSRGRIVWRGK 72


>gi|28377854|ref|NP_784746.1| translation initiation factor IF-1 [Lactobacillus plantarum WCFS1]
 gi|254556039|ref|YP_003062456.1| translation initiation factor IF-1 [Lactobacillus plantarum JDM1]
 gi|308180033|ref|YP_003924161.1| translation initiation factor IF-1 [Lactobacillus plantarum subsp.
           plantarum ST-III]
 gi|38257839|sp|Q88XW4|IF1_LACPL RecName: Full=Translation initiation factor IF-1
 gi|28270687|emb|CAD63593.1| translation initiation factor IF-1 [Lactobacillus plantarum WCFS1]
 gi|254044966|gb|ACT61759.1| translation initiation factor IF-1 [Lactobacillus plantarum JDM1]
 gi|308045524|gb|ADN98067.1| translation initiation factor IF-1 [Lactobacillus plantarum subsp.
           plantarum ST-III]
          Length = 72

 Score =  117 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEIQGTIKETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R H IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGAEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRFK 72


>gi|20808637|ref|NP_623808.1| translation initiation factor IF-1 [Thermoanaerobacter
           tengcongensis MB4]
 gi|22095759|sp|Q8R7X7|IF1_THETN RecName: Full=Translation initiation factor IF-1
 gi|20517271|gb|AAM25412.1| Translation initiation factor IF-1 [Thermoanaerobacter
           tengcongensis MB4]
          Length = 72

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGTVIEALPNAMFQVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+VKV ++PYD+TR RI +R K
Sbjct: 28  -----NGHKVLAHVSGKLRMNFIRILPGDRVKVELSPYDLTRGRIVWRGK 72


>gi|325678628|ref|ZP_08158238.1| translation initiation factor IF-1 [Ruminococcus albus 8]
 gi|324109678|gb|EGC03884.1| translation initiation factor IF-1 [Ruminococcus albus 8]
          Length = 72

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ LE  G V E LPNA F V+L                                  
Sbjct: 1   MSKEDVLEVEGTVVEALPNATFTVELT--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+T+ RIT+R K
Sbjct: 28  -----NGHKILAHISGKLRMNYIRIVPGDKVTVEMSPYDLTKGRITWRAK 72


>gi|16801820|ref|NP_472088.1| translation initiation factor IF-1 [Listeria innocua Clip11262]
 gi|16804648|ref|NP_466133.1| translation initiation factor IF-1 [Listeria monocytogenes EGD-e]
 gi|46908782|ref|YP_015171.1| translation initiation factor IF-1 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47093976|ref|ZP_00231710.1| translation initiation factor IF-1 [Listeria monocytogenes str. 4b
           H7858]
 gi|47097181|ref|ZP_00234746.1| translation initiation factor IF-1 [Listeria monocytogenes str.
           1/2a F6854]
 gi|116873976|ref|YP_850757.1| translation initiation factor IF-1 [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|217966191|ref|YP_002351869.1| translation initiation factor IF-1 [Listeria monocytogenes HCC23]
 gi|224499283|ref|ZP_03667632.1| translation initiation factor IF-1 [Listeria monocytogenes Finland
           1988]
 gi|224503596|ref|ZP_03671903.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           R2-561]
 gi|226225155|ref|YP_002759262.1| initiation factor IF-I [Listeria monocytogenes Clip81459]
 gi|254825029|ref|ZP_05230030.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J1-194]
 gi|254829059|ref|ZP_05233746.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           N3-165]
 gi|254830959|ref|ZP_05235614.1| translation initiation factor IF-1 [Listeria monocytogenes 10403S]
 gi|254854185|ref|ZP_05243533.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           R2-503]
 gi|254899939|ref|ZP_05259863.1| translation initiation factor IF-1 [Listeria monocytogenes J0161]
 gi|254912855|ref|ZP_05262867.1| translation initiation factor IF-1 [Listeria monocytogenes J2818]
 gi|254931120|ref|ZP_05264479.1| translation initiation factor IF-1 [Listeria monocytogenes HPB2262]
 gi|254937235|ref|ZP_05268932.1| translation initiation factor IF-1 [Listeria monocytogenes F6900]
 gi|254992730|ref|ZP_05274920.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J2-064]
 gi|255017193|ref|ZP_05289319.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           F2-515]
 gi|255022695|ref|ZP_05294681.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J1-208]
 gi|255027535|ref|ZP_05299521.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J2-003]
 gi|255028411|ref|ZP_05300362.1| translation initiation factor IF-1 [Listeria monocytogenes LO28]
 gi|255520565|ref|ZP_05387802.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J1-175]
 gi|284800504|ref|YP_003412369.1| translation initiation factor IF-1 [Listeria monocytogenes 08-5578]
 gi|284993690|ref|YP_003415458.1| translation initiation factor IF-1 [Listeria monocytogenes 08-5923]
 gi|290891794|ref|ZP_06554791.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J2-071]
 gi|300763640|ref|ZP_07073638.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           N1-017]
 gi|315283818|ref|ZP_07871886.1| translation initiation factor IF-1 [Listeria marthii FSL S4-120]
 gi|315304921|ref|ZP_07875025.1| translation initiation factor IF-1 [Listeria ivanovii FSL F6-596]
 gi|54037365|sp|P65111|IF1_LISIN RecName: Full=Translation initiation factor IF-1
 gi|54041098|sp|P65110|IF1_LISMO RecName: Full=Translation initiation factor IF-1
 gi|59797576|sp|Q71WG8|IF1_LISMF RecName: Full=Translation initiation factor IF-1
 gi|123466641|sp|A0ALU6|IF1_LISW6 RecName: Full=Translation initiation factor IF-1
 gi|16412098|emb|CAD00688.1| infA [Listeria monocytogenes EGD-e]
 gi|16415295|emb|CAC97985.1| infA [Listeria innocua Clip11262]
 gi|46882055|gb|AAT05348.1| translation initiation factor IF-1 [Listeria monocytogenes serotype
           4b str. F2365]
 gi|47014440|gb|EAL05408.1| translation initiation factor IF-1 [Listeria monocytogenes str.
           1/2a F6854]
 gi|47017637|gb|EAL08436.1| translation initiation factor IF-1 [Listeria monocytogenes str. 4b
           H7858]
 gi|116742854|emb|CAK21978.1| translation initiation factor IF-1 [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|217335461|gb|ACK41255.1| translation initiation factor IF-1 [Listeria monocytogenes HCC23]
 gi|225877617|emb|CAS06331.1| Putative initiation factor IF-I [Listeria monocytogenes serotype 4b
           str. CLIP 80459]
 gi|258601468|gb|EEW14793.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           N3-165]
 gi|258607577|gb|EEW20185.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           R2-503]
 gi|258609840|gb|EEW22448.1| translation initiation factor IF-1 [Listeria monocytogenes F6900]
 gi|284056066|gb|ADB67007.1| translation initiation factor IF-1 [Listeria monocytogenes 08-5578]
 gi|284059157|gb|ADB70096.1| translation initiation factor IF-1 [Listeria monocytogenes 08-5923]
 gi|290558388|gb|EFD91905.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J2-071]
 gi|293582668|gb|EFF94700.1| translation initiation factor IF-1 [Listeria monocytogenes HPB2262]
 gi|293590853|gb|EFF99187.1| translation initiation factor IF-1 [Listeria monocytogenes J2818]
 gi|293594271|gb|EFG02032.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           J1-194]
 gi|300515917|gb|EFK42966.1| translation initiation factor IF-1 [Listeria monocytogenes FSL
           N1-017]
 gi|307572199|emb|CAR85378.1| translation initiation factor IF-1 [Listeria monocytogenes L99]
 gi|313612538|gb|EFR86612.1| translation initiation factor IF-1 [Listeria marthii FSL S4-120]
 gi|313616939|gb|EFR89575.1| translation initiation factor IF-1 [Listeria innocua FSL S4-378]
 gi|313622243|gb|EFR92757.1| translation initiation factor IF-1 [Listeria innocua FSL J1-023]
 gi|313626712|gb|EFR95741.1| translation initiation factor IF-1 [Listeria ivanovii FSL F6-596]
 gi|328468094|gb|EGF39100.1| translation initiation factor IF-1 [Listeria monocytogenes 1816]
 gi|328469782|gb|EGF40699.1| translation initiation factor IF-1 [Listeria monocytogenes 220]
 gi|332313040|gb|EGJ26135.1| Translation initiation factor IF-1 [Listeria monocytogenes str.
           Scott A]
          Length = 72

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA F V+L                                  
Sbjct: 1   MAKEDVIEVEGVVQETLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHKVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|259500914|ref|ZP_05743816.1| initiation factor IF1 [Lactobacillus iners DSM 13335]
 gi|259167608|gb|EEW52103.1| initiation factor IF1 [Lactobacillus iners DSM 13335]
          Length = 83

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  G V + LPNA F+V+L                                  
Sbjct: 11  LAKEDVIEVEGKVIDTLPNAMFKVEL---------------------------------- 36

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 37  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 81


>gi|282882532|ref|ZP_06291153.1| translation initiation factor IF-1 [Peptoniphilus lacrimalis 315-B]
 gi|300814691|ref|ZP_07094942.1| translation initiation factor IF-1 [Peptoniphilus sp. oral taxon
           836 str. F0141]
 gi|281297674|gb|EFA90149.1| translation initiation factor IF-1 [Peptoniphilus lacrimalis 315-B]
 gi|300511310|gb|EFK38559.1| translation initiation factor IF-1 [Peptoniphilus sp. oral taxon
           836 str. F0141]
          Length = 72

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V + LPN NF+VKL                                  
Sbjct: 1   MAKEDVIEVEGVVVDALPNTNFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHIILAHISGKLRMNYIRILPGDKVTVELSPYDLTRGRITWRKK 72


>gi|148824672|ref|YP_001289426.1| translation initiation factor IF-1 infA [Mycobacterium tuberculosis
           F11]
 gi|289576198|ref|ZP_06456425.1| translation initiation factor IF-1 infA [Mycobacterium tuberculosis
           K85]
 gi|289759625|ref|ZP_06519003.1| translation initiation factor IF-1 [Mycobacterium tuberculosis T85]
 gi|148723199|gb|ABR07824.1| translation initiation factor IF-1 infA [Mycobacterium tuberculosis
           F11]
 gi|289540629|gb|EFD45207.1| translation initiation factor IF-1 infA [Mycobacterium tuberculosis
           K85]
 gi|289715189|gb|EFD79201.1| translation initiation factor IF-1 [Mycobacterium tuberculosis T85]
          Length = 116

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 44  MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 70

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 71  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 116


>gi|67923559|ref|ZP_00517032.1| Translation initiation factor IF-1 [Crocosphaera watsonii WH 8501]
 gi|126658009|ref|ZP_01729161.1| translation initiation factor IF-1 [Cyanothece sp. CCY0110]
 gi|67854585|gb|EAM49871.1| Translation initiation factor IF-1 [Crocosphaera watsonii WH 8501]
 gi|126620647|gb|EAZ91364.1| translation initiation factor IF-1 [Cyanothece sp. CCY0110]
          Length = 76

 Score =  116 bits (291), Expect = 8e-25,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|224370670|ref|YP_002604834.1| InfA [Desulfobacterium autotrophicum HRM2]
 gi|223693387|gb|ACN16670.1| InfA [Desulfobacterium autotrophicum HRM2]
          Length = 72

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE ++  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEEPIKVEGTVLETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKV V M+PYD++R RITYR+K
Sbjct: 27  ----ENKHQLLAHISGKMRMHFIKILPGDKVTVEMSPYDLSRGRITYRYK 72


>gi|78358807|ref|YP_390256.1| translation initiation factor IF-1 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
 gi|119370827|sp|Q30UT5|IF12_DESDG RecName: Full=Translation initiation factor IF-1 2
 gi|78221212|gb|ABB40561.1| bacterial translation initiation factor 1 (bIF-1) [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 72

 Score =  116 bits (291), Expect = 9e-25,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIV E LPNA F+V+L                                  
Sbjct: 1   MAKEDAIEVDGIVQEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK  IRI  GDKV+V ++PYD+ R RITYR K
Sbjct: 27  ----ENGHTVLAHISGKMRKFYIRILPGDKVRVELSPYDLNRGRITYRMK 72


>gi|322381104|ref|ZP_08055107.1| translation initiation factor IF-1-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321154680|gb|EFX46951.1| translation initiation factor IF-1-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 74

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPNA F+V+L                                   
Sbjct: 4   AKEDVIEVEGTVIEPLPNAMFKVEL----------------------------------- 28

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++A+ +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 29  ---ENGHKILAHVSGKIRMHFIRILPGDKVTVELSPYDLTRGRITYRFK 74


>gi|257064667|ref|YP_003144339.1| bacterial translation initiation factor 1 (bIF-1) [Slackia
           heliotrinireducens DSM 20476]
 gi|256792320|gb|ACV22990.1| bacterial translation initiation factor 1 (bIF-1) [Slackia
           heliotrinireducens DSM 20476]
          Length = 72

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MAKEDVIELEGTVLEALPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKV V ++ YD++R RITYRFK
Sbjct: 27  ----ENGHKILAHISGKMRMHYIKILPGDKVTVELSVYDLSRGRITYRFK 72


>gi|150392136|ref|YP_001322185.1| translation initiation factor IF-1 [Alkaliphilus metalliredigens
           QYMF]
 gi|190359561|sp|A6TWF8|IF1_ALKMQ RecName: Full=Translation initiation factor IF-1
 gi|149951998|gb|ABR50526.1| translation initiation factor IF-1 [Alkaliphilus metalliredigens
           QYMF]
          Length = 72

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G++ E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIEVEGVIKEALPNATFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R H IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHVVLAHLSGKLRMHFIRILPGDKVTVELSPYDLTRGRITWRKK 72


>gi|298373288|ref|ZP_06983277.1| translation initiation factor IF-1 [Bacteroidetes oral taxon 274
           str. F0058]
 gi|298274340|gb|EFI15892.1| translation initiation factor IF-1 [Bacteroidetes oral taxon 274
           str. F0058]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQEAIEIDGTILEALSNAMFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H IRI  GDKVKV M+PYD+++ RI++R+K
Sbjct: 27  ----QNGHEIIAHISGKMRMHYIRILPGDKVKVEMSPYDLSKGRISFRYK 72


>gi|258591339|emb|CBE67638.1| Translation initiation factor IF-1 [NC10 bacterium 'Dutch
           sediment']
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MPKEEAIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    V+A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 27  ----ETGHKVLAHISGKMRMHFIRILPGDKVIVELSPYDLTRGRIIYRYK 72


>gi|81429356|ref|YP_396357.1| translation initiation factor IF-1 [Lactobacillus sakei subsp.
           sakei 23K]
 gi|119371073|sp|Q38UT3|IF1_LACSS RecName: Full=Translation initiation factor IF-1
 gi|78610999|emb|CAI56051.1| Translation initiation factor IF-1 [Lactobacillus sakei subsp.
           sakei 23K]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V++ LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIEGKVTDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + AV++A+ +G++RK+ I+I  GD+V V ++PYD+T+ RITYRFK
Sbjct: 27  ----ENGAVILAHVSGKIRKNYIKILPGDRVTVELSPYDLTKGRITYRFK 72


>gi|328953135|ref|YP_004370469.1| Translation initiation factor IF-1 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453459|gb|AEB09288.1| Translation initiation factor IF-1 [Desulfobacca acetoxidans DSM
           11109]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MPKEEAIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+ R RITYR K
Sbjct: 27  ----ENGHRVLAHISGKMRMHYIKILPGDRVTVELSPYDLNRGRITYRAK 72


>gi|153952884|ref|YP_001393649.1| translation initiation factor IF-1 [Clostridium kluyveri DSM 555]
 gi|219853549|ref|YP_002470671.1| hypothetical protein CKR_0206 [Clostridium kluyveri NBRC 12016]
 gi|190359627|sp|A5N4S0|IF1_CLOK5 RecName: Full=Translation initiation factor IF-1
 gi|146345765|gb|EDK32301.1| InfA [Clostridium kluyveri DSM 555]
 gi|219567273|dbj|BAH05257.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKDDVIEMQGTVLEALPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|150015067|ref|YP_001307321.1| translation initiation factor IF-1 [Clostridium beijerinckii NCIMB
           8052]
 gi|182418820|ref|ZP_02950085.1| translation initiation factor IF-1 [Clostridium butyricum 5521]
 gi|187935502|ref|YP_001884497.1| translation initiation factor IF-1 [Clostridium botulinum B str.
           Eklund 17B]
 gi|188588411|ref|YP_001919696.1| translation initiation factor IF-1 [Clostridium botulinum E3 str.
           Alaska E43]
 gi|237666910|ref|ZP_04526895.1| translation initiation factor IF-1 [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|251780086|ref|ZP_04823006.1| translation initiation factor IF-1 [Clostridium botulinum E1 str.
           'BoNT E Beluga']
 gi|190359624|sp|A6LPT5|IF1_CLOB8 RecName: Full=Translation initiation factor IF-1
 gi|149901532|gb|ABR32365.1| translation initiation factor IF-1 [Clostridium beijerinckii NCIMB
           8052]
 gi|182377317|gb|EDT74878.1| translation initiation factor IF-1 [Clostridium butyricum 5521]
 gi|187723655|gb|ACD24876.1| translation initiation factor IF-1 [Clostridium botulinum B str.
           Eklund 17B]
 gi|188498692|gb|ACD51828.1| translation initiation factor IF-1 [Clostridium botulinum E3 str.
           Alaska E43]
 gi|237658109|gb|EEP55664.1| translation initiation factor IF-1 [Clostridium butyricum E4 str.
           BoNT E BL5262]
 gi|243084401|gb|EES50291.1| translation initiation factor IF-1 [Clostridium botulinum E1 str.
           'BoNT E Beluga']
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKDDVIEMQGTVLESLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|291544480|emb|CBL17589.1| bacterial translation initiation factor 1 (bIF-1) [Ruminococcus sp.
           18P13]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA FRV+L                                  
Sbjct: 1   MSKEDAIELEGVVLEALPNAMFRVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G++R + IRI  GDKV + M+PYD+T+ RIT+R K
Sbjct: 28  -----NKHIILAHVSGKLRMNYIRIVPGDKVTIEMSPYDLTKGRITWRAK 72


>gi|158520746|ref|YP_001528616.1| translation initiation factor IF-1 [Desulfococcus oleovorans Hxd3]
 gi|158509572|gb|ABW66539.1| translation initiation factor IF-1 [Desulfococcus oleovorans Hxd3]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE ++  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEEAIKVEGTVLETLPNAMFKVELA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV V ++PYD+TR RITYR K
Sbjct: 28  -----NKHQVLAHISGKMRMHFIKILPGDKVTVELSPYDLTRGRITYREK 72


>gi|258404808|ref|YP_003197550.1| translation initiation factor IF-1 [Desulfohalobium retbaense DSM
           5692]
 gi|257797035|gb|ACV67972.1| translation initiation factor IF-1 [Desulfohalobium retbaense DSM
           5692]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA F+VKL                                  
Sbjct: 1   MAKEEAIEVMGEVLEALPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MRKH IRI  GDKVKV ++PYD+TR RI +R+K
Sbjct: 27  ----ENGHEVLGHISGKMRKHYIRILPGDKVKVELSPYDLTRGRIIFRYK 72


>gi|258422423|ref|ZP_05685335.1| translation initiation factor IF-1 [Staphylococcus aureus A9719]
 gi|257841854|gb|EEV66291.1| translation initiation factor IF-1 [Staphylococcus aureus A9719]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKQDVIELEGTVLDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+ YD+TR RITYR+K
Sbjct: 27  ----ENGHEILAHVSGKIRMNYIRILPGDKVTVEMSSYDLTRGRITYRYK 72


>gi|222529707|ref|YP_002573589.1| translation initiation factor IF-1 [Caldicellulosiruptor bescii DSM
           6725]
 gi|302871521|ref|YP_003840157.1| translation initiation factor IF-1 [Caldicellulosiruptor
           obsidiansis OB47]
 gi|312127249|ref|YP_003992123.1| translation initiation factor if-1 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|312135473|ref|YP_004002811.1| translation initiation factor if-1 [Caldicellulosiruptor owensensis
           OL]
 gi|312622068|ref|YP_004023681.1| translation initiation factor if-1 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312793916|ref|YP_004026839.1| translation initiation factor if-1 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312877388|ref|ZP_07737353.1| translation initiation factor IF-1 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|222456554|gb|ACM60816.1| translation initiation factor IF-1 [Caldicellulosiruptor bescii DSM
           6725]
 gi|302574380|gb|ADL42171.1| translation initiation factor IF-1 [Caldicellulosiruptor
           obsidiansis OB47]
 gi|311775524|gb|ADQ05011.1| translation initiation factor IF-1 [Caldicellulosiruptor owensensis
           OL]
 gi|311777268|gb|ADQ06754.1| translation initiation factor IF-1 [Caldicellulosiruptor
           hydrothermalis 108]
 gi|311795862|gb|EFR12226.1| translation initiation factor IF-1 [Caldicellulosiruptor
           lactoaceticus 6A]
 gi|312181056|gb|ADQ41226.1| translation initiation factor IF-1 [Caldicellulosiruptor
           kristjanssonii 177R1B]
 gi|312202535|gb|ADQ45862.1| translation initiation factor IF-1 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIELEGTVVEALPNAMFQVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI +R K
Sbjct: 28  -----NGHKVLAHVSGKLRMNFIRILPGDRVVVQLSPYDLTRGRIVWRSK 72


>gi|167948608|ref|ZP_02535682.1| Translation initiation factor IF-1 [Endoriftia persephone
           'Hot96_1+Hot96_2']
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPN  FRV+L                                  
Sbjct: 1   MAKEDFIEMEGTVTETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKV V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDKVTVQLTPYDLSKGRITYRAR 72


>gi|134298116|ref|YP_001111612.1| translation initiation factor IF-1 [Desulfotomaculum reducens MI-1]
 gi|323703525|ref|ZP_08115171.1| translation initiation factor IF-1 [Desulfotomaculum nigrificans
           DSM 574]
 gi|190359635|sp|A4J134|IF1_DESRM RecName: Full=Translation initiation factor IF-1
 gi|134050816|gb|ABO48787.1| bacterial translation initiation factor 1 (bIF-1) [Desulfotomaculum
           reducens MI-1]
 gi|323531516|gb|EGB21409.1| translation initiation factor IF-1 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKNDVIEVEGKVLEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI YRFK
Sbjct: 27  ----QNGHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLTRGRIVYRFK 72


>gi|300767843|ref|ZP_07077753.1| translation initiation factor IF-1 [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
 gi|300494828|gb|EFK29986.1| translation initiation factor IF-1 [Lactobacillus plantarum subsp.
           plantarum ATCC 14917]
          Length = 94

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  G + E LPNA F+V+L                                  
Sbjct: 23  LAKEDVIEIQGTIKETLPNAMFKVEL---------------------------------- 48

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R H IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 49  ----ENGAEILAHVSGKIRMHYIRILPGDKVTVEMSPYDLTKGRITYRFK 94


>gi|146297262|ref|YP_001181033.1| translation initiation factor IF-1 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|190359580|sp|A4XLQ7|IF1_CALS8 RecName: Full=Translation initiation factor IF-1
 gi|145410838|gb|ABP67842.1| bacterial translation initiation factor 1 (bIF-1)
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIELEGTVIEALPNAMFQVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI +R K
Sbjct: 28  -----NGHKVLAHVSGKLRMNFIRILPGDRVVVQLSPYDLTRGRIVWRSK 72


>gi|218961411|ref|YP_001741186.1| translation initiation factor IF-1 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730068|emb|CAO80980.1| translation initiation factor IF-1 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 80

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K   +E  G+V+E LPN  FRV L                                  
Sbjct: 9   MSKAGVIEVEGVVTEALPNTTFRVTL---------------------------------- 34

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+++G+MR + IRI  GDKVKV ++PYD+TR RITYR+K
Sbjct: 35  ----ENGHEILAHSSGKMRMNYIRILPGDKVKVELSPYDLTRGRITYRYK 80


>gi|284929581|ref|YP_003422103.1| translation initiation factor 1 [cyanobacterium UCYN-A]
 gi|284810025|gb|ADB95722.1| bacterial translation initiation factor 1 (bIF-1) [cyanobacterium
           UCYN-A]
          Length = 75

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|293375412|ref|ZP_06621693.1| translation initiation factor IF-1 [Turicibacter sanguinis PC909]
 gi|325844442|ref|ZP_08168169.1| translation initiation factor IF-1 [Turicibacter sp. HGF1]
 gi|292645965|gb|EFF63994.1| translation initiation factor IF-1 [Turicibacter sanguinis PC909]
 gi|325489116|gb|EGC91500.1| translation initiation factor IF-1 [Turicibacter sp. HGF1]
          Length = 72

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E    V + LPNA F+V+L                                  
Sbjct: 1   MAKQDVIEVEATVIDNLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G++R + IRI  GDKV V ++PYD+TR RITYR K
Sbjct: 27  ----ENGHQLIAHVSGKIRMNFIRILPGDKVTVELSPYDLTRGRITYRHK 72


>gi|189424971|ref|YP_001952148.1| translation initiation factor IF-1 [Geobacter lovleyi SZ]
 gi|189421230|gb|ACD95628.1| translation initiation factor IF-1 [Geobacter lovleyi SZ]
          Length = 72

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+A+ +G+MRK+ I+I  GDKV V ++PYD+TR RITYR K
Sbjct: 27  ----ENDHIVLAHISGKMRKYFIKILPGDKVTVELSPYDLTRGRITYRAK 72


>gi|328955890|ref|YP_004373223.1| bacterial translation initiation factor 1 (bIF-1) [Coriobacterium
           glomerans PW2]
 gi|328456214|gb|AEB07408.1| bacterial translation initiation factor 1 (bIF-1) [Coriobacterium
           glomerans PW2]
          Length = 91

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE+ +E  G V+E LPNA FRV+L                                    
Sbjct: 22  KEDAIELEGTVTEPLPNAMFRVEL------------------------------------ 45

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 46  --ENGHTVLCSISGKIRMNYIRILPGDKVVVELSPYDLTRGRITYRYK 91


>gi|289435876|ref|YP_003465748.1| translation initiation factor IF-1 [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289172120|emb|CBH28666.1| translation initiation factor IF-1 [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|313631794|gb|EFR98974.1| translation initiation factor IF-1 [Listeria seeligeri FSL N1-067]
 gi|313636146|gb|EFS02009.1| translation initiation factor IF-1 [Listeria seeligeri FSL S4-171]
          Length = 72

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPNA F V+L                                  
Sbjct: 1   MAKEDVIEVEGVVHETLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHKVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 72


>gi|313888774|ref|ZP_07822435.1| translation initiation factor IF-1 [Peptoniphilus harei
           ACS-146-V-Sch2b]
 gi|312845143|gb|EFR32543.1| translation initiation factor IF-1 [Peptoniphilus harei
           ACS-146-V-Sch2b]
          Length = 72

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V + LPN +F+V+L                                  
Sbjct: 1   MAKEDVIEVEGVVVDALPNTHFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHIILAHISGKLRMNYIRILPGDKVTVELSPYDLTRGRITWRKK 72


>gi|300857224|ref|YP_003782208.1| translation initiation factor IF-1 [Clostridium ljungdahlii DSM
           13528]
 gi|300437339|gb|ADK17106.1| translation initiation factor IF-1 [Clostridium ljungdahlii DSM
           13528]
          Length = 72

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKDDVIEIQGTVLEALPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|119484812|ref|ZP_01619294.1| translation initiation factor IF-1 [Lyngbya sp. PCC 8106]
 gi|119457630|gb|EAW38754.1| translation initiation factor IF-1 [Lyngbya sp. PCC 8106]
          Length = 74

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|116628984|ref|YP_814156.1| translation initiation factor 1 [Lactobacillus gasseri ATCC 33323]
 gi|227888831|ref|ZP_04006636.1| initiation factor IF1 [Lactobacillus johnsonii ATCC 33200]
 gi|116094566|gb|ABJ59718.1| bacterial translation initiation factor 1 (bIF-1) [Lactobacillus
           gasseri ATCC 33323]
 gi|227850668|gb|EEJ60754.1| initiation factor IF1 [Lactobacillus johnsonii ATCC 33200]
          Length = 83

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  G V + LPNA F+V+L                                  
Sbjct: 11  LAKEDVIEVEGKVVDTLPNAMFKVEL---------------------------------- 36

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 37  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 81


>gi|194334839|ref|YP_002016699.1| translation initiation factor IF-1 [Prosthecochloris aestuarii DSM
           271]
 gi|194312657|gb|ACF47052.1| translation initiation factor IF-1 [Prosthecochloris aestuarii DSM
           271]
          Length = 72

 Score =  115 bits (289), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G++ E LPNA F+V+L                                  
Sbjct: 1   MAKEDSIEVEGVILEALPNAQFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GDKVKV ++PYD+T+ RITYR+K
Sbjct: 27  ----ENGLEILAHVSGKIRMHYIRILPGDKVKVQISPYDLTKGRITYRYK 72


>gi|145596411|ref|YP_001160708.1| translation initiation factor IF-1 [Salinispora tropica CNB-440]
 gi|145305748|gb|ABP56330.1| bacterial translation initiation factor 1 (bIF-1) [Salinispora
           tropica CNB-440]
          Length = 153

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           MPK++  +E  G V E LPNA FRV+L                                 
Sbjct: 81  MPKKDGAIEIEGRVIEPLPNAMFRVELA-------------------------------- 108

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 109 ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 153


>gi|313673445|ref|YP_004051556.1| bacterial translation initiation factor 1 (bif-1) [Calditerrivibrio
           nitroreducens DSM 19672]
 gi|312940201|gb|ADR19393.1| bacterial translation initiation factor 1 (bIF-1) [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 73

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +EF G+V E LPNA F+V+L                                    
Sbjct: 4   KDDVIEFEGVVLEALPNAMFKVEL------------------------------------ 27

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +  V++ + +G+MR + IRI  GDKV V M+PYD+T+ RITYR K
Sbjct: 28  --ENKHVILCHLSGKMRMNFIRILPGDKVTVEMSPYDLTKGRITYRHK 73


>gi|108762768|ref|YP_631520.1| translation initiation factor IF-1 [Myxococcus xanthus DK 1622]
 gi|115376111|ref|ZP_01463356.1| translation initiation factor IF-1 [Stigmatella aurantiaca DW4/3-1]
 gi|119371082|sp|Q1D753|IF1_MYXXD RecName: Full=Translation initiation factor IF-1
 gi|108466648|gb|ABF91833.1| translation initiation factor IF-1 [Myxococcus xanthus DK 1622]
 gi|115366926|gb|EAU65916.1| translation initiation factor IF-1 [Stigmatella aurantiaca DW4/3-1]
          Length = 72

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK++++E  G V E LPNA FRV L                                  
Sbjct: 1   MPKDDSIEVEGTVMEPLPNAMFRVVLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GDKVKV ++PYD+TR RITYR K
Sbjct: 28  -----NGHKVLAHISGKMRMHFIRILPGDKVKVELSPYDLTRGRITYRAK 72


>gi|167749415|ref|ZP_02421542.1| hypothetical protein EUBSIR_00369 [Eubacterium siraeum DSM 15702]
 gi|167657587|gb|EDS01717.1| hypothetical protein EUBSIR_00369 [Eubacterium siraeum DSM 15702]
          Length = 72

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E SG + E LPNA F+V+L                                  
Sbjct: 1   MSKEDVIEVSGKIIEALPNATFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+T+ RIT+R K
Sbjct: 27  ----ENGHKILAHVSGKLRMNFIRILPGDKVTVEMSPYDLTKGRITWRAK 72


>gi|148544674|ref|YP_001272044.1| translation initiation factor IF-1 [Lactobacillus reuteri DSM
           20016]
 gi|184154027|ref|YP_001842368.1| translation initiation factor IF-1 [Lactobacillus reuteri JCM 1112]
 gi|194466931|ref|ZP_03072918.1| translation initiation factor IF-1 [Lactobacillus reuteri 100-23]
 gi|227363797|ref|ZP_03847904.1| translation initiation factor IF-1 [Lactobacillus reuteri MM2-3]
 gi|227543601|ref|ZP_03973650.1| translation initiation factor IF-1 [Lactobacillus reuteri CF48-3A]
 gi|259502553|ref|ZP_05745455.1| initiation factor IF1 [Lactobacillus antri DSM 16041]
 gi|300909370|ref|ZP_07126831.1| translation initiation factor IF-1 [Lactobacillus reuteri SD2112]
 gi|312870493|ref|ZP_07730612.1| translation initiation factor IF-1 [Lactobacillus oris PB013-T2-3]
 gi|325683008|ref|ZP_08162524.1| translation initiation factor IF-1 [Lactobacillus reuteri MM4-1A]
 gi|209572878|sp|A5VLI3|IF1_LACRD RecName: Full=Translation initiation factor IF-1
 gi|148531708|gb|ABQ83707.1| bacterial translation initiation factor 1 (bIF-1) [Lactobacillus
           reuteri DSM 20016]
 gi|183225371|dbj|BAG25888.1| translation initiation factor IF-1 [Lactobacillus reuteri JCM 1112]
 gi|194453967|gb|EDX42864.1| translation initiation factor IF-1 [Lactobacillus reuteri 100-23]
 gi|227071154|gb|EEI09470.1| translation initiation factor IF-1 [Lactobacillus reuteri MM2-3]
 gi|227186441|gb|EEI66512.1| translation initiation factor IF-1 [Lactobacillus reuteri CF48-3A]
 gi|259169505|gb|EEW54000.1| initiation factor IF1 [Lactobacillus antri DSM 16041]
 gi|300893235|gb|EFK86594.1| translation initiation factor IF-1 [Lactobacillus reuteri SD2112]
 gi|311093955|gb|EFQ52280.1| translation initiation factor IF-1 [Lactobacillus oris PB013-T2-3]
 gi|324977358|gb|EGC14309.1| translation initiation factor IF-1 [Lactobacillus reuteri MM4-1A]
          Length = 72

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKADVIEVEGKVTETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R H I+I  GD+VKV M+PYD+T+ RIT+RFK
Sbjct: 27  ----ENGAEILAHVSGKIRMHYIKILPGDRVKVEMSPYDLTKGRITFRFK 72


>gi|125950065|sp|Q1ACG4|IF1C_CHAVU RecName: Full=Translation initiation factor IF-1, chloroplastic
          Length = 78

 Score =  115 bits (289), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+V+E LPNA FRV L                                  
Sbjct: 1   MSKQNLIEIEGLVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++RK+ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCEVLTHISGKIRKNYIRILPGDRVKVELSPYDLTKGRITYRLR 72


>gi|332798229|ref|YP_004459728.1| Translation initiation factor IF-1 [Tepidanaerobacter sp. Re1]
 gi|332695964|gb|AEE90421.1| Translation initiation factor IF-1 [Tepidanaerobacter sp. Re1]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKEDVIEVEGTVLEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G++R + IRI  GD+V V ++PYD+TR RI YRFK
Sbjct: 27  ----KNGHVILAHVSGKIRMNYIRILPGDRVTVELSPYDLTRGRIKYRFK 72


>gi|158337830|ref|YP_001519006.1| translation initiation factor IF-1 [Acaryochloris marina MBIC11017]
 gi|190359552|sp|B0C1F3|IF1_ACAM1 RecName: Full=Translation initiation factor IF-1
 gi|158308071|gb|ABW29688.1| translation initiation factor IF-1 [Acaryochloris marina MBIC11017]
          Length = 74

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MAKQDAIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|302876510|ref|YP_003845143.1| translation initiation factor IF-1 [Clostridium cellulovorans 743B]
 gi|307687182|ref|ZP_07629628.1| translation initiation factor IF-1 [Clostridium cellulovorans 743B]
 gi|302579367|gb|ADL53379.1| translation initiation factor IF-1 [Clostridium cellulovorans 743B]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEMEGSVIEALPNAAFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +++A+ +G++R + IRI  GDKV V ++PYD++R RIT+R K
Sbjct: 27  ----ESGQIILAHISGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRAK 72


>gi|269217224|ref|ZP_06161078.1| translation initiation factor IF-1 [Slackia exigua ATCC 700122]
 gi|269129361|gb|EEZ60446.1| translation initiation factor IF-1 [Slackia exigua ATCC 700122]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MAKQDVIELEGTVLEALPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKV V ++ YD+ R RITYRFK
Sbjct: 27  ----ENGHKILAHISGKMRMHYIKILPGDKVTVELSIYDLNRGRITYRFK 72


>gi|332712148|ref|ZP_08432076.1| bacterial translation initiation factor 1 [Lyngbya majuscula 3L]
 gi|332348954|gb|EGJ28566.1| bacterial translation initiation factor 1 [Lyngbya majuscula 3L]
          Length = 74

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MAKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|255526602|ref|ZP_05393509.1| translation initiation factor IF-1 [Clostridium carboxidivorans P7]
 gi|296187291|ref|ZP_06855687.1| translation initiation factor IF-1 [Clostridium carboxidivorans P7]
 gi|255509710|gb|EET86043.1| translation initiation factor IF-1 [Clostridium carboxidivorans P7]
 gi|296048162|gb|EFG87600.1| translation initiation factor IF-1 [Clostridium carboxidivorans P7]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKDDVIEMQGTVLEALPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD++R RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRAK 72


>gi|118580182|ref|YP_901432.1| translation initiation factor IF-1 [Pelobacter propionicus DSM
           2379]
 gi|190359664|sp|A1APV4|IF1_PELPD RecName: Full=Translation initiation factor IF-1
 gi|118502892|gb|ABK99374.1| bacterial translation initiation factor 1 (bIF-1) [Pelobacter
           propionicus DSM 2379]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEEAIEVEGTVVEPLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+A+ +G+MRK+ I+I  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENDHIVLAHISGKMRKYFIKILPGDKVTVELSPYDLSRGRITYRAK 72


>gi|308272957|emb|CBX29561.1| Translation initiation factor IF-1 [uncultured Desulfobacterium
           sp.]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E ++  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDEAIKVEGTVLETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV V ++PYD+TR RITYR K
Sbjct: 27  ----ENKHQVLAHISGKMRMHFIKILPGDKVTVELSPYDLTRGRITYRTK 72


>gi|147676678|ref|YP_001210893.1| translation initiation factor 1 [Pelotomaculum thermopropionicum
           SI]
 gi|190359665|sp|A5D5E3|IF1_PELTS RecName: Full=Translation initiation factor IF-1
 gi|146272775|dbj|BAF58524.1| translation initiation factor 1 [Pelotomaculum thermopropionicum
           SI]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKQDVIEVEGTVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI YR+K
Sbjct: 27  ----QNGHKVLAHVSGKIRMNFIRILAGDRVMVELSPYDLTRGRIVYRYK 72


>gi|304647597|ref|YP_003864076.1| translation initiation factor IF-1 [Clostridium tetani E88]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MAKEDVIEMQGTVLESLPNAVFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNYIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|51244999|ref|YP_064883.1| translation initiation factor IF-1 [Desulfotalea psychrophila
           LSv54]
 gi|50876036|emb|CAG35876.1| probable translation initiation factor IF-1 [Desulfotalea
           psychrophila LSv54]
          Length = 83

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G + E LPNA FRV+L                                  
Sbjct: 6   MAKEEAIEVEGTIIEPLPNAMFRVELD--------------------------------- 32

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+TR R+T+R K
Sbjct: 33  -----NGHKVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRTK 77


>gi|148264201|ref|YP_001230907.1| translation initiation factor IF-1 [Geobacter uraniireducens Rf4]
 gi|190359702|sp|A5G3G6|IF1_GEOUR RecName: Full=Translation initiation factor IF-1
 gi|146397701|gb|ABQ26334.1| bacterial translation initiation factor 1 (bIF-1) [Geobacter
           uraniireducens Rf4]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA F+VKL                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+A+ +G+MRK+ I+I  GDKV V ++PYD+TR RITYR K
Sbjct: 27  ----ENDHIVLAHISGKMRKYFIKILPGDKVTVELSPYDLTRGRITYRAK 72


>gi|242278633|ref|YP_002990762.1| translation initiation factor IF-1 [Desulfovibrio salexigens DSM
           2638]
 gi|242121527|gb|ACS79223.1| translation initiation factor IF-1 [Desulfovibrio salexigens DSM
           2638]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  GIV E LPNA F+V+L                                  
Sbjct: 1   MAKEEGIEVEGIVQEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + +G+MRKH IRI  GD+VKV ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHVILGHISGKMRKHYIRILPGDRVKVELSPYDLTRGRITFRMK 72


>gi|302388735|ref|YP_003824556.1| bacterial translation initiation factor 1 (bIF-1)
           [Thermosediminibacter oceani DSM 16646]
 gi|302199363|gb|ADL06933.1| bacterial translation initiation factor 1 (bIF-1)
           [Thermosediminibacter oceani DSM 16646]
          Length = 72

 Score =  115 bits (288), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPN  FRV+L                                  
Sbjct: 1   MSKSDVIEVEGTVVEPLPNGMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 27  ----KNGHKVLAHVSGKIRMNYIRILPGDKVTVELSPYDLTRGRIVYRYK 72


>gi|86610049|ref|YP_478811.1| translation initiation factor IF-1 [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|119371134|sp|Q2JIK6|IF1_SYNJB RecName: Full=Translation initiation factor IF-1
 gi|86558591|gb|ABD03548.1| translation initiation factor IF-1 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 74

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V+E LPNA FRV L                                  
Sbjct: 1   MSKEDAIEMEGVVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV ++PYD+ + RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELSPYDLNKGRITYRLK 72


>gi|89893240|ref|YP_516727.1| hypothetical protein DSY0494 [Desulfitobacterium hafniense Y51]
 gi|219666513|ref|YP_002456948.1| translation initiation factor IF-1 [Desulfitobacterium hafniense
           DCB-2]
 gi|119370861|sp|Q250K9|IF1_DESHY RecName: Full=Translation initiation factor IF-1
 gi|89332688|dbj|BAE82283.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219536773|gb|ACL18512.1| translation initiation factor IF-1 [Desulfitobacterium hafniense
           DCB-2]
          Length = 72

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKEDVIEVEGKVLEPLPNAMFLVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD++R RI YRFK
Sbjct: 28  -----NGHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLSRGRIVYRFK 72


>gi|206890382|ref|YP_002249224.1| translation initiation factor IF-1 [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206742320|gb|ACI21377.1| translation initiation factor IF-1 [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 72

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE +E  G + E LPNA FRVKL                                  
Sbjct: 1   MPKEEHIEMQGTIEEALPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++AY +G+MR H I+I  GDKV V ++PYD+T+ RI YRFK
Sbjct: 27  ----ENGHVILAYVSGKMRMHFIKILPGDKVLVEISPYDLTKGRIIYRFK 72


>gi|313677141|ref|YP_004055137.1| bacterial translation initiation factor 1 (bif-1) [Marivirga
           tractuosa DSM 4126]
 gi|312943839|gb|ADR23029.1| bacterial translation initiation factor 1 (bIF-1) [Marivirga
           tractuosa DSM 4126]
          Length = 72

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G ++E L NA FRV+L                                  
Sbjct: 1   MAKQSSIEQDGTITEALSNAMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR + I+I  GDKVK+ M+PYD+T+ RI YR+K
Sbjct: 28  -----NGHEVIAHISGKMRMNYIKILPGDKVKLEMSPYDLTKGRIVYRYK 72


>gi|284053323|ref|ZP_06383533.1| translation initiation factor IF-1 [Arthrospira platensis str.
           Paraca]
 gi|291567804|dbj|BAI90076.1| translation initiation factor IF-1 [Arthrospira platensis NIES-39]
          Length = 74

 Score =  115 bits (287), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+++ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLSKGRITYRLK 72


>gi|144897403|emb|CAM74267.1| Translation initiation factor if-1 [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEDVIEFSGNVTELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NEHEILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|42518451|ref|NP_964381.1| translation initiation factor IF-1 [Lactobacillus johnsonii NCC
           533]
 gi|238853461|ref|ZP_04643839.1| translation initiation factor IF-1 [Lactobacillus gasseri 202-4]
 gi|268318873|ref|YP_003292529.1| Translation initiation factor IF-1 [Lactobacillus johnsonii FI9785]
 gi|282852671|ref|ZP_06262013.1| translation initiation factor IF-1 [Lactobacillus gasseri 224-1]
 gi|300362367|ref|ZP_07058543.1| translation initiation factor IF-1 [Lactobacillus gasseri JV-V03]
 gi|311111218|ref|ZP_07712615.1| translation initiation factor IF-1 [Lactobacillus gasseri MV-22]
 gi|48428197|sp|P61689|IF1_LACJO RecName: Full=Translation initiation factor IF-1
 gi|190359777|sp|Q046A4|IF1_LACGA RecName: Full=Translation initiation factor IF-1
 gi|41582736|gb|AAS08347.1| translation initiation factor IF-1 [Lactobacillus johnsonii NCC
           533]
 gi|238833901|gb|EEQ26160.1| translation initiation factor IF-1 [Lactobacillus gasseri 202-4]
 gi|262397248|emb|CAX66262.1| Translation initiation factor IF-1 [Lactobacillus johnsonii FI9785]
 gi|282556413|gb|EFB62033.1| translation initiation factor IF-1 [Lactobacillus gasseri 224-1]
 gi|300353358|gb|EFJ69230.1| translation initiation factor IF-1 [Lactobacillus gasseri JV-V03]
 gi|311066372|gb|EFQ46712.1| translation initiation factor IF-1 [Lactobacillus gasseri MV-22]
 gi|329666714|gb|AEB92662.1| translation initiation factor IF-1 [Lactobacillus johnsonii DPC
           6026]
          Length = 73

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGKVVDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 27  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 71


>gi|254517494|ref|ZP_05129550.1| translation initiation factor IF-1 [Clostridium sp. 7_2_43FAA]
 gi|226911243|gb|EEH96444.1| translation initiation factor IF-1 [Clostridium sp. 7_2_43FAA]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKDDVIEMQGTVLESLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV + ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTIELSPYDLTRGRITWRAK 72


>gi|193214821|ref|YP_001996020.1| translation initiation factor IF-1 [Chloroherpeton thalassium ATCC
           35110]
 gi|193088298|gb|ACF13573.1| translation initiation factor IF-1 [Chloroherpeton thalassium ATCC
           35110]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G++ E LPNANFRVKL                                  
Sbjct: 1   MAKEEAIEVDGVILEALPNANFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V+V ++PYD+T+ RITYRFK
Sbjct: 27  ----ENELEVLAHVSGKMRMHFIKILPGDRVRVQLSPYDLTKGRITYRFK 72


>gi|302190633|ref|ZP_07266887.1| translation initiation factor IF-1 [Lactobacillus iners AB-1]
 gi|309803636|ref|ZP_07697726.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           11V1-d]
 gi|309804963|ref|ZP_07699021.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           09V1-c]
 gi|309806723|ref|ZP_07700718.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           03V1-b]
 gi|309808433|ref|ZP_07702332.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           01V1-a]
 gi|309809061|ref|ZP_07702934.1| translation initiation factor IF-1 [Lactobacillus iners SPIN
           2503V10-D]
 gi|312871217|ref|ZP_07731315.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           3008A-a]
 gi|312872760|ref|ZP_07732825.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2062A-h1]
 gi|312874102|ref|ZP_07734137.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2052A-d]
 gi|312874745|ref|ZP_07734764.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2053A-b]
 gi|315654004|ref|ZP_07906920.1| translation initiation factor IF-1 [Lactobacillus iners ATCC 55195]
 gi|325912359|ref|ZP_08174755.1| translation initiation factor IF-1 [Lactobacillus iners UPII 143-D]
 gi|325913198|ref|ZP_08175567.1| translation initiation factor IF-1 [Lactobacillus iners UPII 60-B]
 gi|329920628|ref|ZP_08277315.1| translation initiation factor IF-1 [Lactobacillus iners SPIN 1401G]
 gi|308164234|gb|EFO66491.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           11V1-d]
 gi|308165723|gb|EFO67948.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           09V1-c]
 gi|308166903|gb|EFO69087.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           03V1-b]
 gi|308168261|gb|EFO70380.1| translation initiation factor IF-1 [Lactobacillus iners LactinV
           01V1-a]
 gi|308170506|gb|EFO72526.1| translation initiation factor IF-1 [Lactobacillus iners SPIN
           2503V10-D]
 gi|311089490|gb|EFQ47915.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2053A-b]
 gi|311090442|gb|EFQ48851.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2052A-d]
 gi|311091802|gb|EFQ50181.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           2062A-h1]
 gi|311093231|gb|EFQ51577.1| translation initiation factor IF-1 [Lactobacillus iners LEAF
           3008A-a]
 gi|315488700|gb|EFU78346.1| translation initiation factor IF-1 [Lactobacillus iners ATCC 55195]
 gi|325475830|gb|EGC79000.1| translation initiation factor IF-1 [Lactobacillus iners UPII 143-D]
 gi|325477462|gb|EGC80605.1| translation initiation factor IF-1 [Lactobacillus iners UPII 60-B]
 gi|328935886|gb|EGG32346.1| translation initiation factor IF-1 [Lactobacillus iners SPIN 1401G]
          Length = 73

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGKVIDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 27  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 71


>gi|229546942|ref|ZP_04435667.1| translation initiation factor IF-1 [Enterococcus faecalis TX1322]
 gi|229550531|ref|ZP_04439256.1| translation initiation factor IF-1 [Enterococcus faecalis ATCC
           29200]
 gi|293382736|ref|ZP_06628661.1| translation initiation factor IF-1 [Enterococcus faecalis R712]
 gi|307286992|ref|ZP_07567067.1| translation initiation factor IF-1 [Enterococcus faecalis TX0109]
 gi|312901100|ref|ZP_07760388.1| translation initiation factor IF-1 [Enterococcus faecalis TX0470]
 gi|312904662|ref|ZP_07763817.1| translation initiation factor IF-1 [Enterococcus faecalis TX0635]
 gi|312908631|ref|ZP_07767573.1| translation initiation factor IF-1 [Enterococcus faecalis DAPTO
           512]
 gi|229304250|gb|EEN70246.1| translation initiation factor IF-1 [Enterococcus faecalis ATCC
           29200]
 gi|229307870|gb|EEN73857.1| translation initiation factor IF-1 [Enterococcus faecalis TX1322]
 gi|291079896|gb|EFE17260.1| translation initiation factor IF-1 [Enterococcus faecalis R712]
 gi|306501938|gb|EFM71227.1| translation initiation factor IF-1 [Enterococcus faecalis TX0109]
 gi|310625418|gb|EFQ08701.1| translation initiation factor IF-1 [Enterococcus faecalis DAPTO
           512]
 gi|310632014|gb|EFQ15297.1| translation initiation factor IF-1 [Enterococcus faecalis TX0635]
 gi|311291772|gb|EFQ70328.1| translation initiation factor IF-1 [Enterococcus faecalis TX0470]
 gi|315026813|gb|EFT38745.1| translation initiation factor IF-1 [Enterococcus faecalis TX2137]
 gi|315028853|gb|EFT40785.1| translation initiation factor IF-1 [Enterococcus faecalis TX4000]
 gi|315035993|gb|EFT47925.1| translation initiation factor IF-1 [Enterococcus faecalis TX0027]
 gi|315147149|gb|EFT91165.1| translation initiation factor IF-1 [Enterococcus faecalis TX4244]
 gi|315153587|gb|EFT97603.1| translation initiation factor IF-1 [Enterococcus faecalis TX0031]
 gi|315165879|gb|EFU09896.1| translation initiation factor IF-1 [Enterococcus faecalis TX1302]
 gi|315171438|gb|EFU15455.1| translation initiation factor IF-1 [Enterococcus faecalis TX1342]
 gi|315172672|gb|EFU16689.1| translation initiation factor IF-1 [Enterococcus faecalis TX1346]
 gi|315582116|gb|EFU94307.1| translation initiation factor IF-1 [Enterococcus faecalis TX0309A]
          Length = 84

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPNA F+V+L                                   
Sbjct: 14  AKEDMIEVEGTVVETLPNAMFKVEL----------------------------------- 38

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   V+A  +G++R H IRI  GDKV V ++PYD+TR RITYRFK
Sbjct: 39  ---ENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLTRGRITYRFK 84


>gi|119899685|ref|YP_934898.1| translation initiation factor IF-1 [Azoarcus sp. BH72]
 gi|190359537|sp|A1KB06|IF12_AZOSB RecName: Full=Translation initiation factor IF-1 2
 gi|119672098|emb|CAL96012.1| translation initiation factor IF-1 [Azoarcus sp. BH72]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPNA FRVKL                                  
Sbjct: 1   MAKEDVIEMQGEVTENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGHMVLGHISGKMRMHYIRILPGDKVTVQLTPYDLTKGRIVFRTK 72


>gi|228470723|ref|ZP_04055574.1| translation initiation factor IF-1 [Porphyromonas uenonis 60-3]
 gi|313887047|ref|ZP_07820746.1| translation initiation factor IF-1 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332299548|ref|YP_004441469.1| translation initiation factor IF-1 [Porphyromonas asaccharolytica
           DSM 20707]
 gi|228307580|gb|EEK16576.1| translation initiation factor IF-1 [Porphyromonas uenonis 60-3]
 gi|312923458|gb|EFR34268.1| translation initiation factor IF-1 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332176611|gb|AEE12301.1| translation initiation factor IF-1 [Porphyromonas asaccharolytica
           DSM 20707]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+V E L NA F+V+L                                  
Sbjct: 1   MAKQTAIEQDGVVLEALSNAMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  ++ A+ +G+MR H IRI  GDKVKV M+PYD+TR RI+YR+K
Sbjct: 27  ----QNGHIITAHISGKMRMHFIRILPGDKVKVEMSPYDLTRGRISYRYK 72


>gi|256847785|ref|ZP_05553230.1| translation initiation factor IF-1 [Lactobacillus coleohominis
           101-4-CHN]
 gi|256715474|gb|EEU30450.1| translation initiation factor IF-1 [Lactobacillus coleohominis
           101-4-CHN]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKADVIEVEGKVTETLPNAMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H I+I  GD+VKV M+PYD+T+ RIT+RFK
Sbjct: 27  ----ENGVEILAHVSGKIRMHYIKILPGDRVKVEMSPYDLTKGRITFRFK 72


>gi|188584860|ref|YP_001916405.1| translation initiation factor 1 (bIF-1) [Natranaerobius
           thermophilus JW/NM-WN-LF]
 gi|179349547|gb|ACB83817.1| translation initiation factor 1 (bIF-1) [Natranaerobius
           thermophilus JW/NM-WN-LF]
          Length = 85

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E +E  G V E LPNA FRV+L                                  
Sbjct: 14  MSKKEAIEVEGTVVEPLPNAMFRVEL---------------------------------- 39

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKVKV ++PYD++R RITYR+K
Sbjct: 40  ----ENGHKILAHVSGKIRMNYIRILPGDKVKVELSPYDLSRGRITYRYK 85


>gi|196228476|ref|ZP_03127343.1| translation initiation factor IF-1 [Chthoniobacter flavus Ellin428]
 gi|196227879|gb|EDY22382.1| translation initiation factor IF-1 [Chthoniobacter flavus Ellin428]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V ELLPN  FRV L                                  
Sbjct: 1   MAKKDAIEVEGRVVELLPNTMFRVALP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GDKV + M+PYD+T+ RIT+R K
Sbjct: 28  -----NGHQVLAHISGKMRLHFIRILPGDKVLLEMSPYDLTKGRITFRQK 72


>gi|254423094|ref|ZP_05036812.1| translation initiation factor IF-1 [Synechococcus sp. PCC 7335]
 gi|196190583|gb|EDX85547.1| translation initiation factor IF-1 [Synechococcus sp. PCC 7335]
          Length = 75

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G ++E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTITESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|197118438|ref|YP_002138865.1| translation initiation factor IF-1 [Geobacter bemidjiensis Bem]
 gi|253700781|ref|YP_003021970.1| translation initiation factor IF-1 [Geobacter sp. M21]
 gi|322419665|ref|YP_004198888.1| translation initiation factor IF-1 [Geobacter sp. M18]
 gi|197087798|gb|ACH39069.1| translation initiation factor IF-1 [Geobacter bemidjiensis Bem]
 gi|251775631|gb|ACT18212.1| translation initiation factor IF-1 [Geobacter sp. M21]
 gi|320126052|gb|ADW13612.1| translation initiation factor IF-1 [Geobacter sp. M18]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA F+VKL                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+A+ +G+MRK  I+I  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENDHMVLAHISGKMRKFFIKILPGDKVTVELSPYDLSRGRITYRAK 72


>gi|320352935|ref|YP_004194274.1| translation initiation factor 1 (bIF-1) [Desulfobulbus propionicus
           DSM 2032]
 gi|320121437|gb|ADW16983.1| bacterial translation initiation factor 1 (bIF-1) [Desulfobulbus
           propionicus DSM 2032]
          Length = 78

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G + E LPNA F+V+L                                  
Sbjct: 1   MAKEEAIEVEGTIIEPLPNAMFQVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+TR R+T+R K
Sbjct: 28  -----NGHKVLAHISGKMRMHYIKILPGDRVTVELSPYDLTRGRVTFRAK 72


>gi|253682306|ref|ZP_04863103.1| translation initiation factor IF-1 [Clostridium botulinum D str.
           1873]
 gi|331268437|ref|YP_004394929.1| translation initiation factor IF-1 [Clostridium botulinum
           BKT015925]
 gi|253562018|gb|EES91470.1| translation initiation factor IF-1 [Clostridium botulinum D str.
           1873]
 gi|329124987|gb|AEB74932.1| translation initiation factor IF-1 [Clostridium botulinum
           BKT015925]
          Length = 72

 Score =  115 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+++L                                  
Sbjct: 1   MSKDDVIEMQGTVLEALPNAMFQIQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGQTILAHVSGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|327191623|gb|EGE58635.1| translation initiation factor IF-1 [Rhizobium etli CNPAF512]
          Length = 114

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE LEF GIV+ELLPNA FRVKL                                  
Sbjct: 43  MPKEEVLEFPGIVTELLPNATFRVKL---------------------------------- 68

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 69  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 114


>gi|15902255|ref|NP_357805.1| translation initiation factor IF-1 [Streptococcus pneumoniae R6]
 gi|182683210|ref|YP_001834957.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CGSP14]
 gi|15457756|gb|AAK99015.1| Translation initiation factor IF-1 [Streptococcus pneumoniae R6]
 gi|182628544|gb|ACB89492.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CGSP14]
          Length = 90

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V + +PNA F V+L                                   
Sbjct: 20  AKDDVIEVEGKVVDTMPNAMFTVEL----------------------------------- 44

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++A  +G++RK+ IRI  GD+V V M+PYD+TR RITYRFK
Sbjct: 45  ---ENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK 90


>gi|86605845|ref|YP_474608.1| translation initiation factor IF-1 [Synechococcus sp. JA-3-3Ab]
 gi|119371133|sp|Q2JV98|IF1_SYNJA RecName: Full=Translation initiation factor IF-1
 gi|86554387|gb|ABC99345.1| translation initiation factor IF-1 [Synechococcus sp. JA-3-3Ab]
          Length = 74

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V+E LPNA FRV L                                  
Sbjct: 1   MSKEDAIEVEGVVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV ++PYD+ + RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELSPYDLNKGRITYRLK 72


>gi|15896360|ref|NP_349709.1| translation initiation factor IF-1 [Clostridium acetobutylicum ATCC
           824]
 gi|20138498|sp|Q97EK1|IF1_CLOAB RecName: Full=Translation initiation factor IF-1
 gi|15026176|gb|AAK81049.1|AE007808_2 Translation initiation factor IF-1 [Clostridium acetobutylicum ATCC
           824]
 gi|325510515|gb|ADZ22151.1| Translation initiation factor IF-1 [Clostridium acetobutylicum EA
           2018]
          Length = 72

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKEDVIEMQGTVLESLPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGQKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|254412170|ref|ZP_05025945.1| translation initiation factor IF-1 [Microcoleus chthonoplastes PCC
           7420]
 gi|196181136|gb|EDX76125.1| translation initiation factor IF-1 [Microcoleus chthonoplastes PCC
           7420]
          Length = 74

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MAKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+++ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLSKGRITYRLR 72


>gi|18311363|ref|NP_563297.1| translation initiation factor IF-1 [Clostridium perfringens str.
           13]
 gi|110800093|ref|YP_697070.1| translation initiation factor IF-1 [Clostridium perfringens ATCC
           13124]
 gi|110802375|ref|YP_699639.1| translation initiation factor IF-1 [Clostridium perfringens SM101]
 gi|168205210|ref|ZP_02631215.1| translation initiation factor IF-1 [Clostridium perfringens E str.
           JGS1987]
 gi|168211881|ref|ZP_02637506.1| translation initiation factor IF-1 [Clostridium perfringens B str.
           ATCC 3626]
 gi|168215200|ref|ZP_02640825.1| translation initiation factor IF-1 [Clostridium perfringens CPE
           str. F4969]
 gi|168216655|ref|ZP_02642280.1| translation initiation factor IF-1 [Clostridium perfringens NCTC
           8239]
 gi|169347161|ref|ZP_02866103.1| translation initiation factor IF-1 [Clostridium perfringens C str.
           JGS1495]
 gi|182626929|ref|ZP_02954662.1| translation initiation factor IF-1 [Clostridium perfringens D str.
           JGS1721]
 gi|20138469|sp|Q8XHU6|IF1_CLOPE RecName: Full=Translation initiation factor IF-1
 gi|119370853|sp|Q0TMS0|IF1_CLOP1 RecName: Full=Translation initiation factor IF-1
 gi|119370854|sp|Q0SQG8|IF1_CLOPS RecName: Full=Translation initiation factor IF-1
 gi|18146047|dbj|BAB82087.1| translation initiation factor IF-1 [Clostridium perfringens str.
           13]
 gi|110674740|gb|ABG83727.1| translation initiation factor IF-1 [Clostridium perfringens ATCC
           13124]
 gi|110682876|gb|ABG86246.1| translation initiation factor IF-1 [Clostridium perfringens SM101]
 gi|169296844|gb|EDS78973.1| translation initiation factor IF-1 [Clostridium perfringens C str.
           JGS1495]
 gi|170663283|gb|EDT15966.1| translation initiation factor IF-1 [Clostridium perfringens E str.
           JGS1987]
 gi|170710182|gb|EDT22364.1| translation initiation factor IF-1 [Clostridium perfringens B str.
           ATCC 3626]
 gi|170713386|gb|EDT25568.1| translation initiation factor IF-1 [Clostridium perfringens CPE
           str. F4969]
 gi|177907719|gb|EDT70334.1| translation initiation factor IF-1 [Clostridium perfringens D str.
           JGS1721]
 gi|182381124|gb|EDT78603.1| translation initiation factor IF-1 [Clostridium perfringens NCTC
           8239]
          Length = 72

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKSDIIEMQGTVLEALPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKILAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|300870626|ref|YP_003785497.1| translation initiation factor IF 1 [Brachyspira pilosicoli 95/1000]
 gi|300688325|gb|ADK30996.1| translation initiation factor IF 1 [Brachyspira pilosicoli 95/1000]
          Length = 72

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M ++E +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAEKENIEVEGTVVEPLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR + IRI  GDKV + M+PYD+T+ RI YR+K
Sbjct: 27  ----ENGHKILAHISGKMRMNFIRILPGDKVTIEMSPYDLTKGRIIYRYK 72


>gi|307154822|ref|YP_003890206.1| translation initiation factor IF-1 [Cyanothece sp. PCC 7822]
 gi|306985050|gb|ADN16931.1| translation initiation factor IF-1 [Cyanothece sp. PCC 7822]
          Length = 80

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + K++ +E  G V+E LPNA FRV L                                  
Sbjct: 6   LAKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 32

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 33  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 77


>gi|304569544|ref|NP_440649.2| translation initiation factor IF-1 [Synechocystis sp. PCC 6803]
 gi|7404383|sp|P73301|IF1_SYNY3 RecName: Full=Translation initiation factor IF-1
          Length = 75

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVMESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 72


>gi|222055872|ref|YP_002538234.1| translation initiation factor IF-1 [Geobacter sp. FRC-32]
 gi|221565161|gb|ACM21133.1| translation initiation factor IF-1 [Geobacter sp. FRC-32]
          Length = 72

 Score =  114 bits (286), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA F+VKL                                  
Sbjct: 1   MSKEEAIEVEGTVIEPLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+A+ +G+MRK+ I+I  GDKV V ++PYD++R RITYR K
Sbjct: 27  ----ENDHIVLAHISGKMRKYFIKILPGDKVTVELSPYDLSRGRITYRAK 72


>gi|304315964|ref|YP_003851109.1| translation initiation factor IF-1 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|323706474|ref|ZP_08118035.1| translation initiation factor IF-1 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|302777466|gb|ADL68025.1| translation initiation factor IF-1 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|323534194|gb|EGB23984.1| translation initiation factor IF-1 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGKVIEALPNAMFQVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GD+V + ++PYD+TR RI +R K
Sbjct: 28  -----NGHRILAHISGKLRMNFIRILPGDRVTLELSPYDLTRGRIVWRGK 72


>gi|332993400|gb|AEF03455.1| translation initiation factor IF-1 [Alteromonas sp. SN2]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGTVQDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+T+ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIIYRAR 72


>gi|330994106|ref|ZP_08318035.1| Translation initiation factor IF-1 [Gluconacetobacter sp. SXCC-1]
 gi|329758843|gb|EGG75358.1| Translation initiation factor IF-1 [Gluconacetobacter sp. SXCC-1]
          Length = 76

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRV L                                  
Sbjct: 5   MSKEDMIEFSGTVTELLPNAMFRVTLD--------------------------------- 31

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 32  -----NEHTILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 76


>gi|260909772|ref|ZP_05916466.1| translation initiation factor IF1 [Prevotella sp. oral taxon 472
           str. F0295]
 gi|288801120|ref|ZP_06406576.1| translation initiation factor IF-1 [Prevotella sp. oral taxon 299
           str. F0039]
 gi|288929318|ref|ZP_06423163.1| translation initiation factor IF-1 [Prevotella sp. oral taxon 317
           str. F0108]
 gi|260636197|gb|EEX54193.1| translation initiation factor IF1 [Prevotella sp. oral taxon 472
           str. F0295]
 gi|288329420|gb|EFC68006.1| translation initiation factor IF-1 [Prevotella sp. oral taxon 317
           str. F0108]
 gi|288332054|gb|EFC70536.1| translation initiation factor IF-1 [Prevotella sp. oral taxon 299
           str. F0039]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGCPITAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|227530227|ref|ZP_03960276.1| initiation factor IF1 [Lactobacillus vaginalis ATCC 49540]
 gi|227349902|gb|EEJ40193.1| initiation factor IF1 [Lactobacillus vaginalis ATCC 49540]
          Length = 94

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 53/109 (48%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K + +E  G ++E LPNA F+V+L                                   
Sbjct: 24  AKADVIEVEGKITETLPNAMFKVEL----------------------------------- 48

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               + A ++A+ +G++R H I+I  GD+VKV M+PYD+T+ RIT+RFK
Sbjct: 49  ---ENGAEILAHVSGKIRMHYIKILPGDRVKVEMSPYDLTKGRITFRFK 94


>gi|85858169|ref|YP_460371.1| protein translation initiation factor 1 [Syntrophus aciditrophicus
           SB]
 gi|119371132|sp|Q2LQB5|IF1_SYNAS RecName: Full=Translation initiation factor IF-1
 gi|85721260|gb|ABC76203.1| bacterial protein translation Initiation Factor 1 (IF-1)
           [Syntrophus aciditrophicus SB]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEPIEVEGRVIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GDKV V ++PYD+TR RI YR K
Sbjct: 27  ----ENGHRVLAHISGKMRMHFIKILPGDKVTVELSPYDLTRGRIIYRTK 72


>gi|114567817|ref|YP_754971.1| translation initiation factor IF-1 [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|119371135|sp|Q0AUK4|IF1_SYNWW RecName: Full=Translation initiation factor IF-1
 gi|114338752|gb|ABI69600.1| bacterial translation initiation factor 1 (bIF-1) [Syntrophomonas
           wolfei subsp. wolfei str. Goettingen]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  F+V+L                                  
Sbjct: 1   MAKEDVIEVEGTVVEPLPNTMFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + +RI  GD+V V ++PYD+ R RI YRFK
Sbjct: 28  -----NGHKVLAHISGKMRMNFVRILPGDRVMVELSPYDLNRGRIIYRFK 72


>gi|17231687|ref|NP_488235.1| translation initiation factor IF-1 [Nostoc sp. PCC 7120]
 gi|75906934|ref|YP_321230.1| translation initiation factor IF-1 [Anabaena variabilis ATCC 29413]
 gi|113476559|ref|YP_722620.1| translation initiation factor IF-1 [Trichodesmium erythraeum
           IMS101]
 gi|170077665|ref|YP_001734303.1| translation initiation factor IF-1 [Synechococcus sp. PCC 7002]
 gi|186684490|ref|YP_001867686.1| translation initiation factor IF-1 [Nostoc punctiforme PCC 73102]
 gi|282898337|ref|ZP_06306328.1| Translation initiation factor IF-1 [Raphidiopsis brookii D9]
 gi|282899972|ref|ZP_06307933.1| Translation initiation factor IF-1 [Cylindrospermopsis raciborskii
           CS-505]
 gi|298491418|ref|YP_003721595.1| translation initiation factor IF-1 ['Nostoc azollae' 0708]
 gi|300867114|ref|ZP_07111780.1| Translation initiation factor IF-1 [Oscillatoria sp. PCC 6506]
 gi|20138477|sp|Q8YPJ9|IF1_ANASP RecName: Full=Translation initiation factor IF-1
 gi|119370841|sp|Q3MFA1|IF1_ANAVT RecName: Full=Translation initiation factor IF-1
 gi|119371139|sp|Q110C7|IF1_TRIEI RecName: Full=Translation initiation factor IF-1
 gi|17133330|dbj|BAB75894.1| translation initiation factor IF-1 [Nostoc sp. PCC 7120]
 gi|75700659|gb|ABA20335.1| bacterial translation initiation factor 1 (bIF-1) [Anabaena
           variabilis ATCC 29413]
 gi|110167607|gb|ABG52147.1| bacterial translation initiation factor 1 (bIF-1) [Trichodesmium
           erythraeum IMS101]
 gi|169885334|gb|ACA99047.1| translation initiation factor IF-1 [Synechococcus sp. PCC 7002]
 gi|186466942|gb|ACC82743.1| translation initiation factor IF-1 [Nostoc punctiforme PCC 73102]
 gi|281195242|gb|EFA70178.1| Translation initiation factor IF-1 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281196868|gb|EFA71773.1| Translation initiation factor IF-1 [Raphidiopsis brookii D9]
 gi|298233336|gb|ADI64472.1| translation initiation factor IF-1 ['Nostoc azollae' 0708]
 gi|300334869|emb|CBN56946.1| Translation initiation factor IF-1 [Oscillatoria sp. PCC 6506]
          Length = 74

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|22711909|ref|NP_683835.1| translation initiation factor 1 [Chaetosphaeridium globosum]
 gi|25008606|sp|Q8M9V4|IF1C_CHAGL RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|22416913|gb|AAM96513.1| translational initiation factor 1 [Chaetosphaeridium globosum]
          Length = 78

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GIV+E LPNA FRV L                                  
Sbjct: 1   MKKQNLIEMEGIVTESLPNAMFRVSLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ IRI  GDKVKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCQVLAHISGKIRRNYIRILPGDKVKVELSPYDLTKGRITYRLR 72


>gi|239994972|ref|ZP_04715496.1| translation initiation factor IF-1 [Alteromonas macleodii ATCC
           27126]
          Length = 72

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+T+ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIVYRAR 72


>gi|227533982|ref|ZP_03964031.1| initiation factor IF1 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229552730|ref|ZP_04441455.1| initiation factor IF1 [Lactobacillus rhamnosus LMS2-1]
 gi|227188359|gb|EEI68426.1| initiation factor IF1 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|229313936|gb|EEN79909.1| initiation factor IF1 [Lactobacillus rhamnosus LMS2-1]
          Length = 95

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 53/109 (48%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V++ LPNA F+VKL                                   
Sbjct: 25  AKDDVIEIQGTVTDTLPNAMFKVKL----------------------------------- 49

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               + A ++A+ +G++R H IRI  GDKV V ++PYD+T+ RITYRFK
Sbjct: 50  ---ENGAEILAHVSGKIRMHYIRILPGDKVTVELSPYDLTKGRITYRFK 95


>gi|238855090|ref|ZP_04645418.1| translation initiation factor IF-1 [Lactobacillus jensenii 269-3]
 gi|256852058|ref|ZP_05557445.1| translation initiation factor IF-1 [Lactobacillus jensenii
           27-2-CHN]
 gi|260661373|ref|ZP_05862286.1| translation initiation factor IF-1 [Lactobacillus jensenii
           115-3-CHN]
 gi|260664875|ref|ZP_05865726.1| translation initiation factor IF-1 [Lactobacillus jensenii
           SJ-7A-US]
 gi|282931687|ref|ZP_06337179.1| translation initiation factor IF-1 [Lactobacillus jensenii 208-1]
 gi|297205067|ref|ZP_06922463.1| translation initiation factor IF-1 [Lactobacillus jensenii JV-V16]
 gi|313472575|ref|ZP_07813064.1| translation initiation factor IF-1 [Lactobacillus jensenii 1153]
 gi|238832334|gb|EEQ24643.1| translation initiation factor IF-1 [Lactobacillus jensenii 269-3]
 gi|256615470|gb|EEU20660.1| translation initiation factor IF-1 [Lactobacillus jensenii
           27-2-CHN]
 gi|260547828|gb|EEX23805.1| translation initiation factor IF-1 [Lactobacillus jensenii
           115-3-CHN]
 gi|260561358|gb|EEX27331.1| translation initiation factor IF-1 [Lactobacillus jensenii
           SJ-7A-US]
 gi|281304185|gb|EFA96295.1| translation initiation factor IF-1 [Lactobacillus jensenii 208-1]
 gi|297149645|gb|EFH29942.1| translation initiation factor IF-1 [Lactobacillus jensenii JV-V16]
 gi|313448940|gb|EFR61260.1| translation initiation factor IF-1 [Lactobacillus jensenii 1153]
          Length = 73

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGKVVDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GDKV V ++PYD+T+ RITYRF
Sbjct: 27  ----ENGATILAHVSGKIRMHYIRILPGDKVTVELSPYDLTKGRITYRF 71


>gi|21674976|ref|NP_663041.1| translation initiation factor IF-1 [Chlorobium tepidum TLS]
 gi|193211873|ref|YP_001997826.1| translation initiation factor IF-1 [Chlorobaculum parvum NCIB 8327]
 gi|25008603|sp|Q8KAJ3|IF1_CHLTE RecName: Full=Translation initiation factor IF-1
 gi|21648209|gb|AAM73383.1| translation initiation factor IF-1 [Chlorobium tepidum TLS]
 gi|193085350|gb|ACF10626.1| translation initiation factor IF-1 [Chlorobaculum parvum NCIB 8327]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G + E LPNA FRVKL                                  
Sbjct: 1   MAKEESIEVEGEILEALPNAQFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKVKV ++PYD+++ RITYR+K
Sbjct: 27  ----ENGLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDLSKGRITYRYK 72


>gi|257792539|ref|YP_003183145.1| translation initiation factor IF-1 [Eggerthella lenta DSM 2243]
 gi|317490405|ref|ZP_07948889.1| translation initiation factor IF-1 [Eggerthella sp. 1_3_56FAA]
 gi|325833572|ref|ZP_08166021.1| translation initiation factor IF-1 [Eggerthella sp. HGA1]
 gi|257476436|gb|ACV56756.1| translation initiation factor IF-1 [Eggerthella lenta DSM 2243]
 gi|316910540|gb|EFV32165.1| translation initiation factor IF-1 [Eggerthella sp. 1_3_56FAA]
 gi|325485496|gb|EGC87965.1| translation initiation factor IF-1 [Eggerthella sp. HGA1]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MTKEDVIELEGTVLEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKV V ++ YD+ R RITYRFK
Sbjct: 27  ----ENGHKILAHISGKMRMHYIKILPGDKVTVELSVYDLNRGRITYRFK 72


>gi|304319974|ref|YP_003853617.1| translation initiation factor IF-1 [Parvularcula bermudensis
           HTCC2503]
 gi|303298877|gb|ADM08476.1| translation initiation factor IF-1 [Parvularcula bermudensis
           HTCC2503]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G V ELLPNANFRVKL                                  
Sbjct: 1   MAKEELLEFQGTVEELLPNANFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M+PYD+++ RITYRFK
Sbjct: 28  -----NDHEIIAHTAGKMRKNRIRVLAGDKVLVEMSPYDLSKGRITYRFK 72


>gi|59797538|sp|Q6AP48|IF1_DESPS RecName: Full=Translation initiation factor IF-1
          Length = 78

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKEEAIEVEGTIIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+TR R+T+R K
Sbjct: 28  -----NGHKVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRTK 72


>gi|108773202|ref|YP_635783.1| translational initiation factor 1 [Chara vulgaris]
 gi|77157858|gb|ABA61899.1| translational initiation factor 1 [Chara vulgaris]
          Length = 89

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+V+E LPNA FRV L                                  
Sbjct: 12  MSKQNLIEIEGLVTESLPNAMFRVCLD--------------------------------- 38

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++RK+ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 39  -----NGCEVLTHISGKIRKNYIRILPGDRVKVELSPYDLTKGRITYRLR 83


>gi|229496339|ref|ZP_04390059.1| translation initiation factor IF-1 [Porphyromonas endodontalis ATCC
           35406]
 gi|229316917|gb|EEN82830.1| translation initiation factor IF-1 [Porphyromonas endodontalis ATCC
           35406]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA F+V+L                                  
Sbjct: 1   MAKQTAIEQDGVILEALSNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H IRI  GDKVKV M+PYD+T+ RI+YR+K
Sbjct: 27  ----QNGHVITAHISGKMRMHFIRILPGDKVKVEMSPYDLTKGRISYRYK 72


>gi|225016261|ref|ZP_03705453.1| hypothetical protein CLOSTMETH_00164 [Clostridium methylpentosum
           DSM 5476]
 gi|224950936|gb|EEG32145.1| hypothetical protein CLOSTMETH_00164 [Clostridium methylpentosum
           DSM 5476]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEKLPNAEFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G++R + IRI +GDKV + M+PYD+T+ RIT+R K
Sbjct: 27  ----ENGHVLLAHISGKLRMNFIRILVGDKVTLEMSPYDLTKGRITWRSK 72


>gi|58039466|ref|YP_191430.1| translation initiation factor IF-1 [Gluconobacter oxydans 621H]
 gi|73920041|sp|Q5FS72|IF1_GLUOX RecName: Full=Translation initiation factor IF-1
 gi|58001880|gb|AAW60774.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Gluconobacter oxydans 621H]
          Length = 72

 Score =  114 bits (285), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EF+G V ELLPNA FRV L                                  
Sbjct: 1   MSKEDLIEFTGTVMELLPNAMFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+T+G+MRK+RIR+  GD+V V M PYD+++ RIT+RFK
Sbjct: 28  -----NEHTILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLSKGRITFRFK 72


>gi|300088174|ref|YP_003758696.1| translation initiation factor IF-1 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|299527907|gb|ADJ26375.1| translation initiation factor IF-1 [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 73

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK++ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MPKKDAIEVEGTVLEALPNTTFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GD+V VA++PYD+TR R+TYRFK
Sbjct: 28  -----NGHEVLAHISGKMRVHYIRILPGDRVLVALSPYDLTRGRVTYRFK 72


>gi|124003683|ref|ZP_01688531.1| translation initiation factor IF-1 [Microscilla marina ATCC 23134]
 gi|123990738|gb|EAY30205.1| translation initiation factor IF-1 [Microscilla marina ATCC 23134]
          Length = 72

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G+++E L NA FRV+L                                  
Sbjct: 1   MAKQPSIEQDGVITEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR + I+I  GDKVK+ M+PYD+++ RI YR+K
Sbjct: 27  ----QNGHEVIAHISGKMRMNYIKILPGDKVKLEMSPYDLSKGRIVYRYK 72


>gi|258543059|ref|YP_003188492.1| translation initiation factor IF-1 [Acetobacter pasteurianus IFO
           3283-01]
 gi|329115665|ref|ZP_08244387.1| Translation initiation factor IF-1 [Acetobacter pomorum DM001]
 gi|256634137|dbj|BAI00113.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256637197|dbj|BAI03166.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256640249|dbj|BAI06211.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256643306|dbj|BAI09261.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646361|dbj|BAI12309.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649414|dbj|BAI15355.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652400|dbj|BAI18334.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655458|dbj|BAI21385.1| translation initiation factor 1 (IF-1) [Acetobacter pasteurianus
           IFO 3283-12]
 gi|326695093|gb|EGE46812.1| Translation initiation factor IF-1 [Acetobacter pomorum DM001]
          Length = 72

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MSKEDMIEFSGTVTELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+T+G+MRK+RIR+  GD+V V M PYD+++ RIT+RFK
Sbjct: 28  -----NEHVILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLSKGRITFRFK 72


>gi|148381397|ref|YP_001255938.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           ATCC 3502]
 gi|153931487|ref|YP_001385772.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           ATCC 19397]
 gi|153935368|ref|YP_001389179.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           Hall]
 gi|153940017|ref|YP_001392810.1| translation initiation factor IF-1 [Clostridium botulinum F str.
           Langeland]
 gi|168178856|ref|ZP_02613520.1| translation initiation factor IF-1 [Clostridium botulinum NCTC
           2916]
 gi|168181888|ref|ZP_02616552.1| translation initiation factor IF-1 [Clostridium botulinum Bf]
 gi|170755308|ref|YP_001783097.1| translation initiation factor IF-1 [Clostridium botulinum B1 str.
           Okra]
 gi|170759574|ref|YP_001788797.1| translation initiation factor IF-1 [Clostridium botulinum A3 str.
           Loch Maree]
 gi|187776600|ref|ZP_02993073.1| hypothetical protein CLOSPO_00114 [Clostridium sporogenes ATCC
           15579]
 gi|226950909|ref|YP_002806000.1| translation initiation factor IF-1 [Clostridium botulinum A2 str.
           Kyoto]
 gi|237796918|ref|YP_002864470.1| translation initiation factor IF-1 [Clostridium botulinum Ba4 str.
           657]
 gi|190359613|sp|A7FZ49|IF1_CLOB1 RecName: Full=Translation initiation factor IF-1
 gi|190359625|sp|A5I7I2|IF1_CLOBH RecName: Full=Translation initiation factor IF-1
 gi|190359626|sp|A7GJ50|IF1_CLOBL RecName: Full=Translation initiation factor IF-1
 gi|148290881|emb|CAL85017.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           ATCC 3502]
 gi|152927531|gb|ABS33031.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           ATCC 19397]
 gi|152931282|gb|ABS36781.1| translation initiation factor IF-1 [Clostridium botulinum A str.
           Hall]
 gi|152935913|gb|ABS41411.1| translation initiation factor IF-1 [Clostridium botulinum F str.
           Langeland]
 gi|164511620|emb|CAO86116.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511622|emb|CAO86117.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511624|emb|CAO86118.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511626|emb|CAO86119.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511628|emb|CAO86120.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511630|emb|CAO86121.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511632|emb|CAO86122.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|164511634|emb|CAO86123.1| translation initiation factor IF-1 [Clostridium botulinum]
 gi|169120520|gb|ACA44356.1| translation initiation factor IF-1 [Clostridium botulinum B1 str.
           Okra]
 gi|169406563|gb|ACA54974.1| translation initiation factor IF-1 [Clostridium botulinum A3 str.
           Loch Maree]
 gi|182669954|gb|EDT81930.1| translation initiation factor IF-1 [Clostridium botulinum NCTC
           2916]
 gi|182674928|gb|EDT86889.1| translation initiation factor IF-1 [Clostridium botulinum Bf]
 gi|187775259|gb|EDU39061.1| hypothetical protein CLOSPO_00114 [Clostridium sporogenes ATCC
           15579]
 gi|226843191|gb|ACO85857.1| translation initiation factor IF-1 [Clostridium botulinum A2 str.
           Kyoto]
 gi|229262095|gb|ACQ53128.1| translation initiation factor IF-1 [Clostridium botulinum Ba4 str.
           657]
 gi|295320790|gb|ADG01168.1| translation initiation factor IF-1 [Clostridium botulinum F str.
           230613]
 gi|322807782|emb|CBZ05357.1| translation initiation factor 1 [Clostridium botulinum H04402 065]
          Length = 72

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKDDVIEMQGTVLESLPNAMFEVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    +IA+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ESGHKIIAHISGKLRMNFIRILPGDKVTVELSPYDLTRGRITWRAK 72


>gi|210611149|ref|ZP_03288763.1| hypothetical protein CLONEX_00953 [Clostridium nexile DSM 1787]
 gi|210152136|gb|EEA83143.1| hypothetical protein CLONEX_00953 [Clostridium nexile DSM 1787]
          Length = 72

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+T+ RIT+R K
Sbjct: 27  ----ENGHQVLAHISGKLRTNFIKILPGDKVTLELSPYDLTKGRITWRDK 72


>gi|220935006|ref|YP_002513905.1| translation initiation factor IF-1 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996316|gb|ACL72918.1| translation initiation factor IF-1 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 72

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDHIEMEGTVLDTLPNTMFRVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +GRMRK+ IRI  GD+V V M PYD+T+ RITYR K
Sbjct: 28  -----NGHIVTAHISGRMRKNYIRILTGDRVTVQMTPYDLTKGRITYRNK 72


>gi|167629491|ref|YP_001679990.1| translation initiation factor if-1 [Heliobacterium modesticaldum
           Ice1]
 gi|167592231|gb|ABZ83979.1| translation initiation factor if-1 [Heliobacterium modesticaldum
           Ice1]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKTDVIEVEGRVVEPLPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHKVLAHVSGKIRMNFIRILPGDRVTVELSPYDLTRGRITYRFK 72


>gi|58336651|ref|YP_193236.1| translation initiation factor IF-1 [Lactobacillus acidophilus NCFM]
 gi|104773564|ref|YP_618544.1| translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116513561|ref|YP_812467.1| translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC BAA-365]
 gi|161506895|ref|YP_001576849.1| translation initiation factor IF-1 [Lactobacillus helveticus DPC
           4571]
 gi|227879265|ref|ZP_03997135.1| initiation factor IF1 [Lactobacillus crispatus JV-V01]
 gi|227894542|ref|ZP_04012347.1| initiation factor IF1 [Lactobacillus ultunensis DSM 16047]
 gi|227903209|ref|ZP_04021014.1| initiation factor IF1 [Lactobacillus acidophilus ATCC 4796]
 gi|256844451|ref|ZP_05549937.1| translation initiation factor IF-1 [Lactobacillus crispatus
           125-2-CHN]
 gi|256849161|ref|ZP_05554594.1| translational initiation IF-1 [Lactobacillus crispatus MV-1A-US]
 gi|260102377|ref|ZP_05752614.1| initiation factor IF1 [Lactobacillus helveticus DSM 20075]
 gi|262047177|ref|ZP_06020135.1| translation initiation factor IF-1 [Lactobacillus crispatus
           MV-3A-US]
 gi|293380398|ref|ZP_06626469.1| translation initiation factor IF-1 [Lactobacillus crispatus 214-1]
 gi|295692182|ref|YP_003600792.1| translation initiation factor if-1 [Lactobacillus crispatus ST1]
 gi|300812382|ref|ZP_07092817.1| translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|313123132|ref|YP_004033391.1| protein translation initiation factor 1 [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|315037552|ref|YP_004031120.1| translation initiation factor IF-1 [Lactobacillus amylovorus GRL
           1112]
 gi|325956025|ref|YP_004286635.1| translation initiation factor IF-1 [Lactobacillus acidophilus 30SC]
 gi|73920043|sp|Q5FM69|IF1_LACAC RecName: Full=Translation initiation factor IF-1
 gi|119371071|sp|Q1GBJ6|IF1_LACDA RecName: Full=Translation initiation factor IF-1
 gi|122275669|sp|Q04BZ3|IF1_LACDB RecName: Full=Translation initiation factor IF-1
 gi|190359645|sp|A8YXM7|IF1_LACH4 RecName: Full=Translation initiation factor IF-1
 gi|58253968|gb|AAV42205.1| translational initiation IF-1 [Lactobacillus acidophilus NCFM]
 gi|103422645|emb|CAI97253.1| Translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus ATCC 11842]
 gi|116092876|gb|ABJ58029.1| bacterial translation initiation factor 1 (bIF-1) [Lactobacillus
           delbrueckii subsp. bulgaricus ATCC BAA-365]
 gi|160347884|gb|ABX26558.1| translation initiation factor IF-1 [Lactobacillus helveticus DPC
           4571]
 gi|227861159|gb|EEJ68808.1| initiation factor IF1 [Lactobacillus crispatus JV-V01]
 gi|227863701|gb|EEJ71122.1| initiation factor IF1 [Lactobacillus ultunensis DSM 16047]
 gi|227869014|gb|EEJ76435.1| initiation factor IF1 [Lactobacillus acidophilus ATCC 4796]
 gi|256613529|gb|EEU18732.1| translation initiation factor IF-1 [Lactobacillus crispatus
           125-2-CHN]
 gi|256713937|gb|EEU28925.1| translational initiation IF-1 [Lactobacillus crispatus MV-1A-US]
 gi|260083821|gb|EEW67941.1| initiation factor IF1 [Lactobacillus helveticus DSM 20075]
 gi|260572422|gb|EEX28984.1| translation initiation factor IF-1 [Lactobacillus crispatus
           MV-3A-US]
 gi|290923081|gb|EFE00013.1| translation initiation factor IF-1 [Lactobacillus crispatus 214-1]
 gi|295030288|emb|CBL49767.1| Translation initiation factor IF-1 [Lactobacillus crispatus ST1]
 gi|300496687|gb|EFK31774.1| translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus PB2003/044-T3-4]
 gi|312275685|gb|ADQ58325.1| translation initiation factor IF-1 [Lactobacillus amylovorus GRL
           1112]
 gi|312279695|gb|ADQ60414.1| Protein translation initiation factor 1 [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|323465845|gb|ADX69532.1| Protein translation initiation factor 1 [Lactobacillus helveticus
           H10]
 gi|325125197|gb|ADY84527.1| Translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. bulgaricus 2038]
 gi|325332590|gb|ADZ06498.1| translation initiation factor IF-1 [Lactobacillus acidophilus 30SC]
 gi|325684742|gb|EGD26896.1| translation initiation factor IF-1 [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
 gi|327182848|gb|AEA31295.1| translation initiation factor IF-1 [Lactobacillus amylovorus GRL
           1118]
 gi|328463386|gb|EGF35059.1| translation initiation factor IF-1 [Lactobacillus helveticus MTCC
           5463]
          Length = 73

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEVEGKVVDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 27  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 71


>gi|148261675|ref|YP_001235802.1| translation initiation factor IF-1 [Acidiphilium cryptum JF-5]
 gi|326405168|ref|YP_004285250.1| translation initiation factor IF-1 [Acidiphilium multivorum AIU301]
 gi|190359556|sp|A5G201|IF1_ACICJ RecName: Full=Translation initiation factor IF-1
 gi|146403356|gb|ABQ31883.1| bacterial translation initiation factor 1 (bIF-1) [Acidiphilium
           cryptum JF-5]
 gi|325052030|dbj|BAJ82368.1| translation initiation factor IF-1 [Acidiphilium multivorum AIU301]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 60/110 (54%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MSKEDMIEFSGTVAELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NDHIILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|221104623|ref|XP_002153994.1| PREDICTED: similar to Translation initiation factor IF-1,
           chloroplastic [Hydra magnipapillata]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 60/110 (54%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EF+G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEDLIEFTGVVTELLPNATFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+T+G+MRK+RIR+ LGDKV V M PYD+++ RIT+R K
Sbjct: 28  -----NEHIILAHTSGKMRKNRIRVLLGDKVTVEMTPYDLSKGRITFRQK 72


>gi|78358653|ref|YP_390102.1| translation initiation factor 1 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|119370814|sp|Q30V89|IF11_DESDG RecName: Full=Translation initiation factor IF-1 1
 gi|78221058|gb|ABB40407.1| bacterial translation initiation factor 1 (bIF-1) [Desulfovibrio
           desulfuricans subsp. desulfuricans str. G20]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 51/108 (47%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +  +G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEEAITVTGVVQEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MRK  IR+  GDKV V ++PYD+TR RIT+R
Sbjct: 27  ----ENGHEVLAHISGKMRKFHIRVLPGDKVSVELSPYDLTRGRITFR 70


>gi|238928133|ref|ZP_04659893.1| initiation factor IF1 [Selenomonas flueggei ATCC 43531]
 gi|292669836|ref|ZP_06603262.1| translation initiation factor IF1 [Selenomonas noxia ATCC 43541]
 gi|304438384|ref|ZP_07398325.1| translation initiation factor IF-1 [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|313895149|ref|ZP_07828706.1| translation initiation factor IF-1 [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320529818|ref|ZP_08030895.1| translation initiation factor IF-1 [Selenomonas artemidis F0399]
 gi|238884093|gb|EEQ47731.1| initiation factor IF1 [Selenomonas flueggei ATCC 43531]
 gi|292648633|gb|EFF66605.1| translation initiation factor IF1 [Selenomonas noxia ATCC 43541]
 gi|304368750|gb|EFM22434.1| translation initiation factor IF-1 [Selenomonas sp. oral taxon 149
           str. 67H29BP]
 gi|312976044|gb|EFR41502.1| translation initiation factor IF-1 [Selenomonas sp. oral taxon 137
           str. F0430]
 gi|320137836|gb|EFW29741.1| translation initiation factor IF-1 [Selenomonas artemidis F0399]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKQDVIEVEGRVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + + PYD+TR RITYRFK
Sbjct: 27  ----ENGHVVLAHVSGKIRMNFIRILPGDKVTIELTPYDLTRGRITYRFK 72


>gi|299143171|ref|ZP_07036251.1| translation initiation factor IF-1 [Peptoniphilus sp. oral taxon
           386 str. F0131]
 gi|298517656|gb|EFI41395.1| translation initiation factor IF-1 [Peptoniphilus sp. oral taxon
           386 str. F0131]
          Length = 72

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN NF+VKL                                  
Sbjct: 1   MGKEDVIEVEGTVVDALPNTNFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G++R + IRI  GDKV V ++PYD++R RIT+R K
Sbjct: 27  ----ENGHVILAHISGKLRMNYIRILPGDKVTVELSPYDLSRGRITWRKK 72


>gi|37519982|ref|NP_923359.1| translation initiation factor IF-1 [Gloeobacter violaceus PCC 7421]
 gi|44888007|sp|Q7NNJ8|IF1_GLOVI RecName: Full=Translation initiation factor IF-1
 gi|35210974|dbj|BAC88354.1| translation initiation factor IF-1 [Gloeobacter violaceus PCC 7421]
          Length = 73

 Score =  114 bits (284), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKQDVIEMEGTVVESLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NSFNILAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|258513663|ref|YP_003189885.1| translation initiation factor IF-1 [Desulfotomaculum acetoxidans
           DSM 771]
 gi|257777368|gb|ACV61262.1| translation initiation factor IF-1 [Desulfotomaculum acetoxidans
           DSM 771]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKQDVIEVEGKVIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHKVLAHVSGKIRMNFIRILAGDRVMVELSPYDLTRGRIIYRYK 72


>gi|256828524|ref|YP_003157252.1| translation initiation factor IF-1 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577700|gb|ACU88836.1| translation initiation factor IF-1 [Desulfomicrobium baculatum DSM
           4028]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G+V E +PNA F V+L                                  
Sbjct: 1   MAKEESIEVEGVVEEAMPNAMFLVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MRK  IRI  GD+VK+ ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHQVLGHISGKMRKFYIRILPGDRVKLELSPYDLTRGRITYRFK 72


>gi|224827038|ref|ZP_03700135.1| translation initiation factor IF-1 [Lutiella nitroferrum 2002]
 gi|224600704|gb|EEG06890.1| translation initiation factor IF-1 [Lutiella nitroferrum 2002]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T++  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDTIQMQGEVLETLPNATFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|270712510|ref|ZP_06223174.1| translation initiation factor IF-1 [Haemophilus influenzae HK1212]
 gi|270315649|gb|EFA27829.1| translation initiation factor IF-1 [Haemophilus influenzae HK1212]
          Length = 131

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 60  MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 85

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 86  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRSR 131


>gi|315652330|ref|ZP_07905322.1| translation initiation factor IF-1 [Eubacterium saburreum DSM 3986]
 gi|331004145|ref|ZP_08327625.1| translation initiation factor IF-1 [Lachnospiraceae oral taxon 107
           str. F0167]
 gi|315485453|gb|EFU75843.1| translation initiation factor IF-1 [Eubacterium saburreum DSM 3986]
 gi|330411555|gb|EGG90965.1| translation initiation factor IF-1 [Lachnospiraceae oral taxon 107
           str. F0167]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLTKGRIIWRDK 72


>gi|317131393|ref|YP_004090707.1| translation initiation factor IF-1 [Ethanoligenens harbinense
           YUAN-3]
 gi|315469372|gb|ADU25976.1| translation initiation factor IF-1 [Ethanoligenens harbinense
           YUAN-3]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA F+V+L                                  
Sbjct: 1   MSKDDMIELEGIVREALPNAMFQVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +N +++A+ +G++R + IRI  GDKV V M+PYD+TR RIT+R K
Sbjct: 28  -----NNHMILAHISGKLRMNYIRILPGDKVTVEMSPYDLTRGRITWRSK 72


>gi|329122426|ref|ZP_08251013.1| translation initiation factor IF-1 [Haemophilus aegyptius ATCC
           11116]
 gi|327473708|gb|EGF19127.1| translation initiation factor IF-1 [Haemophilus aegyptius ATCC
           11116]
          Length = 131

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 60  MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 85

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 86  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRSR 131


>gi|152989993|ref|YP_001355715.1| translation initiation factor IF-1 [Nitratiruptor sp. SB155-2]
 gi|190359748|sp|A6Q1J9|IF1_NITSB RecName: Full=Translation initiation factor IF-1
 gi|151421854|dbj|BAF69358.1| translation initiation factor IF-1 [Nitratiruptor sp. SB155-2]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGIVKEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + AG+MR H I+I  GDKVKV + PY + + RIT+R+K
Sbjct: 27  ----ENGHVVLCHIAGKMRMHYIKILPGDKVKVELTPYSLDKGRITFRYK 72


>gi|312889345|ref|ZP_07748899.1| bacterial translation initiation factor 1 (bIF-1) [Mucilaginibacter
           paludis DSM 18603]
 gi|311298222|gb|EFQ75337.1| bacterial translation initiation factor 1 (bIF-1) [Mucilaginibacter
           paludis DSM 18603]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQASIEQDGTIKEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GD+VK+ M+PYD+T+ RITYR+K
Sbjct: 27  ----ENGHEIIAHISGKMRMHYIKILPGDRVKLEMSPYDLTKGRITYRYK 72


>gi|109898688|ref|YP_661943.1| translation initiation factor IF-1 [Pseudoalteromonas atlantica
           T6c]
 gi|332306355|ref|YP_004434206.1| translation initiation factor IF-1 [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|119371091|sp|Q15T99|IF1_PSEA6 RecName: Full=Translation initiation factor IF-1
 gi|109700969|gb|ABG40889.1| bacterial translation initiation factor 1 (bIF-1)
           [Pseudoalteromonas atlantica T6c]
 gi|332173684|gb|AEE22938.1| translation initiation factor IF-1 [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV   M PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTCEMTPYDLSKGRIIYRAR 72


>gi|210631176|ref|ZP_03296787.1| hypothetical protein COLSTE_00672 [Collinsella stercoris DSM 13279]
 gi|210160143|gb|EEA91114.1| hypothetical protein COLSTE_00672 [Collinsella stercoris DSM 13279]
          Length = 75

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE+ +E  G V+E LPNA FRV+L                                    
Sbjct: 6   KEDAIELEGTVTEPLPNAMFRVEL------------------------------------ 29

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 30  --ENGHSVLCSISGKIRMNYIRILPGDKVVVELSPYDLTRGRITYRYK 75


>gi|296126886|ref|YP_003634138.1| translation initiation factor IF-1 [Brachyspira murdochii DSM
           12563]
 gi|296018702|gb|ADG71939.1| translation initiation factor IF-1 [Brachyspira murdochii DSM
           12563]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M   ET+E  G V E LPNA FRV+L                                  
Sbjct: 1   MADRETIEVEGTVVEPLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR + IRI  GDKV + M+PYD+T+ RI YR+K
Sbjct: 27  ----ENGHKILAHISGKMRMNFIRILPGDKVTIEMSPYDLTKGRIIYRYK 72


>gi|227550742|ref|ZP_03980791.1| initiation factor IF-1 [Enterococcus faecium TX1330]
 gi|314937630|ref|ZP_07844956.1| translation initiation factor IF-1 [Enterococcus faecium TX0133a04]
 gi|314942871|ref|ZP_07849684.1| translation initiation factor IF-1 [Enterococcus faecium TX0133C]
 gi|314947993|ref|ZP_07851397.1| translation initiation factor IF-1 [Enterococcus faecium TX0082]
 gi|314950910|ref|ZP_07853979.1| translation initiation factor IF-1 [Enterococcus faecium TX0133A]
 gi|314991442|ref|ZP_07856919.1| translation initiation factor IF-1 [Enterococcus faecium TX0133B]
 gi|314995037|ref|ZP_07860157.1| translation initiation factor IF-1 [Enterococcus faecium TX0133a01]
 gi|227180203|gb|EEI61175.1| initiation factor IF-1 [Enterococcus faecium TX1330]
 gi|313590763|gb|EFR69608.1| translation initiation factor IF-1 [Enterococcus faecium TX0133a01]
 gi|313593922|gb|EFR72767.1| translation initiation factor IF-1 [Enterococcus faecium TX0133B]
 gi|313596919|gb|EFR75764.1| translation initiation factor IF-1 [Enterococcus faecium TX0133A]
 gi|313598343|gb|EFR77188.1| translation initiation factor IF-1 [Enterococcus faecium TX0133C]
 gi|313643007|gb|EFS07587.1| translation initiation factor IF-1 [Enterococcus faecium TX0133a04]
 gi|313645591|gb|EFS10171.1| translation initiation factor IF-1 [Enterococcus faecium TX0082]
          Length = 82

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPNA F+V+L                                   
Sbjct: 12  AKEDMIEVEGTVVETLPNAMFKVEL----------------------------------- 36

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   V+A  +G++R H IRI  GDKV V ++PYD+ R RITYRFK
Sbjct: 37  ---ENGHQVLATVSGKIRMHYIRILPGDKVTVELSPYDLNRGRITYRFK 82


>gi|119511159|ref|ZP_01630276.1| translation initiation factor IF-1 [Nodularia spumigena CCY9414]
 gi|119464147|gb|EAW45067.1| translation initiation factor IF-1 [Nodularia spumigena CCY9414]
          Length = 74

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDLIEMEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+++ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLSKGRITYRLR 72


>gi|126697664|ref|YP_001086561.1| translation initiation factor IF-1 [Clostridium difficile 630]
 gi|254973755|ref|ZP_05270227.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-66c26]
 gi|255091145|ref|ZP_05320623.1| translation initiation factor IF-1 [Clostridium difficile CIP
           107932]
 gi|255099256|ref|ZP_05328233.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-63q42]
 gi|255305039|ref|ZP_05349211.1| translation initiation factor IF-1 [Clostridium difficile ATCC
           43255]
 gi|255312799|ref|ZP_05354382.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-76w55]
 gi|255515558|ref|ZP_05383234.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-97b34]
 gi|255648653|ref|ZP_05395555.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-37x79]
 gi|255654186|ref|ZP_05399595.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-23m63]
 gi|260681870|ref|YP_003213155.1| translation initiation factor IF-1 [Clostridium difficile CD196]
 gi|260685468|ref|YP_003216601.1| translation initiation factor IF-1 [Clostridium difficile R20291]
 gi|296449775|ref|ZP_06891544.1| translation initiation factor IF-1 [Clostridium difficile NAP08]
 gi|296877839|ref|ZP_06901861.1| translation initiation factor IF-1 [Clostridium difficile NAP07]
 gi|306518776|ref|ZP_07405123.1| translation initiation factor IF-1 [Clostridium difficile
           QCD-32g58]
 gi|119370852|sp|Q18CI2|IF1_CLOD6 RecName: Full=Translation initiation factor IF-1
 gi|115249101|emb|CAJ66912.1| Translation initiation factor IF-1 [Clostridium difficile]
 gi|260208033|emb|CBA60229.1| translation initiation factor IF-1 [Clostridium difficile CD196]
 gi|260211484|emb|CBE01620.1| translation initiation factor IF-1 [Clostridium difficile R20291]
 gi|296261373|gb|EFH08199.1| translation initiation factor IF-1 [Clostridium difficile NAP08]
 gi|296431139|gb|EFH16964.1| translation initiation factor IF-1 [Clostridium difficile NAP07]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G VSE LPNA F+VKL                                  
Sbjct: 1   MAKKDVIELEGTVSEALPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKK 72


>gi|253577203|ref|ZP_04854523.1| translation initiation factor IF-1 [Paenibacillus sp. oral taxon
           786 str. D14]
 gi|251843447|gb|EES71475.1| translation initiation factor IF-1 [Paenibacillus sp. oral taxon
           786 str. D14]
          Length = 71

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   ++A+ +G++R H IRI  GDKV V ++PYD+T+ RITYR
Sbjct: 27  ----ENGHQILAHVSGKLRMHFIRILTGDKVVVQLSPYDLTKGRITYR 70


>gi|260768161|ref|ZP_05877095.1| translation initiation factor 1 [Vibrio furnissii CIP 102972]
 gi|260616191|gb|EEX41376.1| translation initiation factor 1 [Vibrio furnissii CIP 102972]
 gi|315179862|gb|ADT86776.1| translation initiation factor IF-1 [Vibrio furnissii NCTC 11218]
          Length = 72

 Score =  114 bits (284), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V A+ +G+MRK+ IRI  GDKV V M PYD+T+ RI +R +
Sbjct: 27  ----ENGHTVTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIVFRAR 72


>gi|17987954|ref|NP_540588.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           16M]
 gi|148560550|ref|YP_001258297.1| translation initiation factor IF-1 [Brucella ovis ATCC 25840]
 gi|225626780|ref|ZP_03784819.1| translation initiation factor IF-1 [Brucella ceti str. Cudo]
 gi|237814739|ref|ZP_04593737.1| translation initiation factor IF-1 [Brucella abortus str. 2308 A]
 gi|297247662|ref|ZP_06931380.1| translation initiation factor IF-1 [Brucella abortus bv. 5 str.
           B3196]
 gi|17983694|gb|AAL52852.1| bacterial protein translation initiation factor 1 (if-1) [Brucella
           melitensis bv. 1 str. 16M]
 gi|148371807|gb|ABQ61786.1| translation initiation factor IF-1 [Brucella ovis ATCC 25840]
 gi|225618437|gb|EEH15480.1| translation initiation factor IF-1 [Brucella ceti str. Cudo]
 gi|237789576|gb|EEP63786.1| translation initiation factor IF-1 [Brucella abortus str. 2308 A]
 gi|297174831|gb|EFH34178.1| translation initiation factor IF-1 [Brucella abortus bv. 5 str.
           B3196]
          Length = 101

 Score =  113 bits (283), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 30  MAKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 55

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 56  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 101


>gi|332982685|ref|YP_004464126.1| translation initiation factor 1 (bIF-1) [Mahella australiensis 50-1
           BON]
 gi|332700363|gb|AEE97304.1| bacterial translation initiation factor 1 (bIF-1) [Mahella
           australiensis 50-1 BON]
          Length = 72

 Score =  113 bits (283), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +   G V E LPNA F+V+L                                  
Sbjct: 1   MSKDDMIAVEGTVIEALPNAMFQVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV V ++PYD++R RI +R K
Sbjct: 27  ----ENGHKVLAHASGKLRMNFIRILPGDKVTVELSPYDLSRGRIIWRGK 72


>gi|294084883|ref|YP_003551643.1| translation initiation factor 1 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664458|gb|ADE39559.1| Translation initiation factor 1 [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEGVIEFSGTVAELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  V+A+T+G+MRK+RIR+  GD+V V M PYD+++ RIT+RFK
Sbjct: 28  -----NDHEVLAHTSGKMRKNRIRVLAGDRVNVEMTPYDLSKGRITFRFK 72


>gi|15800747|ref|NP_286761.1| translation initiation factor IF-1 [Escherichia coli O157:H7
           EDL933]
 gi|15830223|ref|NP_308996.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128851|ref|NP_415404.1| translation initiation factor IF-1 [Escherichia coli str. K-12
           substr. MG1655]
 gi|16759825|ref|NP_455442.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16764314|ref|NP_459929.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|24112259|ref|NP_706769.1| translation initiation factor IF-1 [Shigella flexneri 2a str. 301]
 gi|26246910|ref|NP_752950.1| translation initiation factor IF-1 [Escherichia coli CFT073]
 gi|29142402|ref|NP_805744.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|30062371|ref|NP_836542.1| translation initiation factor IF-1 [Shigella flexneri 2a str.
           2457T]
 gi|62179477|ref|YP_215894.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|74311442|ref|YP_309861.1| translation initiation factor IF-1 [Shigella sonnei Ss046]
 gi|82543370|ref|YP_407317.1| translation initiation factor IF-1 [Shigella boydii Sb227]
 gi|82777594|ref|YP_403943.1| translation initiation factor IF-1 [Shigella dysenteriae Sd197]
 gi|89107734|ref|AP_001514.1| translation initiation factor IF-1 [Escherichia coli str. K-12
           substr. W3110]
 gi|91209929|ref|YP_539915.1| translation initiation factor IF-1 [Escherichia coli UTI89]
 gi|110641084|ref|YP_668814.1| translation initiation factor IF-1 [Escherichia coli 536]
 gi|110804885|ref|YP_688405.1| translation initiation factor IF-1 [Shigella flexneri 5 str. 8401]
 gi|152969473|ref|YP_001334582.1| translation initiation factor IF-1 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|156934621|ref|YP_001438537.1| translation initiation factor IF-1 [Cronobacter sakazakii ATCC
           BAA-894]
 gi|157146429|ref|YP_001453748.1| translation initiation factor IF-1 [Citrobacter koseri ATCC
           BAA-895]
 gi|157158572|ref|YP_001462080.1| translation initiation factor IF-1 [Escherichia coli E24377A]
 gi|157160406|ref|YP_001457724.1| translation initiation factor IF-1 [Escherichia coli HS]
 gi|161503920|ref|YP_001571032.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161614817|ref|YP_001588782.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167550375|ref|ZP_02344132.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167995288|ref|ZP_02576378.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168230846|ref|ZP_02655904.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168236862|ref|ZP_02661920.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168240803|ref|ZP_02665735.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168263561|ref|ZP_02685534.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168466537|ref|ZP_02700399.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168752465|ref|ZP_02777487.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4113]
 gi|168765314|ref|ZP_02790321.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4501]
 gi|168769877|ref|ZP_02794884.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4486]
 gi|168777869|ref|ZP_02802876.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783794|ref|ZP_02808801.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789219|ref|ZP_02814226.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC869]
 gi|168822947|ref|ZP_02834947.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|170020714|ref|YP_001725668.1| translation initiation factor IF-1 [Escherichia coli ATCC 8739]
 gi|170080542|ref|YP_001729862.1| translation initiation factor IF-1 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681224|ref|YP_001744287.1| translation initiation factor IF-1 [Escherichia coli SMS-3-5]
 gi|170769229|ref|ZP_02903682.1| translation initiation factor IF-1 [Escherichia albertii TW07627]
 gi|187733292|ref|YP_001880919.1| translation initiation factor IF-1 [Shigella boydii CDC 3083-94]
 gi|188494179|ref|ZP_03001449.1| translation initiation factor IF-1 [Escherichia coli 53638]
 gi|191167598|ref|ZP_03029409.1| translation initiation factor IF-1 [Escherichia coli B7A]
 gi|191172149|ref|ZP_03033693.1| translation initiation factor IF-1 [Escherichia coli F11]
 gi|193064657|ref|ZP_03045736.1| translation initiation factor IF-1 [Escherichia coli E22]
 gi|194428361|ref|ZP_03060902.1| translation initiation factor IF-1 [Escherichia coli B171]
 gi|194433156|ref|ZP_03065438.1| translation initiation factor IF-1 [Shigella dysenteriae 1012]
 gi|194438692|ref|ZP_03070779.1| translation initiation factor IF-1 [Escherichia coli 101-1]
 gi|194444853|ref|YP_002040152.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194451702|ref|YP_002044947.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194472001|ref|ZP_03077985.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194734304|ref|YP_002114006.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195939547|ref|ZP_03084929.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4024]
 gi|197250446|ref|YP_002145872.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197265210|ref|ZP_03165284.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198243007|ref|YP_002214878.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200390717|ref|ZP_03217328.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204929950|ref|ZP_03220971.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352162|ref|YP_002225963.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|206578930|ref|YP_002239465.1| translation initiation factor IF-1 [Klebsiella pneumoniae 342]
 gi|207856346|ref|YP_002242997.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|208815732|ref|ZP_03256911.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4045]
 gi|208822723|ref|ZP_03263042.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4042]
 gi|209397314|ref|YP_002269557.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4115]
 gi|209918133|ref|YP_002292217.1| translation initiation factor IF-1 [Escherichia coli SE11]
 gi|213024831|ref|ZP_03339278.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. 404ty]
 gi|213052421|ref|ZP_03345299.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213428599|ref|ZP_03361349.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213586624|ref|ZP_03368450.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-0664]
 gi|213615822|ref|ZP_03371648.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213649845|ref|ZP_03379898.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213865546|ref|ZP_03387665.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|215486014|ref|YP_002328445.1| translation initiation factor IF-1 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217325550|ref|ZP_03441634.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           TW14588]
 gi|218548406|ref|YP_002382197.1| translation initiation factor IF-1 [Escherichia fergusonii ATCC
           35469]
 gi|218553470|ref|YP_002386383.1| translation initiation factor IF-1 [Escherichia coli IAI1]
 gi|218557792|ref|YP_002390705.1| translation initiation factor IF-1 [Escherichia coli S88]
 gi|218688672|ref|YP_002396884.1| translation initiation factor IF-1 [Escherichia coli ED1a]
 gi|218694357|ref|YP_002402024.1| translation initiation factor IF-1 [Escherichia coli 55989]
 gi|218700600|ref|YP_002408229.1| translation initiation factor IF-1 [Escherichia coli IAI39]
 gi|218704313|ref|YP_002411832.1| translation initiation factor IF-1 [Escherichia coli UMN026]
 gi|224582763|ref|YP_002636561.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|227884150|ref|ZP_04001955.1| translation initiation factor IF-1 [Escherichia coli 83972]
 gi|237707127|ref|ZP_04537608.1| translation initiation factor IF-1 [Escherichia sp. 3_2_53FAA]
 gi|238893945|ref|YP_002918679.1| translation initiation factor IF-1 [Klebsiella pneumoniae
           NTUH-K2044]
 gi|238900142|ref|YP_002925938.1| translation initiation factor IF-1 [Escherichia coli BW2952]
 gi|238913429|ref|ZP_04657266.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|253774087|ref|YP_003036918.1| translation initiation factor IF-1 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160998|ref|YP_003044106.1| translation initiation factor IF-1 [Escherichia coli B str. REL606]
 gi|254792084|ref|YP_003076921.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020988|ref|ZP_05434853.1| translation initiation factor IF-1 [Shigella sp. D9]
 gi|256023415|ref|ZP_05437280.1| translation initiation factor IF-1 [Escherichia sp. 4_1_40B]
 gi|260597286|ref|YP_003209857.1| translation initiation factor IF-1 [Cronobacter turicensis z3032]
 gi|260843134|ref|YP_003220912.1| translation initiation factor IF-1 [Escherichia coli O103:H2 str.
           12009]
 gi|260854175|ref|YP_003228066.1| translation initiation factor IF-1 [Escherichia coli O26:H11 str.
           11368]
 gi|260867056|ref|YP_003233458.1| translation initiation factor IF-1 [Escherichia coli O111:H- str.
           11128]
 gi|261227389|ref|ZP_05941670.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256188|ref|ZP_05948721.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|283784706|ref|YP_003364571.1| translation initiation factor IF-1 [Citrobacter rodentium ICC168]
 gi|288936313|ref|YP_003440372.1| translation initiation factor IF-1 [Klebsiella variicola At-22]
 gi|289805269|ref|ZP_06535898.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. AG3]
 gi|289830110|ref|ZP_06547541.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|290510631|ref|ZP_06550001.1| translation initiation factor IF-1 [Klebsiella sp. 1_1_55]
 gi|291281887|ref|YP_003498705.1| hypothetical protein G2583_1121 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293404191|ref|ZP_06648185.1| translation initiation factor IF-1 [Escherichia coli FVEC1412]
 gi|293409262|ref|ZP_06652838.1| translation initiation factor IF-1 [Escherichia coli B354]
 gi|293414166|ref|ZP_06656815.1| translation initiation factor IF-1 [Escherichia coli B185]
 gi|293433181|ref|ZP_06661609.1| translation initiation factor IF-1 [Escherichia coli B088]
 gi|297520879|ref|ZP_06939265.1| translation initiation factor IF-1 [Escherichia coli OP50]
 gi|298379972|ref|ZP_06989577.1| translation initiation factor IF-1 [Escherichia coli FVEC1302]
 gi|300817015|ref|ZP_07097234.1| translation initiation factor IF-1 [Escherichia coli MS 107-1]
 gi|300823622|ref|ZP_07103749.1| translation initiation factor IF-1 [Escherichia coli MS 119-7]
 gi|300899538|ref|ZP_07117778.1| translation initiation factor IF-1 [Escherichia coli MS 198-1]
 gi|300902961|ref|ZP_07120905.1| translation initiation factor IF-1 [Escherichia coli MS 84-1]
 gi|300921084|ref|ZP_07137468.1| translation initiation factor IF-1 [Escherichia coli MS 115-1]
 gi|300926521|ref|ZP_07142310.1| translation initiation factor IF-1 [Escherichia coli MS 182-1]
 gi|300929576|ref|ZP_07145039.1| translation initiation factor IF-1 [Escherichia coli MS 187-1]
 gi|300937623|ref|ZP_07152432.1| translation initiation factor IF-1 [Escherichia coli MS 21-1]
 gi|300949757|ref|ZP_07163734.1| translation initiation factor IF-1 [Escherichia coli MS 116-1]
 gi|300954706|ref|ZP_07167141.1| translation initiation factor IF-1 [Escherichia coli MS 175-1]
 gi|300978552|ref|ZP_07174305.1| translation initiation factor IF-1 [Escherichia coli MS 45-1]
 gi|300983206|ref|ZP_07176485.1| translation initiation factor IF-1 [Escherichia coli MS 200-1]
 gi|301022867|ref|ZP_07186700.1| translation initiation factor IF-1 [Escherichia coli MS 69-1]
 gi|301024397|ref|ZP_07188084.1| translation initiation factor IF-1 [Escherichia coli MS 196-1]
 gi|301047858|ref|ZP_07194908.1| translation initiation factor IF-1 [Escherichia coli MS 185-1]
 gi|301305342|ref|ZP_07211437.1| translation initiation factor IF-1 [Escherichia coli MS 124-1]
 gi|301325794|ref|ZP_07219242.1| translation initiation factor IF-1 [Escherichia coli MS 78-1]
 gi|301646328|ref|ZP_07246216.1| translation initiation factor IF-1 [Escherichia coli MS 146-1]
 gi|306812661|ref|ZP_07446854.1| translation initiation factor IF-1 [Escherichia coli NC101]
 gi|307137512|ref|ZP_07496868.1| translation initiation factor IF-1 [Escherichia coli H736]
 gi|307311729|ref|ZP_07591369.1| translation initiation factor IF-1 [Escherichia coli W]
 gi|309795309|ref|ZP_07689727.1| translation initiation factor IF-1 [Escherichia coli MS 145-7]
 gi|311280206|ref|YP_003942437.1| translation initiation factor IF-1 [Enterobacter cloacae SCF1]
 gi|312969048|ref|ZP_07783255.1| translation initiation factor IF-1 [Escherichia coli 2362-75]
 gi|312971010|ref|ZP_07785189.1| translation initiation factor IF-1 [Escherichia coli 1827-70]
 gi|329998524|ref|ZP_08303134.1| translation initiation factor IF-1 [Klebsiella sp. MS 92-3]
 gi|331641405|ref|ZP_08342540.1| translation initiation factor IF-1 [Escherichia coli H736]
 gi|331646151|ref|ZP_08347254.1| translation initiation factor IF-1 [Escherichia coli M605]
 gi|331651903|ref|ZP_08352922.1| translation initiation factor IF-1 [Escherichia coli M718]
 gi|331656955|ref|ZP_08357917.1| translation initiation factor IF-1 [Escherichia coli TA206]
 gi|331662297|ref|ZP_08363220.1| translation initiation factor IF-1 [Escherichia coli TA143]
 gi|331667257|ref|ZP_08368122.1| translation initiation factor IF-1 [Escherichia coli TA271]
 gi|331676671|ref|ZP_08377367.1| translation initiation factor IF-1 [Escherichia coli H591]
 gi|331682393|ref|ZP_08383012.1| translation initiation factor IF-1 [Escherichia coli H299]
 gi|332282214|ref|ZP_08394627.1| translation initiation factor IF-1 [Shigella sp. D9]
 gi|59799601|sp|P69222|IF1_ECOLI RecName: Full=Translation initiation factor IF-1
 gi|59799602|sp|P69223|IF1_ECOL6 RecName: Full=Translation initiation factor IF-1
 gi|59799603|sp|P69224|IF1_ECO57 RecName: Full=Translation initiation factor IF-1
 gi|59799604|sp|P69225|IF1_SALTI RecName: Full=Translation initiation factor IF-1
 gi|59799605|sp|P69226|IF1_SALTY RecName: Full=Translation initiation factor IF-1
 gi|59799606|sp|P69227|IF1_SHIFL RecName: Full=Translation initiation factor IF-1
 gi|73920046|sp|Q57R48|IF1_SALCH RecName: Full=Translation initiation factor IF-1
 gi|119370862|sp|Q0TJG6|IF1_ECOL5 RecName: Full=Translation initiation factor IF-1
 gi|119370863|sp|Q1RE30|IF1_ECOUT RecName: Full=Translation initiation factor IF-1
 gi|119371115|sp|Q323L9|IF1_SHIBS RecName: Full=Translation initiation factor IF-1
 gi|119371116|sp|Q32E03|IF1_SHIDS RecName: Full=Translation initiation factor IF-1
 gi|119371117|sp|Q3Z3N6|IF1_SHISS RecName: Full=Translation initiation factor IF-1
 gi|122957698|sp|Q0T8P2|IF1_SHIF8 RecName: Full=Translation initiation factor IF-1
 gi|190359590|sp|A8AIJ9|IF1_CITK8 RecName: Full=Translation initiation factor IF-1
 gi|190359638|sp|A7ZJV1|IF1_ECO24 RecName: Full=Translation initiation factor IF-1
 gi|190359639|sp|A7ZYI7|IF1_ECOHS RecName: Full=Translation initiation factor IF-1
 gi|190359641|sp|A7MEQ6|IF1_ENTS8 RecName: Full=Translation initiation factor IF-1
 gi|190359687|sp|A9MI00|IF1_SALAR RecName: Full=Translation initiation factor IF-1
 gi|190359688|sp|A9N7Y7|IF1_SALPB RecName: Full=Translation initiation factor IF-1
 gi|190359706|sp|A6T6Y1|IF1_KLEP7 RecName: Full=Translation initiation factor IF-1
 gi|25299545|pir||AH0610 initiation factor IF-1 [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|12514043|gb|AAG55371.1|AE005277_12 protein chain initiation factor IF-1 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26107310|gb|AAN79493.1|AE016758_97 Translation initiation factor IF-1 [Escherichia coli CFT073]
 gi|41808|emb|CAA68446.1| unnamed protein product [Escherichia coli]
 gi|145167|gb|AAA03232.1| putative [Escherichia coli]
 gi|1651402|dbj|BAA35602.1| translation initiation factor IF-1 [Escherichia coli str. K12
           substr. W3110]
 gi|1787110|gb|AAC73970.1| translation initiation factor IF-1 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13360428|dbj|BAB34392.1| protein chain initiation factor IF-1 [Escherichia coli O157:H7 str.
           Sakai]
 gi|16419464|gb|AAL19888.1| protein chain initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16502118|emb|CAD05354.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|24051110|gb|AAN42476.1| protein chain initiation factor IF-1 [Shigella flexneri 2a str.
           301]
 gi|29138032|gb|AAO69593.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|30040617|gb|AAP16348.1| protein chain initiation factor IF-1 [Shigella flexneri 2a str.
           2457T]
 gi|62127110|gb|AAX64813.1| Translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|73854919|gb|AAZ87626.1| protein chain initiation factor IF-1 [Shigella sonnei Ss046]
 gi|81241742|gb|ABB62452.1| protein chain initiation factor IF-1 [Shigella dysenteriae Sd197]
 gi|81244781|gb|ABB65489.1| protein chain initiation factor IF-1 [Shigella boydii Sb227]
 gi|91071503|gb|ABE06384.1| protein chain initiation factor IF-1 [Escherichia coli UTI89]
 gi|110342676|gb|ABG68913.1| translation initiation factor IF-1 [Escherichia coli 536]
 gi|110614433|gb|ABF03100.1| protein chain initiation factor IF-1 [Shigella flexneri 5 str.
           8401]
 gi|150954322|gb|ABR76352.1| translation initiation factor IF-1 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|156532875|gb|ABU77701.1| hypothetical protein ESA_02455 [Cronobacter sakazakii ATCC BAA-894]
 gi|157066086|gb|ABV05341.1| translation initiation factor IF-1 [Escherichia coli HS]
 gi|157080602|gb|ABV20310.1| translation initiation factor IF-1 [Escherichia coli E24377A]
 gi|157083634|gb|ABV13312.1| hypothetical protein CKO_02188 [Citrobacter koseri ATCC BAA-895]
 gi|160865267|gb|ABX21890.1| hypothetical protein SARI_02010 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161364181|gb|ABX67949.1| hypothetical protein SPAB_02569 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|169755642|gb|ACA78341.1| translation initiation factor IF-1 [Escherichia coli ATCC 8739]
 gi|169888377|gb|ACB02084.1| translation initiation factor IF-1 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170121881|gb|EDS90812.1| translation initiation factor IF-1 [Escherichia albertii TW07627]
 gi|170518942|gb|ACB17120.1| translation initiation factor IF-1 [Escherichia coli SMS-3-5]
 gi|187430284|gb|ACD09558.1| translation initiation factor IF-1 [Shigella boydii CDC 3083-94]
 gi|187766993|gb|EDU30837.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4196]
 gi|188013693|gb|EDU51815.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4113]
 gi|188489378|gb|EDU64481.1| translation initiation factor IF-1 [Escherichia coli 53638]
 gi|188998906|gb|EDU67892.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4076]
 gi|189361178|gb|EDU79597.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4486]
 gi|189364901|gb|EDU83317.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4501]
 gi|189371143|gb|EDU89559.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC869]
 gi|190902359|gb|EDV62097.1| translation initiation factor IF-1 [Escherichia coli B7A]
 gi|190907676|gb|EDV67271.1| translation initiation factor IF-1 [Escherichia coli F11]
 gi|192927714|gb|EDV82329.1| translation initiation factor IF-1 [Escherichia coli E22]
 gi|194403516|gb|ACF63738.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194410006|gb|ACF70225.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194413576|gb|EDX29857.1| translation initiation factor IF-1 [Escherichia coli B171]
 gi|194418653|gb|EDX34740.1| translation initiation factor IF-1 [Shigella dysenteriae 1012]
 gi|194422324|gb|EDX38324.1| translation initiation factor IF-1 [Escherichia coli 101-1]
 gi|194458365|gb|EDX47204.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194709806|gb|ACF89027.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195630909|gb|EDX49495.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197214149|gb|ACH51546.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197243465|gb|EDY26085.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197290160|gb|EDY29517.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197937523|gb|ACH74856.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603162|gb|EDZ01708.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320944|gb|EDZ06145.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205271943|emb|CAR36787.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|205324597|gb|EDZ12436.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327017|gb|EDZ13781.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205334849|gb|EDZ21613.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205340073|gb|EDZ26837.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205340735|gb|EDZ27499.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205347816|gb|EDZ34447.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206567988|gb|ACI09764.1| translation initiation factor IF-1 [Klebsiella pneumoniae 342]
 gi|206708149|emb|CAR32442.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|208732380|gb|EDZ81068.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4045]
 gi|208738208|gb|EDZ85891.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4042]
 gi|209158714|gb|ACI36147.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           EC4115]
 gi|209775108|gb|ACI85866.1| protein chain initiation factor IF-1 [Escherichia coli]
 gi|209775110|gb|ACI85867.1| protein chain initiation factor IF-1 [Escherichia coli]
 gi|209775112|gb|ACI85868.1| protein chain initiation factor IF-1 [Escherichia coli]
 gi|209775114|gb|ACI85869.1| protein chain initiation factor IF-1 [Escherichia coli]
 gi|209775116|gb|ACI85870.1| protein chain initiation factor IF-1 [Escherichia coli]
 gi|209911392|dbj|BAG76466.1| translation initiation factor IF-1 [Escherichia coli SE11]
 gi|215264086|emb|CAS08428.1| translation initiation factor IF-1 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217321771|gb|EEC30195.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           TW14588]
 gi|218351089|emb|CAU96793.1| translation initiation factor IF-1 [Escherichia coli 55989]
 gi|218355947|emb|CAQ88563.1| translation initiation factor IF-1 [Escherichia fergusonii ATCC
           35469]
 gi|218360238|emb|CAQ97788.1| translation initiation factor IF-1 [Escherichia coli IAI1]
 gi|218364561|emb|CAR02247.1| translation initiation factor IF-1 [Escherichia coli S88]
 gi|218370586|emb|CAR18393.1| translation initiation factor IF-1 [Escherichia coli IAI39]
 gi|218426236|emb|CAR07061.1| translation initiation factor IF-1 [Escherichia coli ED1a]
 gi|218431410|emb|CAR12288.1| translation initiation factor IF-1 [Escherichia coli UMN026]
 gi|222032618|emb|CAP75357.1| Translation initiation factor IF-1 [Escherichia coli LF82]
 gi|224467290|gb|ACN45120.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|226898337|gb|EEH84596.1| translation initiation factor IF-1 [Escherichia sp. 3_2_53FAA]
 gi|227838902|gb|EEJ49368.1| translation initiation factor IF-1 [Escherichia coli 83972]
 gi|238546261|dbj|BAH62612.1| translation initiation factor IF-1 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|238863686|gb|ACR65684.1| translation initiation factor IF-1 [Escherichia coli BW2952]
 gi|242376699|emb|CAQ31412.1| protein chain initiation factor IF-1 [Escherichia coli BL21(DE3)]
 gi|253325131|gb|ACT29733.1| translation initiation factor IF-1 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972899|gb|ACT38570.1| translation initiation factor IF-1 [Escherichia coli B str. REL606]
 gi|253977113|gb|ACT42783.1| translation initiation factor IF-1 [Escherichia coli BL21(DE3)]
 gi|254591484|gb|ACT70845.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257752824|dbj|BAI24326.1| translation initiation factor IF-1 [Escherichia coli O26:H11 str.
           11368]
 gi|257758281|dbj|BAI29778.1| translation initiation factor IF-1 [Escherichia coli O103:H2 str.
           12009]
 gi|257763412|dbj|BAI34907.1| translation initiation factor IF-1 [Escherichia coli O111:H- str.
           11128]
 gi|260216463|emb|CBA29598.1| Translation initiation factor IF-1 [Cronobacter turicensis z3032]
 gi|260449970|gb|ACX40392.1| translation initiation factor IF-1 [Escherichia coli DH1]
 gi|261246170|emb|CBG23974.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267992684|gb|ACY87569.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|281178018|dbj|BAI54348.1| translation initiation factor IF-1 [Escherichia coli SE15]
 gi|281600212|gb|ADA73196.1| Translation initiation factor IF-1 [Shigella flexneri 2002017]
 gi|282948160|emb|CBG87727.1| translation initiation factor IF-1 [Citrobacter rodentium ICC168]
 gi|284920737|emb|CBG33800.1| translation initiation factor IF-1 [Escherichia coli 042]
 gi|288891022|gb|ADC59340.1| translation initiation factor IF-1 [Klebsiella variicola At-22]
 gi|289777347|gb|EFD85345.1| translation initiation factor IF-1 [Klebsiella sp. 1_1_55]
 gi|290761760|gb|ADD55721.1| hypothetical protein G2583_1121 [Escherichia coli O55:H7 str.
           CB9615]
 gi|291324000|gb|EFE63422.1| translation initiation factor IF-1 [Escherichia coli B088]
 gi|291428777|gb|EFF01802.1| translation initiation factor IF-1 [Escherichia coli FVEC1412]
 gi|291434224|gb|EFF07197.1| translation initiation factor IF-1 [Escherichia coli B185]
 gi|291469730|gb|EFF12214.1| translation initiation factor IF-1 [Escherichia coli B354]
 gi|294492304|gb|ADE91060.1| translation initiation factor IF-1 [Escherichia coli IHE3034]
 gi|298279670|gb|EFI21178.1| translation initiation factor IF-1 [Escherichia coli FVEC1302]
 gi|299880404|gb|EFI88615.1| translation initiation factor IF-1 [Escherichia coli MS 196-1]
 gi|300300286|gb|EFJ56671.1| translation initiation factor IF-1 [Escherichia coli MS 185-1]
 gi|300306970|gb|EFJ61490.1| translation initiation factor IF-1 [Escherichia coli MS 200-1]
 gi|300318317|gb|EFJ68101.1| translation initiation factor IF-1 [Escherichia coli MS 175-1]
 gi|300356899|gb|EFJ72769.1| translation initiation factor IF-1 [Escherichia coli MS 198-1]
 gi|300397329|gb|EFJ80867.1| translation initiation factor IF-1 [Escherichia coli MS 69-1]
 gi|300405022|gb|EFJ88560.1| translation initiation factor IF-1 [Escherichia coli MS 84-1]
 gi|300409631|gb|EFJ93169.1| translation initiation factor IF-1 [Escherichia coli MS 45-1]
 gi|300411935|gb|EFJ95245.1| translation initiation factor IF-1 [Escherichia coli MS 115-1]
 gi|300417438|gb|EFK00749.1| translation initiation factor IF-1 [Escherichia coli MS 182-1]
 gi|300450871|gb|EFK14491.1| translation initiation factor IF-1 [Escherichia coli MS 116-1]
 gi|300457353|gb|EFK20846.1| translation initiation factor IF-1 [Escherichia coli MS 21-1]
 gi|300462464|gb|EFK25957.1| translation initiation factor IF-1 [Escherichia coli MS 187-1]
 gi|300523822|gb|EFK44891.1| translation initiation factor IF-1 [Escherichia coli MS 119-7]
 gi|300530367|gb|EFK51429.1| translation initiation factor IF-1 [Escherichia coli MS 107-1]
 gi|300839360|gb|EFK67120.1| translation initiation factor IF-1 [Escherichia coli MS 124-1]
 gi|300847437|gb|EFK75197.1| translation initiation factor IF-1 [Escherichia coli MS 78-1]
 gi|301075431|gb|EFK90237.1| translation initiation factor IF-1 [Escherichia coli MS 146-1]
 gi|301157497|emb|CBW16987.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
 gi|305853424|gb|EFM53863.1| translation initiation factor IF-1 [Escherichia coli NC101]
 gi|306908284|gb|EFN38783.1| translation initiation factor IF-1 [Escherichia coli W]
 gi|307552726|gb|ADN45501.1| translation initiation factor IF-1 [Escherichia coli ABU 83972]
 gi|307627686|gb|ADN71990.1| translation initiation factor IF-1 [Escherichia coli UM146]
 gi|308120959|gb|EFO58221.1| translation initiation factor IF-1 [Escherichia coli MS 145-7]
 gi|308749401|gb|ADO49153.1| translation initiation factor IF-1 [Enterobacter cloacae SCF1]
 gi|309701160|emb|CBJ00460.1| translation initiation factor IF-1 [Escherichia coli ETEC H10407]
 gi|310336771|gb|EFQ01938.1| translation initiation factor IF-1 [Escherichia coli 1827-70]
 gi|312286450|gb|EFR14363.1| translation initiation factor IF-1 [Escherichia coli 2362-75]
 gi|312911942|dbj|BAJ35916.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|312945407|gb|ADR26234.1| translation initiation factor IF-1 [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313650204|gb|EFS14616.1| translation initiation factor IF-1 [Shigella flexneri 2a str.
           2457T]
 gi|315060169|gb|ADT74496.1| translation initiation factor IF-1 [Escherichia coli W]
 gi|315135532|dbj|BAJ42691.1| hypothetical protein ECDH1ME8569_0835 [Escherichia coli DH1]
 gi|315257922|gb|EFU37890.1| translation initiation factor IF-1 [Escherichia coli MS 85-1]
 gi|315287274|gb|EFU46685.1| translation initiation factor IF-1 [Escherichia coli MS 110-3]
 gi|315291243|gb|EFU50603.1| translation initiation factor IF-1 [Escherichia coli MS 153-1]
 gi|315296148|gb|EFU55457.1| translation initiation factor IF-1 [Escherichia coli MS 16-3]
 gi|315619195|gb|EFU99774.1| translation initiation factor IF-1 [Escherichia coli 3431]
 gi|320085189|emb|CBY94975.1| Translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|320175324|gb|EFW50430.1| Translation initiation factor 1 [Shigella dysenteriae CDC 74-1112]
 gi|320180601|gb|EFW55530.1| Translation initiation factor 1 [Shigella boydii ATCC 9905]
 gi|320183178|gb|EFW58036.1| Translation initiation factor 1 [Shigella flexneri CDC 796-83]
 gi|320192630|gb|EFW67271.1| Translation initiation factor 1 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320196621|gb|EFW71244.1| Translation initiation factor 1 [Escherichia coli WV_060327]
 gi|320202278|gb|EFW76849.1| Translation initiation factor 1 [Escherichia coli EC4100B]
 gi|320637754|gb|EFX07546.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           G5101]
 gi|320642878|gb|EFX12079.1| translation initiation factor IF-1 [Escherichia coli O157:H- str.
           493-89]
 gi|320648335|gb|EFX16990.1| translation initiation factor IF-1 [Escherichia coli O157:H- str. H
           2687]
 gi|320654173|gb|EFX22241.1| translation initiation factor IF-1 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320659797|gb|EFX27353.1| translation initiation factor IF-1 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320664266|gb|EFX31417.1| translation initiation factor IF-1 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|321223277|gb|EFX48346.1| Translation initiation factor 1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616386|gb|EFY13295.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322619636|gb|EFY16511.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322622668|gb|EFY19513.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322628581|gb|EFY25368.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322631517|gb|EFY28273.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322637044|gb|EFY33747.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322641595|gb|EFY38232.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644450|gb|EFY40990.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649580|gb|EFY46011.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654118|gb|EFY50441.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658033|gb|EFY54300.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322663507|gb|EFY59709.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322670243|gb|EFY66383.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322671479|gb|EFY67601.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322676835|gb|EFY72902.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682760|gb|EFY78779.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686439|gb|EFY82421.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322713946|gb|EFZ05517.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323129219|gb|ADX16649.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323155743|gb|EFZ41912.1| translation initiation factor IF-1 [Escherichia coli EPECa14]
 gi|323159508|gb|EFZ45488.1| translation initiation factor IF-1 [Escherichia coli E128010]
 gi|323165820|gb|EFZ51606.1| translation initiation factor IF-1 [Shigella sonnei 53G]
 gi|323172146|gb|EFZ57784.1| translation initiation factor IF-1 [Escherichia coli LT-68]
 gi|323175495|gb|EFZ61090.1| translation initiation factor IF-1 [Escherichia coli 1180]
 gi|323185152|gb|EFZ70517.1| translation initiation factor IF-1 [Escherichia coli 1357]
 gi|323190705|gb|EFZ75974.1| translation initiation factor IF-1 [Escherichia coli RN587/1]
 gi|323196107|gb|EFZ81270.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323196747|gb|EFZ81891.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323202973|gb|EFZ88007.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323209014|gb|EFZ93951.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211919|gb|EFZ96747.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215149|gb|EFZ99894.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323222352|gb|EGA06730.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323226873|gb|EGA11056.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229827|gb|EGA13950.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323233052|gb|EGA17148.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240787|gb|EGA24829.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323243104|gb|EGA27124.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247425|gb|EGA31381.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323251647|gb|EGA35514.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323257365|gb|EGA41063.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261954|gb|EGA45520.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267969|gb|EGA51448.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323271964|gb|EGA55379.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|323379274|gb|ADX51542.1| translation initiation factor IF-1 [Escherichia coli KO11]
 gi|323937990|gb|EGB34252.1| translation initiation protein IF-1 [Escherichia coli E1520]
 gi|323942800|gb|EGB38965.1| translation initiation protein IF-1 [Escherichia coli E482]
 gi|323947184|gb|EGB43193.1| translation initiation protein IF-1 [Escherichia coli H120]
 gi|323953406|gb|EGB49272.1| translation initiation protein IF-1 [Escherichia coli H252]
 gi|323958191|gb|EGB53900.1| translation initiation protein IF-1 [Escherichia coli H263]
 gi|323962932|gb|EGB58505.1| translation initiation protein IF-1 [Escherichia coli H489]
 gi|323967319|gb|EGB62742.1| translation initiation protein IF-1 [Escherichia coli M863]
 gi|323969617|gb|EGB64904.1| translation initiation protein IF-1 [Escherichia coli TA007]
 gi|323976730|gb|EGB71818.1| translation initiation protein IF-1 [Escherichia coli TW10509]
 gi|324009822|gb|EGB79041.1| translation initiation factor IF-1 [Escherichia coli MS 57-2]
 gi|324012974|gb|EGB82193.1| translation initiation factor IF-1 [Escherichia coli MS 60-1]
 gi|324019026|gb|EGB88245.1| translation initiation factor IF-1 [Escherichia coli MS 117-3]
 gi|324113820|gb|EGC07795.1| translation initiation protein IF-1 [Escherichia fergusonii B253]
 gi|324116097|gb|EGC10021.1| translation initiation protein IF-1 [Escherichia coli E1167]
 gi|325496828|gb|EGC94687.1| translation initiation factor IF-1 [Escherichia fergusonii ECD227]
 gi|326338221|gb|EGD62050.1| Translation initiation factor 1 [Escherichia coli O157:H7 str.
           1125]
 gi|326346198|gb|EGD69936.1| Translation initiation factor 1 [Escherichia coli O157:H7 str.
           1044]
 gi|326622631|gb|EGE28976.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627206|gb|EGE33549.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|327253671|gb|EGE65300.1| translation initiation factor IF-1 [Escherichia coli STEC_7v]
 gi|328538645|gb|EGF64743.1| translation initiation factor IF-1 [Klebsiella sp. MS 92-3]
 gi|330910665|gb|EGH39175.1| translation initiation factor 1 [Escherichia coli AA86]
 gi|331038203|gb|EGI10423.1| translation initiation factor IF-1 [Escherichia coli H736]
 gi|331044903|gb|EGI17030.1| translation initiation factor IF-1 [Escherichia coli M605]
 gi|331050181|gb|EGI22239.1| translation initiation factor IF-1 [Escherichia coli M718]
 gi|331055203|gb|EGI27212.1| translation initiation factor IF-1 [Escherichia coli TA206]
 gi|331060719|gb|EGI32683.1| translation initiation factor IF-1 [Escherichia coli TA143]
 gi|331065613|gb|EGI37506.1| translation initiation factor IF-1 [Escherichia coli TA271]
 gi|331075360|gb|EGI46658.1| translation initiation factor IF-1 [Escherichia coli H591]
 gi|331080024|gb|EGI51203.1| translation initiation factor IF-1 [Escherichia coli H299]
 gi|332088857|gb|EGI93969.1| translation initiation factor IF-1 [Shigella boydii 5216-82]
 gi|332091003|gb|EGI96093.1| translation initiation factor IF-1 [Shigella dysenteriae 155-74]
 gi|332097185|gb|EGJ02168.1| translation initiation factor IF-1 [Shigella boydii 3594-74]
 gi|332104566|gb|EGJ07912.1| translation initiation factor IF-1 [Shigella sp. D9]
 gi|332342271|gb|AEE55605.1| translation initiation factor protein InfA [Escherichia coli
           UMNK88]
 gi|332759798|gb|EGJ90101.1| translation initiation factor IF-1 [Shigella flexneri 4343-70]
 gi|332760487|gb|EGJ90776.1| translation initiation factor IF-1 [Shigella flexneri 2747-71]
 gi|332762939|gb|EGJ93189.1| translation initiation factor IF-1 [Shigella flexneri K-671]
 gi|332768061|gb|EGJ98247.1| translation initiation factor IF-1 [Shigella flexneri 2930-71]
 gi|332987846|gb|AEF06829.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
 gi|333006686|gb|EGK26185.1| translation initiation factor IF-1 [Shigella flexneri VA-6]
 gi|333007015|gb|EGK26510.1| translation initiation factor IF-1 [Shigella flexneri K-218]
 gi|333008803|gb|EGK28263.1| translation initiation factor IF-1 [Shigella flexneri K-272]
 gi|333020313|gb|EGK39579.1| translation initiation factor IF-1 [Shigella flexneri K-227]
 gi|333021007|gb|EGK40265.1| translation initiation factor IF-1 [Shigella flexneri K-304]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR 72


>gi|269102228|ref|ZP_06154925.1| translation initiation factor IF-1 [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162126|gb|EEZ40622.1| translation initiation factor IF-1 [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIVFRAR 72


>gi|225621048|ref|YP_002722306.1| translation initiation factor IF-1 [Brachyspira hyodysenteriae WA1]
 gi|225215868|gb|ACN84602.1| translation initiation factor IF-1 [Brachyspira hyodysenteriae WA1]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M + ET+E  G V E LPNA FRV+L                                  
Sbjct: 1   MAERETIEVEGTVVEPLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR + IRI  GDKV + M+PYD+T+ RI YR+K
Sbjct: 27  ----ENGHKILAHISGKMRMNFIRILPGDKVTIEMSPYDLTKGRIIYRYK 72


>gi|152993914|ref|YP_001359635.1| translation initiation factor IF-1 [Sulfurovum sp. NBC37-1]
 gi|190359716|sp|A6QCR9|IF1_SULNB RecName: Full=Translation initiation factor IF-1
 gi|151425775|dbj|BAF73278.1| translation initiation factor IF-1 [Sulfurovum sp. NBC37-1]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEIDGKVVEALPNATFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + AG+MR H I+I  GDKVKV + PY + + RIT+R+K
Sbjct: 28  -----NGHIVLCHIAGKMRMHYIKILPGDKVKVELTPYSLDKGRITFRYK 72


>gi|150395438|ref|YP_001325905.1| translation initiation factor IF-1 [Sinorhizobium medicae WSM419]
 gi|150026953|gb|ABR59070.1| translation initiation factor IF-1 [Sinorhizobium medicae WSM419]
          Length = 87

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 16  MAKEEVLEFPGVVTELLPNATFRVKL---------------------------------- 41

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 42  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 87


>gi|227820809|ref|YP_002824779.1| translation initiation factor IF-1 [Sinorhizobium fredii NGR234]
 gi|227339808|gb|ACP24026.1| translation initiation factor IF-1 [Sinorhizobium fredii NGR234]
          Length = 87

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 16  MAKEEVLEFPGVVTELLPNATFRVKL---------------------------------- 41

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 42  ----ENDHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 87


>gi|158319567|ref|YP_001512074.1| translation initiation factor IF-1 [Alkaliphilus oremlandii OhILAs]
 gi|190359562|sp|A8MLG4|IF1_ALKOO RecName: Full=Translation initiation factor IF-1
 gi|158139766|gb|ABW18078.1| translation initiation factor IF-1 [Alkaliphilus oremlandii OhILAs]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G+V E LPNA F V L                                  
Sbjct: 1   MSKQDVIELEGVVKEALPNAMFIVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R + IRI  GDKV V ++PYD++R RIT+R K
Sbjct: 27  ----ENGHEVLGHISGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRKK 72


>gi|90413214|ref|ZP_01221209.1| putative initiation factor [Photobacterium profundum 3TCK]
 gi|90325766|gb|EAS42224.1| putative initiation factor [Photobacterium profundum 3TCK]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVQDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIVFRAR 72


>gi|114327694|ref|YP_744851.1| translation initiation factor IF-1 [Granulibacter bethesdensis
           CGDNIH1]
 gi|119370869|sp|Q0BTC4|IF1_GRABC RecName: Full=Translation initiation factor IF-1
 gi|114315868|gb|ABI61928.1| bacterial protein translation initiation factor 1 (IF-1)
           [Granulibacter bethesdensis CGDNIH1]
          Length = 72

 Score =  113 bits (283), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V ELLPNA FRVKL                                  
Sbjct: 1   MSKEDMIEFSGTVMELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NEHSILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|291277247|ref|YP_003517019.1| translation initiation factor IF-1 [Helicobacter mustelae 12198]
 gi|290964441|emb|CBG40291.1| translation initiation factor IF-1 [Helicobacter mustelae 12198]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEIDGKVVEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H I+I  GDKVK+ + PY + + RIT+R+K
Sbjct: 27  ----ENGHVVLCHISGKMRMHYIKILPGDKVKIELTPYSLDKGRITFRYK 72


>gi|160932177|ref|ZP_02079568.1| hypothetical protein CLOLEP_01012 [Clostridium leptum DSM 753]
 gi|156868779|gb|EDO62151.1| hypothetical protein CLOLEP_01012 [Clostridium leptum DSM 753]
          Length = 74

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + K++ +E  G V E LPNA F+V+L                                  
Sbjct: 3   LSKQDVIEIEGTVKEALPNAMFQVELP--------------------------------- 29

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G++R + IRI  GDKV + M+PYD+TR RIT+R K
Sbjct: 30  -----NGHMILAHISGKLRMNFIRILPGDKVTLEMSPYDLTRGRITWRSK 74


>gi|116493141|ref|YP_804876.1| translation initiation factor IF-1 [Pediococcus pentosaceus ATCC
           25745]
 gi|122265395|sp|Q03ED8|IF1_PEDPA RecName: Full=Translation initiation factor IF-1
 gi|116103291|gb|ABJ68434.1| bacterial translation initiation factor 1 (bIF-1) [Pediococcus
           pentosaceus ATCC 25745]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E +PNA F+V+L                                  
Sbjct: 1   MAKDNVIEIEGTVKETMPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H I+I  GDKV V M+PYD+++ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIKILPGDKVTVEMSPYDLSKGRITYRFK 72


>gi|162147234|ref|YP_001601695.1| translation initiation factor IF-1 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209544283|ref|YP_002276512.1| translation initiation factor IF-1 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|296117425|ref|ZP_06836013.1| translation initiation factor IF-1 [Gluconacetobacter hansenii ATCC
           23769]
 gi|190359743|sp|A9HFM1|IF1_GLUDA RecName: Full=Translation initiation factor IF-1
 gi|161785811|emb|CAP55382.1| putative translation initiation factor IF-1 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209531960|gb|ACI51897.1| translation initiation factor IF-1 [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|295976027|gb|EFG82817.1| translation initiation factor IF-1 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V+ELLPNA FRVKL                                  
Sbjct: 1   MSKEDMIEFSGTVTELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+T+G+MRK+RIR+  GD+V V M PYD+++ RIT+RFK
Sbjct: 28  -----NEHMILAHTSGKMRKNRIRVLAGDRVNVEMTPYDLSKGRITFRFK 72


>gi|22297645|ref|NP_680892.1| translation initiation factor IF-1 [Thermosynechococcus elongatus
           BP-1]
 gi|220906739|ref|YP_002482050.1| translation initiation factor IF-1 [Cyanothece sp. PCC 7425]
 gi|29427443|sp|Q8DML3|IF1_THEEB RecName: Full=Translation initiation factor IF-1
 gi|22293822|dbj|BAC07654.1| translation initiation factor IF-1 [Thermosynechococcus elongatus
           BP-1]
 gi|219863350|gb|ACL43689.1| translation initiation factor IF-1 [Cyanothece sp. PCC 7425]
          Length = 74

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV L                                  
Sbjct: 1   MSKQDAIEIEGTVTESLPNAMFRVDLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|167855537|ref|ZP_02478299.1| translation initiation factor IF-1 [Haemophilus parasuis 29755]
 gi|219871285|ref|YP_002475660.1| translation initiation factor IF-1 [Haemophilus parasuis SH0165]
 gi|167853338|gb|EDS24590.1| translation initiation factor IF-1 [Haemophilus parasuis 29755]
 gi|219691489|gb|ACL32712.1| translation initiation factor IF-1 [Haemophilus parasuis SH0165]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRAR 72


>gi|313112855|ref|ZP_07798501.1| translation initiation factor IF-1 [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624760|gb|EFQ08069.1| translation initiation factor IF-1 [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 83

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 27/110 (24%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIV E +PNA F+V++++ D ++                           
Sbjct: 1   MSKEDVIEIEGIVREAMPNAIFKVEMLSEDKNTGKL------------------------ 36

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +++A+ +G++R + IRI  GDKV V M+PYD+++ RIT+R K
Sbjct: 37  ---TPSGHILLAHISGKLRTNFIRILPGDKVTVEMSPYDLSKGRITWRSK 83


>gi|184155969|ref|YP_001844309.1| translation initiation factor IF-1 [Lactobacillus fermentum IFO
           3956]
 gi|227515509|ref|ZP_03945558.1| protein translation initiation factor 1 [Lactobacillus fermentum
           ATCC 14931]
 gi|260662774|ref|ZP_05863668.1| translation initiation factor IF-1 [Lactobacillus fermentum
           28-3-CHN]
 gi|183227313|dbj|BAG27829.1| translation initiation factor IF-1 [Lactobacillus fermentum IFO
           3956]
 gi|227086122|gb|EEI21434.1| protein translation initiation factor 1 [Lactobacillus fermentum
           ATCC 14931]
 gi|260552855|gb|EEX25854.1| translation initiation factor IF-1 [Lactobacillus fermentum
           28-3-CHN]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V+E LPNA F+V+L                                  
Sbjct: 1   MAKADVIEVEGKVTETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H I+I  GD+V+V M+PYD+T+ RIT+RFK
Sbjct: 27  ----ENGVEILAHVSGKIRMHYIKILPGDRVRVEMSPYDLTKGRITFRFK 72


>gi|319955877|ref|YP_004167140.1| bacterial translation initiation factor 1 (bif-1) [Nitratifractor
           salsuginis DSM 16511]
 gi|319418281|gb|ADV45391.1| bacterial translation initiation factor 1 (bIF-1) [Nitratifractor
           salsuginis DSM 16511]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEIDGKVIEALPNATFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + AG+MR H I+I  GD+VKV + PY + + RIT+R+K
Sbjct: 28  -----NGHVVLCHIAGKMRMHYIKILPGDRVKVELTPYSLDKGRITFRYK 72


>gi|239623371|ref|ZP_04666402.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239522337|gb|EEQ62203.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVIEKLPNAMFQVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|333029361|ref|ZP_08457422.1| Translation initiation factor IF-1 [Bacteroides coprosuis DSM
           18011]
 gi|332739958|gb|EGJ70440.1| Translation initiation factor IF-1 [Bacteroides coprosuis DSM
           18011]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQPAIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GD+VKV M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDRVKVEMSPYDLSKGRIVFRYK 72


>gi|74316444|ref|YP_314184.1| translation initiation factor IF-1 [Thiobacillus denitrificans ATCC
           25259]
 gi|119370820|sp|Q3SLM8|IF11_THIDA RecName: Full=Translation initiation factor IF-1 1
 gi|74055939|gb|AAZ96379.1| translation initiation factor IF-1 [Thiobacillus denitrificans ATCC
           25259]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEDVIQMQGEVIENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + +G+MR H IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGHVLLGHISGKMRMHYIRILPGDKVTVELTPYDLTKGRIVFRAK 72


>gi|308233880|ref|ZP_07664617.1| translation initiation factor IF-1 [Atopobium vaginae DSM 15829]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKQDGIELEGTVLEPLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGKTILCTISGKIRMNYIRILPGDKVTVEISPYDLTRGRITYRYK 72


>gi|149192138|ref|ZP_01870360.1| translation initiation factor IF-1 [Vibrio shilonii AK1]
 gi|148834041|gb|EDL51056.1| translation initiation factor IF-1 [Vibrio shilonii AK1]
          Length = 72

 Score =  113 bits (283), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIVFRAR 72


>gi|304413813|ref|ZP_07395230.1| translation initiation factor 1 (IF-1) [Candidatus Regiella
           insecticola LSR1]
 gi|304283533|gb|EFL91928.1| translation initiation factor 1 (IF-1) [Candidatus Regiella
           insecticola LSR1]
          Length = 72

 Score =  113 bits (282), Expect = 8e-24,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHQVTAHISGKMRKNYIRILTGDKVSVELTPYDLTKGRIIFRAR 72


>gi|164686550|ref|ZP_02210578.1| hypothetical protein CLOBAR_00117 [Clostridium bartlettii DSM
           16795]
 gi|164604419|gb|EDQ97884.1| hypothetical protein CLOBAR_00117 [Clostridium bartlettii DSM
           16795]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +EF G V E LPNA F+VKL                                  
Sbjct: 1   MAKKDVIEFEGTVVENLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R + IRI  GDKVK+ ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHEVLCHLSGKLRMNFIRILEGDKVKIELSPYDLTRGRITWRKK 72


>gi|119364596|sp|Q32RV0|IF1C_STAPU RecName: Full=Translation initiation factor IF-1, chloroplastic
          Length = 77

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GIV+E LPNA FRV L                                  
Sbjct: 1   MRKQNLIEMEGIVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++RK+ IRI LGD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCQVLAHISGKIRKNYIRILLGDRVKVELSPYDLTKGRITYRLR 72


>gi|304384297|ref|ZP_07366708.1| translation initiation factor IF-1 [Prevotella marshii DSM 16973]
 gi|304334613|gb|EFM00895.1| translation initiation factor IF-1 [Prevotella marshii DSM 16973]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVK+ M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGCPITAHISGKMRMHYIKILPGDKVKIEMSPYDLTKGRIVFRYK 72


>gi|94968277|ref|YP_590325.1| translation initiation factor IF-1 [Candidatus Koribacter
           versatilis Ellin345]
 gi|119370837|sp|Q1IS99|IF1_ACIBL RecName: Full=Translation initiation factor IF-1
 gi|94550327|gb|ABF40251.1| bacterial translation initiation factor 1 (bIF-1) [Candidatus
           Koribacter versatilis Ellin345]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E   +V E LPNA F+V+L                                  
Sbjct: 1   MSKEDAIEVMAVVIEPLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MRK+ IRI  GD+V V ++PYD+TR RI YR+K
Sbjct: 27  ----ENKHQVLAHVSGKMRKNFIRILPGDRVAVELSPYDLTRGRIVYRYK 72


>gi|268609569|ref|ZP_06143296.1| translation initiation factor IF-1 [Ruminococcus flavefaciens FD-1]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V++ LPNA F+V+L                                  
Sbjct: 1   MSKEDVIEVEGVVTDALPNAMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+++ +G++R + IRI  GDKVK+ M+PYD+++ RIT+R K
Sbjct: 27  ----ENGHEVLSHVSGKLRMNYIRIVPGDKVKLEMSPYDLSKGRITWRVK 72


>gi|261344320|ref|ZP_05971964.1| translation initiation factor IF-1 [Providencia rustigianii DSM
           4541]
 gi|282567925|gb|EFB73460.1| translation initiation factor IF-1 [Providencia rustigianii DSM
           4541]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIIFRSR 72


>gi|229829407|ref|ZP_04455476.1| hypothetical protein GCWU000342_01497 [Shuttleworthia satelles DSM
           14600]
 gi|229791838|gb|EEP27952.1| hypothetical protein GCWU000342_01497 [Shuttleworthia satelles DSM
           14600]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKADVIEVEGKVLEKLPNAMFSVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKV V M+PYD+T+ RI +R K
Sbjct: 27  ----ENGHQILAHISGKLRMNYIRILPGDKVTVEMSPYDLTKGRIIWRDK 72


>gi|30995385|ref|NP_438706.2| translation initiation factor IF-1 [Haemophilus influenzae Rd KW20]
 gi|113460850|ref|YP_718917.1| translation initiation factor IF-1 [Haemophilus somnus 129PT]
 gi|145628929|ref|ZP_01784729.1| translation initiation factor IF-1 [Haemophilus influenzae 22.1-21]
 gi|145630271|ref|ZP_01786052.1| translation initiation factor IF-1 [Haemophilus influenzae R3021]
 gi|145633500|ref|ZP_01789229.1| translation initiation factor IF-1 [Haemophilus influenzae 3655]
 gi|145635371|ref|ZP_01791073.1| translation initiation factor IF-1 [Haemophilus influenzae PittAA]
 gi|145637410|ref|ZP_01793069.1| translation initiation factor IF-1 [Haemophilus influenzae PittHH]
 gi|145638542|ref|ZP_01794151.1| translation initiation factor IF-1 [Haemophilus influenzae PittII]
 gi|145640521|ref|ZP_01796105.1| translation initiation factor IF-1 [Haemophilus influenzae R3021]
 gi|148825177|ref|YP_001289930.1| translation initiation factor IF-1 [Haemophilus influenzae PittEE]
 gi|148827739|ref|YP_001292492.1| translation initiation factor IF-1 [Haemophilus influenzae PittGG]
 gi|170717336|ref|YP_001784446.1| translation initiation factor IF-1 [Haemophilus somnus 2336]
 gi|229844292|ref|ZP_04464432.1| translation initiation factor IF-1 [Haemophilus influenzae 6P18H1]
 gi|229846631|ref|ZP_04466739.1| translation initiation factor IF-1 [Haemophilus influenzae 7P49H1]
 gi|251792057|ref|YP_003006777.1| translation initiation factor IF-1 [Aggregatibacter aphrophilus
           NJ8700]
 gi|319775531|ref|YP_004138019.1| translation initiation factor IF-1 [Haemophilus influenzae F3047]
 gi|319897935|ref|YP_004136132.1| translation initiation factor if-1 [Haemophilus influenzae F3031]
 gi|325579203|ref|ZP_08149159.1| translation initiation factor IF-1 [Haemophilus parainfluenzae ATCC
           33392]
 gi|1170492|sp|P44322|IF1_HAEIN RecName: Full=Translation initiation factor IF-1
 gi|119370870|sp|Q4QN00|IF1_HAEI8 RecName: Full=Translation initiation factor IF-1
 gi|119370871|sp|Q0I2S8|IF1_HAES1 RecName: Full=Translation initiation factor IF-1
 gi|190359741|sp|A5UH53|IF1_HAEIG RecName: Full=Translation initiation factor IF-1
 gi|190359745|sp|A5U9U6|IF1_HAEIE RecName: Full=Translation initiation factor IF-1
 gi|112822893|gb|ABI24982.1| bacterial translation initiation factor 1 (bIF-1) [Haemophilus
           somnus 129PT]
 gi|144979399|gb|EDJ89085.1| translation initiation factor IF-1 [Haemophilus influenzae 22.1-21]
 gi|144984006|gb|EDJ91443.1| translation initiation factor IF-1 [Haemophilus influenzae R3021]
 gi|144985869|gb|EDJ92477.1| translation initiation factor IF-1 [Haemophilus influenzae 3655]
 gi|145267377|gb|EDK07379.1| translation initiation factor IF-1 [Haemophilus influenzae PittAA]
 gi|145269356|gb|EDK09300.1| translation initiation factor IF-1 [Haemophilus influenzae PittHH]
 gi|145272137|gb|EDK12045.1| translation initiation factor IF-1 [Haemophilus influenzae PittII]
 gi|145275107|gb|EDK14969.1| translation initiation factor IF-1 [Haemophilus influenzae 22.4-21]
 gi|148715337|gb|ABQ97547.1| translation initiation factor IF-1 [Haemophilus influenzae PittEE]
 gi|148718981|gb|ABR00109.1| translation initiation factor IF-1 [Haemophilus influenzae PittGG]
 gi|168825465|gb|ACA30836.1| translation initiation factor IF-1 [Haemophilus somnus 2336]
 gi|229810724|gb|EEP46442.1| translation initiation factor IF-1 [Haemophilus influenzae 7P49H1]
 gi|229812541|gb|EEP48230.1| translation initiation factor IF-1 [Haemophilus influenzae 6P18H1]
 gi|247533444|gb|ACS96690.1| translation initiation factor IF-1 [Aggregatibacter aphrophilus
           NJ8700]
 gi|301169263|emb|CBW28860.1| translation initiation factor IF-1 [Haemophilus influenzae 10810]
 gi|309750046|gb|ADO80030.1| translation initiation factor 1 (IF-1) [Haemophilus influenzae
           R2866]
 gi|309972301|gb|ADO95502.1| translation initiation factor 1 (IF-1) [Haemophilus influenzae
           R2846]
 gi|317433441|emb|CBY81824.1| translation initiation factor IF-1 [Haemophilus influenzae F3031]
 gi|317450122|emb|CBY86336.1| translation initiation factor IF-1 [Haemophilus influenzae F3047]
 gi|325159438|gb|EGC71572.1| translation initiation factor IF-1 [Haemophilus parainfluenzae ATCC
           33392]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRSR 72


>gi|161485991|ref|NP_737178.2| translation initiation factor IF-1 [Corynebacterium efficiens
           YS-314]
 gi|259506745|ref|ZP_05749645.1| translation initiation factor IF-1 [Corynebacterium efficiens
           YS-314]
 gi|29427494|sp|Q8FS36|IF1_COREF RecName: Full=Translation initiation factor IF-1
 gi|259165686|gb|EEW50240.1| translation initiation factor IF-1 [Corynebacterium efficiens
           YS-314]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRVVEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 72


>gi|225387214|ref|ZP_03756978.1| hypothetical protein CLOSTASPAR_00966 [Clostridium asparagiforme
           DSM 15981]
 gi|225046693|gb|EEG56939.1| hypothetical protein CLOSTASPAR_00966 [Clostridium asparagiforme
           DSM 15981]
          Length = 72

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|241889132|ref|ZP_04776436.1| translation initiation factor IF-1 [Gemella haemolysans ATCC 10379]
 gi|317496168|ref|ZP_07954528.1| translation initiation factor IF-1 [Gemella moribillum M424]
 gi|329768295|ref|ZP_08259796.1| translation initiation factor IF-1 [Gemella haemolysans M341]
 gi|329770018|ref|ZP_08261413.1| translation initiation factor IF-1 [Gemella sanguinis M325]
 gi|241864381|gb|EER68759.1| translation initiation factor IF-1 [Gemella haemolysans ATCC 10379]
 gi|316913743|gb|EFV35229.1| translation initiation factor IF-1 [Gemella moribillum M424]
 gi|328837329|gb|EGF86959.1| translation initiation factor IF-1 [Gemella sanguinis M325]
 gi|328837494|gb|EGF87123.1| translation initiation factor IF-1 [Gemella haemolysans M341]
          Length = 71

 Score =  113 bits (282), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 39/110 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MAK-DVIEVEGLVVENLPNAMFKVEL---------------------------------- 25

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G++R + IRI  GDKV V M+PYD+T+ RITYRFK
Sbjct: 26  ----ENGHIILAHVSGKIRMNYIRILPGDKVTVEMSPYDLTKGRITYRFK 71


>gi|326799150|ref|YP_004316969.1| translation initiation factor IF-1 [Sphingobacterium sp. 21]
 gi|326549914|gb|ADZ78299.1| Translation initiation factor IF-1 [Sphingobacterium sp. 21]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQASIEQDGVIKEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GD+VK+ M+PYD+T+ RITYR+K
Sbjct: 27  ----ENGHEIIAHISGKMRMHYIKILPGDRVKLEMSPYDLTKGRITYRYK 72


>gi|251772513|gb|EES53079.1| translation initiation factor IF-1 [Leptospirillum
           ferrodiazotrophum]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T+E  G V E LPNA FRV+L                                  
Sbjct: 1   MGKEDTVEVQGTVLETLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR + I+I  GDKV + ++ YD+TR RITYRFK
Sbjct: 27  ----ENGHKVLAHISGKMRMNYIKILPGDKVTLELSLYDLTRGRITYRFK 72


>gi|15674054|ref|NP_268229.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           lactis Il1403]
 gi|116513031|ref|YP_811938.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           cremoris SK11]
 gi|125625119|ref|YP_001033602.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|281492736|ref|YP_003354716.1| protein translation initiation factor 1 (IF-1) [Lactococcus lactis
           subsp. lactis KF147]
 gi|61226326|sp|P0A3K4|IF1_LACLA RecName: Full=Translation initiation factor IF-1
 gi|61226328|sp|P0A3K5|IF1_LACLC RecName: Full=Translation initiation factor IF-1
 gi|122939921|sp|Q02W47|IF1_LACLS RecName: Full=Translation initiation factor IF-1
 gi|190359646|sp|A2RNN1|IF1_LACLM RecName: Full=Translation initiation factor IF-1
 gi|12725124|gb|AAK06170.1|AE006436_19 translation initiation factor IF-1 [Lactococcus lactis subsp.
           lactis Il1403]
 gi|581299|emb|CAA41941.1| initiation factor IF-1 [Lactococcus lactis]
 gi|116108685|gb|ABJ73825.1| bacterial translation initiation factor 1 (bIF-1) [Lactococcus
           lactis subsp. cremoris SK11]
 gi|124493927|emb|CAL98922.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           cremoris MG1363]
 gi|281376388|gb|ADA65874.1| Protein translation initiation factor 1 (IF-1) [Lactococcus lactis
           subsp. lactis KF147]
 gi|300071927|gb|ADJ61327.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           cremoris NZ9000]
 gi|326407608|gb|ADZ64679.1| translation initiation factor IF-1 [Lactococcus lactis subsp.
           lactis CV56]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + +PNA F V+L                                  
Sbjct: 1   MAKDDVIEVDGKVVDTMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++RK+ IRI  GDKV+V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHQVLATISGKIRKNYIRILPGDKVQVELSPYDLTRGRITYRFK 72


>gi|325280946|ref|YP_004253488.1| Translation initiation factor IF-1 [Odoribacter splanchnicus DSM
           20712]
 gi|324312755|gb|ADY33308.1| Translation initiation factor IF-1 [Odoribacter splanchnicus DSM
           20712]
          Length = 73

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G+++E L NA FRV+L                                  
Sbjct: 1   MAKQPSIEQDGVITEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H I+I  GD+V+V M+PYD+T+ RIT+R+K
Sbjct: 27  ----ENGHVITAHISGKMRMHYIKILPGDRVRVDMSPYDLTKGRITFRYK 72


>gi|28202207|ref|NP_777448.1| translation initiation factor 1 [Anthoceros formosae]
 gi|41688579|sp|Q85C77|IF1C_ANTFO RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|27807909|dbj|BAC55384.1| initiation factor 1 [Anthoceros formosae]
 gi|27808059|dbj|BAC55481.1| initiation factor 1 [Anthoceros formosae]
          Length = 78

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G+V+E LPNA FRV L                                  
Sbjct: 1   MEKQNLIDMEGVVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R++ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCQVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRLR 72


>gi|306821596|ref|ZP_07455194.1| translation initiation factor IF-1 [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
 gi|304550341|gb|EFM38334.1| translation initiation factor IF-1 [Eubacterium yurii subsp.
           margaretiae ATCC 43715]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V++ LPNA F+VKL                                  
Sbjct: 1   MAKSDVIEMEGTVTDALPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  + A+ +G++R + IRI  GDKV V ++PYD+T+ RI +R K
Sbjct: 27  ----ENDFEITAHISGKLRMNFIRILPGDKVTVELSPYDLTKGRIIWRKK 72


>gi|260772640|ref|ZP_05881556.1| translation initiation factor 1 [Vibrio metschnikovii CIP 69.14]
 gi|260611779|gb|EEX36982.1| translation initiation factor 1 [Vibrio metschnikovii CIP 69.14]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHTVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|114769472|ref|ZP_01447098.1| translation initiation factor IF-1 [alpha proteobacterium HTCC2255]
 gi|114550389|gb|EAU53270.1| translation initiation factor IF-1 [alpha proteobacterium HTCC2255]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEFDGVVVELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+++ RI +R+K
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLSKGRINFRYK 72


>gi|119775190|ref|YP_927930.1| translation initiation factor IF-1 [Shewanella amazonensis SB2B]
 gi|190359690|sp|A1S7A4|IF1_SHEAM RecName: Full=Translation initiation factor IF-1
 gi|119767690|gb|ABM00261.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           amazonensis SB2B]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVQLTPYDLTKGRIVFRAR 72


>gi|261409497|ref|YP_003245738.1| translation initiation factor IF-1 [Paenibacillus sp. Y412MC10]
 gi|308070951|ref|YP_003872556.1| translation initiation factor IF-1 [Paenibacillus polymyxa E681]
 gi|310644177|ref|YP_003948936.1| protein translation initiation factor 1 [Paenibacillus polymyxa
           SC2]
 gi|315649675|ref|ZP_07902759.1| translation initiation factor IF-1 [Paenibacillus vortex V453]
 gi|329922034|ref|ZP_08277827.1| translation initiation factor IF-1 [Paenibacillus sp. HGF5]
 gi|261285960|gb|ACX67931.1| translation initiation factor IF-1 [Paenibacillus sp. Y412MC10]
 gi|305860230|gb|ADM72018.1| Translation initiation factor IF-1 [Paenibacillus polymyxa E681]
 gi|309249128|gb|ADO58695.1| Protein translation initiation factor 1 [Paenibacillus polymyxa
           SC2]
 gi|315274863|gb|EFU38239.1| translation initiation factor IF-1 [Paenibacillus vortex V453]
 gi|328942417|gb|EGG38681.1| translation initiation factor IF-1 [Paenibacillus sp. HGF5]
          Length = 71

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNATFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   ++A+ +G++R H IRI  GDKV V ++PYD+T+ RITYR
Sbjct: 27  ----ENGHQILAHVSGKLRMHFIRILTGDKVVVQLSPYDLTKGRITYR 70


>gi|325104846|ref|YP_004274500.1| bacterial translation initiation factor 1 (bIF-1) [Pedobacter
           saltans DSM 12145]
 gi|324973694|gb|ADY52678.1| bacterial translation initiation factor 1 (bIF-1) [Pedobacter
           saltans DSM 12145]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSSIEQDGVIKEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GD+VK+ M+PYD+T+ RITYR+K
Sbjct: 27  ----ENGHEIIAHISGKMRMHYIKILPGDRVKLEMSPYDLTKGRITYRYK 72


>gi|57234756|ref|YP_181241.1| translation initiation factor IF-1 [Dehalococcoides ethenogenes
           195]
 gi|73748339|ref|YP_307578.1| translation initiation factor IF-1 [Dehalococcoides sp. CBDB1]
 gi|147669119|ref|YP_001213937.1| translation initiation factor 1 [Dehalococcoides sp. BAV1]
 gi|270307864|ref|YP_003329922.1| translation initiation factor 1 (IF-1) [Dehalococcoides sp. VS]
 gi|289432387|ref|YP_003462260.1| translation initiation factor IF-1 [Dehalococcoides sp. GT]
 gi|119370858|sp|Q3Z958|IF1_DEHE1 RecName: Full=Translation initiation factor IF-1
 gi|119370859|sp|Q3ZZQ1|IF1_DEHSC RecName: Full=Translation initiation factor IF-1
 gi|190359634|sp|A5FRW7|IF1_DEHSB RecName: Full=Translation initiation factor IF-1
 gi|57225204|gb|AAW40261.1| translation initiation factor IF-1 [Dehalococcoides ethenogenes
           195]
 gi|73660055|emb|CAI82662.1| translation initiation factor IF-1 [Dehalococcoides sp. CBDB1]
 gi|146270067|gb|ABQ17059.1| bacterial translation initiation factor 1 (bIF-1) [Dehalococcoides
           sp. BAV1]
 gi|270153756|gb|ACZ61594.1| translation initiation factor 1 (IF-1) [Dehalococcoides sp. VS]
 gi|288946107|gb|ADC73804.1| translation initiation factor IF-1 [Dehalococcoides sp. GT]
          Length = 73

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK++ +E    V E LP+A FRV+L                                  
Sbjct: 1   MPKKDAIEVEATVLEALPSAAFRVQLS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H IRI  GD+V V ++PYD+TR R+TYRFK
Sbjct: 28  -----NGHEVLAHISGKMRVHYIRILPGDRVLVELSPYDLTRGRVTYRFK 72


>gi|266620239|ref|ZP_06113174.1| translation initiation factor IF-1 [Clostridium hathewayi DSM
           13479]
 gi|288868142|gb|EFD00441.1| translation initiation factor IF-1 [Clostridium hathewayi DSM
           13479]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|56413995|ref|YP_151070.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|197362918|ref|YP_002142555.1| translation initiation factor IF-1 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|59797988|sp|Q5PGJ4|IF1_SALPA RecName: Full=Translation initiation factor IF-1
 gi|56128252|gb|AAV77758.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197094395|emb|CAR59910.1| initiation factor IF-1 [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHMVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR 72


>gi|24374167|ref|NP_718210.1| translation initiation factor IF-1 [Shewanella oneidensis MR-1]
 gi|113969989|ref|YP_733782.1| translation initiation factor IF-1 [Shewanella sp. MR-4]
 gi|114047224|ref|YP_737774.1| translation initiation factor IF-1 [Shewanella sp. MR-7]
 gi|117920201|ref|YP_869393.1| translation initiation factor IF-1 [Shewanella sp. ANA-3]
 gi|120598599|ref|YP_963173.1| translation initiation factor IF-1 [Shewanella sp. W3-18-1]
 gi|126174684|ref|YP_001050833.1| translation initiation factor IF-1 [Shewanella baltica OS155]
 gi|146293322|ref|YP_001183746.1| translation initiation factor IF-1 [Shewanella putrefaciens CN-32]
 gi|153000983|ref|YP_001366664.1| translation initiation factor IF-1 [Shewanella baltica OS185]
 gi|160875696|ref|YP_001555012.1| translation initiation factor IF-1 [Shewanella baltica OS195]
 gi|217973057|ref|YP_002357808.1| translation initiation factor IF-1 [Shewanella baltica OS223]
 gi|304409061|ref|ZP_07390682.1| translation initiation factor IF-1 [Shewanella baltica OS183]
 gi|307303064|ref|ZP_07582819.1| translation initiation factor IF-1 [Shewanella baltica BA175]
 gi|29427468|sp|Q8EDW6|IF1_SHEON RecName: Full=Translation initiation factor IF-1
 gi|119371113|sp|Q0HJP2|IF1_SHESM RecName: Full=Translation initiation factor IF-1
 gi|119371114|sp|Q0HVY8|IF1_SHESR RecName: Full=Translation initiation factor IF-1
 gi|190359691|sp|A3D5F1|IF1_SHEB5 RecName: Full=Translation initiation factor IF-1
 gi|190359692|sp|A6WP62|IF1_SHEB8 RecName: Full=Translation initiation factor IF-1
 gi|190359695|sp|A4Y7L4|IF1_SHEPC RecName: Full=Translation initiation factor IF-1
 gi|190359696|sp|A0KW18|IF1_SHESA RecName: Full=Translation initiation factor IF-1
 gi|190359698|sp|A1RIX4|IF1_SHESW RecName: Full=Translation initiation factor IF-1
 gi|190359747|sp|A9L4G2|IF1_SHEB9 RecName: Full=Translation initiation factor IF-1
 gi|24348674|gb|AAN55654.1|AE015704_5 translation initiation factor IF-1 [Shewanella oneidensis MR-1]
 gi|113884673|gb|ABI38725.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella sp.
           MR-4]
 gi|113888666|gb|ABI42717.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella sp.
           MR-7]
 gi|117612533|gb|ABK47987.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella sp.
           ANA-3]
 gi|120558692|gb|ABM24619.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella sp.
           W3-18-1]
 gi|125997889|gb|ABN61964.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           baltica OS155]
 gi|145565012|gb|ABP75947.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           putrefaciens CN-32]
 gi|151365601|gb|ABS08601.1| translation initiation factor IF-1 [Shewanella baltica OS185]
 gi|160861218|gb|ABX49752.1| translation initiation factor IF-1 [Shewanella baltica OS195]
 gi|217498192|gb|ACK46385.1| translation initiation factor IF-1 [Shewanella baltica OS223]
 gi|304352882|gb|EFM17279.1| translation initiation factor IF-1 [Shewanella baltica OS183]
 gi|306913424|gb|EFN43846.1| translation initiation factor IF-1 [Shewanella baltica BA175]
 gi|315267885|gb|ADT94738.1| translation initiation factor IF-1 [Shewanella baltica OS678]
 gi|319426622|gb|ADV54696.1| translation initiation factor IF-1 [Shewanella putrefaciens 200]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVQLTPYDLTKGRIVFRAR 72


>gi|59712371|ref|YP_205147.1| translation initiation factor IF-1 [Vibrio fischeri ES114]
 gi|197335883|ref|YP_002156586.1| translation initiation factor IF-1 [Vibrio fischeri MJ11]
 gi|209695652|ref|YP_002263581.1| translation initiation factor IF-1 [Aliivibrio salmonicida LFI1238]
 gi|73920052|sp|Q5E3Y7|IF1_VIBF1 RecName: Full=Translation initiation factor IF-1
 gi|59480472|gb|AAW86259.1| translation initiation factor IF-1 [Vibrio fischeri ES114]
 gi|197317373|gb|ACH66820.1| translation initiation factor IF-1 [Vibrio fischeri MJ11]
 gi|208009604|emb|CAQ79900.1| translation initiation factor IF-1 [Aliivibrio salmonicida LFI1238]
          Length = 72

 Score =  113 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDAIELQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|256822680|ref|YP_003146643.1| translation initiation factor IF-1 [Kangiella koreensis DSM 16069]
 gi|256796219|gb|ACV26875.1| translation initiation factor IF-1 [Kangiella koreensis DSM 16069]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDVIELEGKVLETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GD V V ++PYD+++ RIT+R +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDTVTVEISPYDLSKGRITFRAR 72


>gi|160941046|ref|ZP_02088384.1| hypothetical protein CLOBOL_05939 [Clostridium bolteae ATCC
           BAA-613]
 gi|158435995|gb|EDP13762.1| hypothetical protein CLOBOL_05939 [Clostridium bolteae ATCC
           BAA-613]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVIEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|332886317|gb|EGK06561.1| translation initiation factor IF-1 [Dysgonomonas mossii DSM 22836]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+T+ RI++R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLTKGRISFRYK 72


>gi|189501189|ref|YP_001960659.1| translation initiation factor IF-1 [Chlorobium phaeobacteroides
           BS1]
 gi|189496630|gb|ACE05178.1| translation initiation factor IF-1 [Chlorobium phaeobacteroides
           BS1]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPNA F+VKL                                  
Sbjct: 1   MAKEDSIEVEGEILEALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R + IRI  GDKVKV ++PYD+T+ RITYR+K
Sbjct: 27  ----ENGLEILAHVSGKIRMYYIRILPGDKVKVQISPYDLTKGRITYRYK 72


>gi|296532751|ref|ZP_06895432.1| translation initiation factor IF-1 [Roseomonas cervicalis ATCC
           49957]
 gi|296266913|gb|EFH12857.1| translation initiation factor IF-1 [Roseomonas cervicalis ATCC
           49957]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EFSG V ELLPNA FRVKL                                  
Sbjct: 1   MSKEDMIEFSGQVVELLPNAMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NEHMVLAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|54308346|ref|YP_129366.1| putative initiation factor IF-1 [Photobacterium profundum SS9]
 gi|59798038|sp|Q6LT12|IF1_PHOPR RecName: Full=Translation initiation factor IF-1
 gi|46912774|emb|CAG19564.1| putative initiation factor IF-1 [Photobacterium profundum SS9]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVQDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRAR 72


>gi|224437304|ref|ZP_03658276.1| translation initiation factor IF-1 [Helicobacter cinaedi CCUG
           18818]
 gi|313143759|ref|ZP_07805952.1| translation initiation factor IF-1 [Helicobacter cinaedi CCUG
           18818]
 gi|313128790|gb|EFR46407.1| translation initiation factor IF-1 [Helicobacter cinaedi CCUG
           18818]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGKVIEALPNATFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + AG+MR H I+I  GD VK+ + PY + + RITYR+K
Sbjct: 27  ----ENGHIVLCHIAGKMRMHYIKILPGDAVKIELTPYSLDKGRITYRYK 72


>gi|221632956|ref|YP_002522179.1| translation initiation factor IF-1 [Thermomicrobium roseum DSM
           5159]
 gi|221157193|gb|ACM06320.1| translation initiation factor IF-1 [Thermomicrobium roseum DSM
           5159]
          Length = 81

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK++ +E  G V+E LPNA FRV+L                                  
Sbjct: 1   MPKKDVIEVEGTVTEALPNAMFRVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +GR+R H IRI  GD+V+V ++PYD+TR RITYR +
Sbjct: 28  -----NGYEVLAHVSGRLRMHFIRILPGDRVRVELSPYDLTRGRITYRLR 72


>gi|302388064|ref|YP_003823886.1| translation initiation factor IF-1 [Clostridium saccharolyticum
           WM1]
 gi|302198692|gb|ADL06263.1| translation initiation factor IF-1 [Clostridium saccharolyticum
           WM1]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIEMSPYDLSKGRIIWRDK 72


>gi|262041014|ref|ZP_06014235.1| translation initiation factor IF-1 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041649|gb|EEW42699.1| translation initiation factor IF-1 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVAVELTPYDLSKGRIVFRSR 72


>gi|255324775|ref|ZP_05365889.1| translation initiation factor IF-1 [Corynebacterium
           tuberculostearicum SK141]
 gi|311740034|ref|ZP_07713868.1| translation initiation factor IF-1 [Corynebacterium
           pseudogenitalium ATCC 33035]
 gi|255298250|gb|EET77553.1| translation initiation factor IF-1 [Corynebacterium
           tuberculostearicum SK141]
 gi|311305107|gb|EFQ81176.1| translation initiation factor IF-1 [Corynebacterium
           pseudogenitalium ATCC 33035]
          Length = 87

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 16  MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 42

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 43  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 87


>gi|323143531|ref|ZP_08078210.1| translation initiation factor IF-1 [Succinatimonas hippei YIT
           12066]
 gi|322416692|gb|EFY07347.1| translation initiation factor IF-1 [Succinatimonas hippei YIT
           12066]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEESIEMQGTVLETLPNTTFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G+MRK+ IRI  GDKV V + PYD+T+ RIT+R +
Sbjct: 27  ----ENGHIVMAHISGKMRKNYIRILTGDKVTVQITPYDLTKGRITFRAR 72


>gi|309777154|ref|ZP_07672117.1| translation initiation factor IF-1 [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308915024|gb|EFP60801.1| translation initiation factor IF-1 [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G+V + LPNA F+VKL                                  
Sbjct: 1   MGKQDVIEIDGVVVDTLPNAMFKVKLA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 28  -----NGHEILAHVSGKIRMHYIRILPGDRVTVEISPYDLTRGRITFRHK 72


>gi|221134867|ref|ZP_03561170.1| translation initiation factor IF-1 [Glaciecola sp. HTCC2999]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEITPYDLSKGRIIYRAR 72


>gi|29348114|ref|NP_811617.1| translation initiation factor IF-1 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|53715444|ref|YP_101436.1| translation initiation factor IF-1 [Bacteroides fragilis YCH46]
 gi|60683416|ref|YP_213560.1| translation initiation factor IF-1 [Bacteroides fragilis NCTC 9343]
 gi|153805979|ref|ZP_01958647.1| hypothetical protein BACCAC_00224 [Bacteroides caccae ATCC 43185]
 gi|160883042|ref|ZP_02064045.1| hypothetical protein BACOVA_01005 [Bacteroides ovatus ATCC 8483]
 gi|160888376|ref|ZP_02069379.1| hypothetical protein BACUNI_00789 [Bacteroides uniformis ATCC 8492]
 gi|167764350|ref|ZP_02436475.1| hypothetical protein BACSTE_02734 [Bacteroides stercoris ATCC
           43183]
 gi|189460706|ref|ZP_03009491.1| hypothetical protein BACCOP_01353 [Bacteroides coprocola DSM 17136]
 gi|189465440|ref|ZP_03014225.1| hypothetical protein BACINT_01793 [Bacteroides intestinalis DSM
           17393]
 gi|198273981|ref|ZP_03206513.1| hypothetical protein BACPLE_00117 [Bacteroides plebeius DSM 17135]
 gi|212695283|ref|ZP_03303411.1| hypothetical protein BACDOR_04823 [Bacteroides dorei DSM 17855]
 gi|218131304|ref|ZP_03460108.1| hypothetical protein BACEGG_02915 [Bacteroides eggerthii DSM 20697]
 gi|224023641|ref|ZP_03642007.1| hypothetical protein BACCOPRO_00348 [Bacteroides coprophilus DSM
           18228]
 gi|224537839|ref|ZP_03678378.1| hypothetical protein BACCELL_02726 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|237711695|ref|ZP_04542176.1| translation initiation factor IF-1 [Bacteroides sp. 9_1_42FAA]
 gi|237717421|ref|ZP_04547902.1| translation initiation factor IF-1 [Bacteroides sp. D1]
 gi|237718721|ref|ZP_04549202.1| translation initiation factor IF-1 [Bacteroides sp. 2_2_4]
 gi|237725863|ref|ZP_04556344.1| translation initiation factor IF-1 [Bacteroides sp. D4]
 gi|253566692|ref|ZP_04844145.1| translation initiation factor IF-1 [Bacteroides sp. 3_2_5]
 gi|253569613|ref|ZP_04847023.1| translation initiation factor IF-1 [Bacteroides sp. 1_1_6]
 gi|254881344|ref|ZP_05254054.1| translation initiation factor IF-1 [Bacteroides sp. 4_3_47FAA]
 gi|255011668|ref|ZP_05283794.1| translation initiation factor IF-1 [Bacteroides fragilis 3_1_12]
 gi|255690025|ref|ZP_05413700.1| translation initiation factor IF-1 [Bacteroides finegoldii DSM
           17565]
 gi|260175438|ref|ZP_05761850.1| translation initiation factor IF-1 [Bacteroides sp. D2]
 gi|262406186|ref|ZP_06082736.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_22]
 gi|265753115|ref|ZP_06088684.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_33FAA]
 gi|265767570|ref|ZP_06095236.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_16]
 gi|270294730|ref|ZP_06200931.1| translation initiation factor IF-1 [Bacteroides sp. D20]
 gi|293372097|ref|ZP_06618488.1| translation initiation factor IF-1 [Bacteroides ovatus SD CMC 3f]
 gi|294644080|ref|ZP_06721857.1| translation initiation factor IF-1 [Bacteroides ovatus SD CC 2a]
 gi|294806540|ref|ZP_06765379.1| translation initiation factor IF-1 [Bacteroides xylanisolvens SD CC
           1b]
 gi|298386201|ref|ZP_06995758.1| translation initiation factor IF-1 [Bacteroides sp. 1_1_14]
 gi|298483086|ref|ZP_07001267.1| translation initiation factor IF-1 [Bacteroides sp. D22]
 gi|299144602|ref|ZP_07037670.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_23]
 gi|304360647|ref|YP_003856784.1| translation initiation factor IF-1 [Bacteroides vulgatus ATCC 8482]
 gi|313149504|ref|ZP_07811697.1| translation initiation factor IF-1 [Bacteroides fragilis 3_1_12]
 gi|315923668|ref|ZP_07919908.1| translation initiation factor IF-1 [Bacteroides sp. D2]
 gi|317476334|ref|ZP_07935583.1| translation initiation factor IF-1 [Bacteroides eggerthii
           1_2_48FAA]
 gi|317477729|ref|ZP_07936922.1| translation initiation factor IF-1 [Bacteroides sp. 4_1_36]
 gi|319640346|ref|ZP_07995071.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_40A]
 gi|319900946|ref|YP_004160674.1| bacterial translation initiation factor 1 (bIF-1) [Bacteroides
           helcogenes P 36-108]
 gi|329956725|ref|ZP_08297298.1| translation initiation factor IF-1 [Bacteroides clarus YIT 12056]
 gi|329962289|ref|ZP_08300295.1| translation initiation factor IF-1 [Bacteroides fluxus YIT 12057]
 gi|44888018|sp|Q8A498|IF1_BACTN RecName: Full=Translation initiation factor IF-1
 gi|59797512|sp|Q64NN0|IF1_BACFR RecName: Full=Translation initiation factor IF-1
 gi|73920037|sp|Q5L8D1|IF1_BACFN RecName: Full=Translation initiation factor IF-1
 gi|29340017|gb|AAO77811.1| translation initiation factor IF-1 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|52218309|dbj|BAD50902.1| translation initiation factor IF-1 [Bacteroides fragilis YCH46]
 gi|60494850|emb|CAH09657.1| putative translation initiation factor IF-1 [Bacteroides fragilis
           NCTC 9343]
 gi|149130656|gb|EDM21862.1| hypothetical protein BACCAC_00224 [Bacteroides caccae ATCC 43185]
 gi|156111514|gb|EDO13259.1| hypothetical protein BACOVA_01005 [Bacteroides ovatus ATCC 8483]
 gi|156862053|gb|EDO55484.1| hypothetical protein BACUNI_00789 [Bacteroides uniformis ATCC 8492]
 gi|167697755|gb|EDS14334.1| hypothetical protein BACSTE_02734 [Bacteroides stercoris ATCC
           43183]
 gi|189432665|gb|EDV01650.1| hypothetical protein BACCOP_01353 [Bacteroides coprocola DSM 17136]
 gi|189437714|gb|EDV06699.1| hypothetical protein BACINT_01793 [Bacteroides intestinalis DSM
           17393]
 gi|198273059|gb|EDY97328.1| hypothetical protein BACPLE_00117 [Bacteroides plebeius DSM 17135]
 gi|212662193|gb|EEB22767.1| hypothetical protein BACDOR_04823 [Bacteroides dorei DSM 17855]
 gi|217986521|gb|EEC52857.1| hypothetical protein BACEGG_02915 [Bacteroides eggerthii DSM 20697]
 gi|224016863|gb|EEF74875.1| hypothetical protein BACCOPRO_00348 [Bacteroides coprophilus DSM
           18228]
 gi|224520525|gb|EEF89630.1| hypothetical protein BACCELL_02726 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|229435671|gb|EEO45748.1| translation initiation factor IF-1 [Bacteroides dorei 5_1_36/D4]
 gi|229443404|gb|EEO49195.1| translation initiation factor IF-1 [Bacteroides sp. D1]
 gi|229451853|gb|EEO57644.1| translation initiation factor IF-1 [Bacteroides sp. 2_2_4]
 gi|229454390|gb|EEO60111.1| translation initiation factor IF-1 [Bacteroides sp. 9_1_42FAA]
 gi|251841632|gb|EES69713.1| translation initiation factor IF-1 [Bacteroides sp. 1_1_6]
 gi|251944864|gb|EES85339.1| translation initiation factor IF-1 [Bacteroides sp. 3_2_5]
 gi|254834137|gb|EET14446.1| translation initiation factor IF-1 [Bacteroides sp. 4_3_47FAA]
 gi|260624633|gb|EEX47504.1| translation initiation factor IF-1 [Bacteroides finegoldii DSM
           17565]
 gi|262357061|gb|EEZ06151.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_22]
 gi|263236301|gb|EEZ21796.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_33FAA]
 gi|263252875|gb|EEZ24387.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_16]
 gi|270273977|gb|EFA19838.1| translation initiation factor IF-1 [Bacteroides sp. D20]
 gi|292632889|gb|EFF51476.1| translation initiation factor IF-1 [Bacteroides ovatus SD CMC 3f]
 gi|292640604|gb|EFF58845.1| translation initiation factor IF-1 [Bacteroides ovatus SD CC 2a]
 gi|294446235|gb|EFG14863.1| translation initiation factor IF-1 [Bacteroides xylanisolvens SD CC
           1b]
 gi|295085406|emb|CBK66929.1| bacterial translation initiation factor 1 (bIF-1) [Bacteroides
           xylanisolvens XB1A]
 gi|298261429|gb|EFI04296.1| translation initiation factor IF-1 [Bacteroides sp. 1_1_14]
 gi|298270830|gb|EFI12410.1| translation initiation factor IF-1 [Bacteroides sp. D22]
 gi|298515093|gb|EFI38974.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_23]
 gi|301164901|emb|CBW24462.1| putative translation initiation factor IF-1 [Bacteroides fragilis
           638R]
 gi|313138271|gb|EFR55631.1| translation initiation factor IF-1 [Bacteroides fragilis 3_1_12]
 gi|313697543|gb|EFS34378.1| translation initiation factor IF-1 [Bacteroides sp. D2]
 gi|316906074|gb|EFV27835.1| translation initiation factor IF-1 [Bacteroides sp. 4_1_36]
 gi|316907360|gb|EFV29065.1| translation initiation factor IF-1 [Bacteroides eggerthii
           1_2_48FAA]
 gi|317388121|gb|EFV68975.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_40A]
 gi|319415977|gb|ADV43088.1| bacterial translation initiation factor 1 (bIF-1) [Bacteroides
           helcogenes P 36-108]
 gi|328524097|gb|EGF51173.1| translation initiation factor IF-1 [Bacteroides clarus YIT 12056]
 gi|328530397|gb|EGF57274.1| translation initiation factor IF-1 [Bacteroides fluxus YIT 12057]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIVFRYK 72


>gi|218135257|ref|ZP_03464061.1| hypothetical protein BACPEC_03162 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990642|gb|EEC56653.1| hypothetical protein BACPEC_03162 [Bacteroides pectinophilus ATCC
           43243]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEIEGKVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNFIRILPGDKVTIELSPYDLTKGRIIWRDK 72


>gi|261415798|ref|YP_003249481.1| translation initiation factor IF-1 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261372254|gb|ACX74999.1| translation initiation factor IF-1 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302327859|gb|ADL27060.1| translation initiation factor IF-1 [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE ++  G+V E LPNA FRV+L                                  
Sbjct: 1   MAKEEGIQVEGVVLEALPNAFFRVQLG--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR+H IRI   DKV V ++PYD+ R RITYR+K
Sbjct: 28  -----NGHEILAHVSGKMRRHFIRILPDDKVLVEISPYDLNRGRITYRYK 72


>gi|16126582|ref|NP_421146.1| translation initiation factor IF-1 [Caulobacter crescentus CB15]
 gi|167647547|ref|YP_001685210.1| translation initiation factor IF-1 [Caulobacter sp. K31]
 gi|295690492|ref|YP_003594185.1| translation initiation factor IF-1 [Caulobacter segnis ATCC 21756]
 gi|20138512|sp|Q9A5V4|IF1_CAUCR RecName: Full=Translation initiation factor IF-1
 gi|13423870|gb|AAK24314.1| translation initiation factor IF-1 [Caulobacter crescentus CB15]
 gi|167349977|gb|ABZ72712.1| translation initiation factor IF-1 [Caulobacter sp. K31]
 gi|295432395|gb|ADG11567.1| translation initiation factor IF-1 [Caulobacter segnis ATCC 21756]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G VSELLPNA FRVKL                                  
Sbjct: 1   MAKEELLEFPGTVSELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|330997343|ref|ZP_08321194.1| translation initiation factor IF-1 [Paraprevotella xylaniphila YIT
           11841]
 gi|332882087|ref|ZP_08449722.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|329570717|gb|EGG52433.1| translation initiation factor IF-1 [Paraprevotella xylaniphila YIT
           11841]
 gi|332680011|gb|EGJ52973.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGVIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIVFRYK 72


>gi|270291111|ref|ZP_06197334.1| translation initiation factor IF-1 [Pediococcus acidilactici 7_4]
 gi|304385392|ref|ZP_07367737.1| translation initiation factor IF-1 [Pediococcus acidilactici DSM
           20284]
 gi|270280507|gb|EFA26342.1| translation initiation factor IF-1 [Pediococcus acidilactici 7_4]
 gi|304328599|gb|EFL95820.1| translation initiation factor IF-1 [Pediococcus acidilactici DSM
           20284]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E +PNA F+V+L                                  
Sbjct: 1   MAKDNVIEIEGKVKETMPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H I+I  GD+V V M+PYD+T+ RITYRFK
Sbjct: 27  ----ENGHEILAHVSGKIRMHYIKILPGDRVTVEMSPYDLTKGRITYRFK 72


>gi|15641741|ref|NP_231373.1| translation initiation factor IF-1 [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|27365455|ref|NP_760983.1| translation initiation factor IF-1 [Vibrio vulnificus CMCP6]
 gi|28897790|ref|NP_797395.1| translation initiation factor IF-1 [Vibrio parahaemolyticus RIMD
           2210633]
 gi|37680505|ref|NP_935114.1| translation initiation factor IF-1 [Vibrio vulnificus YJ016]
 gi|84393769|ref|ZP_00992517.1| translation initiation factor IF-1 [Vibrio splendidus 12B01]
 gi|91228217|ref|ZP_01262199.1| translation initiation factor IF-1 [Vibrio alginolyticus 12G01]
 gi|121585859|ref|ZP_01675653.1| initiation factor IF-1 [Vibrio cholerae 2740-80]
 gi|121727937|ref|ZP_01680985.1| initiation factor IF-1 [Vibrio cholerae V52]
 gi|147673089|ref|YP_001217282.1| translation initiation factor IF-1 [Vibrio cholerae O395]
 gi|148977555|ref|ZP_01814134.1| translation initiation factor IF-1 [Vibrionales bacterium SWAT-3]
 gi|153212015|ref|ZP_01947832.1| initiation factor IF-1 [Vibrio cholerae 1587]
 gi|153802171|ref|ZP_01956757.1| initiation factor IF-1 [Vibrio cholerae MZO-3]
 gi|153819074|ref|ZP_01971741.1| initiation factor IF-1 [Vibrio cholerae NCTC 8457]
 gi|153822779|ref|ZP_01975446.1| initiation factor IF-1 [Vibrio cholerae B33]
 gi|153826266|ref|ZP_01978933.1| initiation factor IF-1 [Vibrio cholerae MZO-2]
 gi|153827957|ref|ZP_01980624.1| initiation factor IF-1 [Vibrio cholerae 623-39]
 gi|156973858|ref|YP_001444765.1| translation initiation factor IF-1 [Vibrio harveyi ATCC BAA-1116]
 gi|163802083|ref|ZP_02195979.1| translation initiation factor IF-1 [Vibrio sp. AND4]
 gi|218709069|ref|YP_002416690.1| translation initiation factor IF-1 [Vibrio splendidus LGP32]
 gi|227081885|ref|YP_002810436.1| initiation factor IF-1 [Vibrio cholerae M66-2]
 gi|229508156|ref|ZP_04397661.1| translation initiation factor 1 [Vibrio cholerae BX 330286]
 gi|229511605|ref|ZP_04401084.1| translation initiation factor 1 [Vibrio cholerae B33]
 gi|229515128|ref|ZP_04404588.1| translation initiation factor 1 [Vibrio cholerae TMA 21]
 gi|229518744|ref|ZP_04408187.1| translation initiation factor 1 [Vibrio cholerae RC9]
 gi|229520665|ref|ZP_04410088.1| translation initiation factor 1 [Vibrio cholerae TM 11079-80]
 gi|229523825|ref|ZP_04413230.1| translation initiation factor 1 [Vibrio cholerae bv. albensis
           VL426]
 gi|229529237|ref|ZP_04418627.1| translation initiation factor 1 [Vibrio cholerae 12129(1)]
 gi|229607731|ref|YP_002878379.1| translation initiation factor IF-1 [Vibrio cholerae MJ-1236]
 gi|254224880|ref|ZP_04918495.1| initiation factor IF-1 [Vibrio cholerae V51]
 gi|254285319|ref|ZP_04960284.1| initiation factor IF-1 [Vibrio cholerae AM-19226]
 gi|254848853|ref|ZP_05238203.1| initiation factor IF-1 [Vibrio cholerae MO10]
 gi|255744843|ref|ZP_05418793.1| translation initiation factor 1 [Vibrio cholera CIRS 101]
 gi|260779211|ref|ZP_05888103.1| translation initiation factor 1 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260876953|ref|ZP_05889308.1| translation initiation factor IF-1 [Vibrio parahaemolyticus
           AN-5034]
 gi|260897467|ref|ZP_05905963.1| translation initiation factor IF-1 [Vibrio parahaemolyticus
           Peru-466]
 gi|261211856|ref|ZP_05926143.1| translation initiation factor 1 [Vibrio sp. RC341]
 gi|261252448|ref|ZP_05945021.1| translation initiation factor 1 [Vibrio orientalis CIP 102891]
 gi|262161875|ref|ZP_06030893.1| translation initiation factor 1 [Vibrio cholerae INDRE 91/1]
 gi|262169741|ref|ZP_06037432.1| translation initiation factor 1 [Vibrio cholerae RC27]
 gi|262394726|ref|YP_003286580.1| translation initiation factor 1 [Vibrio sp. Ex25]
 gi|262404149|ref|ZP_06080704.1| translation initiation factor 1 [Vibrio sp. RC586]
 gi|269963096|ref|ZP_06177431.1| translation initiation factor IF-1 [Vibrio harveyi 1DA3]
 gi|269967655|ref|ZP_06181705.1| translation initiation factor IF-1 [Vibrio alginolyticus 40B]
 gi|297579316|ref|ZP_06941244.1| translation initiation factor IF-1 [Vibrio cholerae RC385]
 gi|298498188|ref|ZP_07007995.1| translation initiation factor IF-1 [Vibrio cholerae MAK 757]
 gi|312885228|ref|ZP_07744906.1| translation initiation factor IF-1 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|320155838|ref|YP_004188217.1| translation initiation factor 1 [Vibrio vulnificus MO6-24/O]
 gi|323494222|ref|ZP_08099335.1| translation initiation factor IF-1 [Vibrio brasiliensis LMG 20546]
 gi|323499493|ref|ZP_08104464.1| translation initiation factor IF-1 [Vibrio sinaloensis DSM 21326]
 gi|44888005|sp|Q7MJ42|IF1_VIBVY RecName: Full=Translation initiation factor IF-1
 gi|54037376|sp|P65129|IF1_VIBPA RecName: Full=Translation initiation factor IF-1
 gi|54037377|sp|P65130|IF1_VIBVU RecName: Full=Translation initiation factor IF-1
 gi|54041106|sp|P65128|IF1_VIBCH RecName: Full=Translation initiation factor IF-1
 gi|190359723|sp|A5F7F3|IF1_VIBC3 RecName: Full=Translation initiation factor IF-1
 gi|190359746|sp|A7N1L7|IF1_VIBHB RecName: Full=Translation initiation factor IF-1
 gi|9656258|gb|AAF94887.1| initiation factor IF-1 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|27361603|gb|AAO10510.1| translation initiation factor IF-1 [Vibrio vulnificus CMCP6]
 gi|28806003|dbj|BAC59279.1| initiation factor IF-1 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37199253|dbj|BAC95085.1| translation initiation factor 1 [Vibrio vulnificus YJ016]
 gi|84375631|gb|EAP92530.1| translation initiation factor IF-1 [Vibrio splendidus 12B01]
 gi|91188206|gb|EAS74507.1| translation initiation factor IF-1 [Vibrio alginolyticus 12G01]
 gi|121549997|gb|EAX60015.1| initiation factor IF-1 [Vibrio cholerae 2740-80]
 gi|121629787|gb|EAX62203.1| initiation factor IF-1 [Vibrio cholerae V52]
 gi|124116811|gb|EAY35631.1| initiation factor IF-1 [Vibrio cholerae 1587]
 gi|124122306|gb|EAY41049.1| initiation factor IF-1 [Vibrio cholerae MZO-3]
 gi|125622568|gb|EAZ50887.1| initiation factor IF-1 [Vibrio cholerae V51]
 gi|126510406|gb|EAZ73000.1| initiation factor IF-1 [Vibrio cholerae NCTC 8457]
 gi|126519685|gb|EAZ76908.1| initiation factor IF-1 [Vibrio cholerae B33]
 gi|145963206|gb|EDK28473.1| translation initiation factor IF-1 [Vibrionales bacterium SWAT-3]
 gi|146314972|gb|ABQ19511.1| initiation factor IF-1 [Vibrio cholerae O395]
 gi|148876538|gb|EDL74673.1| initiation factor IF-1 [Vibrio cholerae 623-39]
 gi|149740031|gb|EDM54206.1| initiation factor IF-1 [Vibrio cholerae MZO-2]
 gi|150424591|gb|EDN16527.1| initiation factor IF-1 [Vibrio cholerae AM-19226]
 gi|156525452|gb|ABU70538.1| hypothetical protein VIBHAR_01568 [Vibrio harveyi ATCC BAA-1116]
 gi|159174224|gb|EDP59032.1| translation initiation factor IF-1 [Vibrio sp. AND4]
 gi|218322088|emb|CAV18177.1| Translation initiation factor IF-1 [Vibrio splendidus LGP32]
 gi|227009773|gb|ACP05985.1| initiation factor IF-1 [Vibrio cholerae M66-2]
 gi|227013640|gb|ACP09850.1| initiation factor IF-1 [Vibrio cholerae O395]
 gi|229333011|gb|EEN98497.1| translation initiation factor 1 [Vibrio cholerae 12129(1)]
 gi|229337406|gb|EEO02423.1| translation initiation factor 1 [Vibrio cholerae bv. albensis
           VL426]
 gi|229342220|gb|EEO07215.1| translation initiation factor 1 [Vibrio cholerae TM 11079-80]
 gi|229343433|gb|EEO08408.1| translation initiation factor 1 [Vibrio cholerae RC9]
 gi|229347833|gb|EEO12792.1| translation initiation factor 1 [Vibrio cholerae TMA 21]
 gi|229351570|gb|EEO16511.1| translation initiation factor 1 [Vibrio cholerae B33]
 gi|229355661|gb|EEO20582.1| translation initiation factor 1 [Vibrio cholerae BX 330286]
 gi|229370386|gb|ACQ60809.1| translation initiation factor 1 [Vibrio cholerae MJ-1236]
 gi|254844558|gb|EET22972.1| initiation factor IF-1 [Vibrio cholerae MO10]
 gi|255737314|gb|EET92709.1| translation initiation factor 1 [Vibrio cholera CIRS 101]
 gi|260605375|gb|EEX31670.1| translation initiation factor 1 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260839206|gb|EEX65838.1| translation initiation factor 1 [Vibrio sp. RC341]
 gi|260935839|gb|EEX91828.1| translation initiation factor 1 [Vibrio orientalis CIP 102891]
 gi|262021975|gb|EEY40685.1| translation initiation factor 1 [Vibrio cholerae RC27]
 gi|262028607|gb|EEY47262.1| translation initiation factor 1 [Vibrio cholerae INDRE 91/1]
 gi|262338320|gb|ACY52115.1| translation initiation factor 1 [Vibrio sp. Ex25]
 gi|262349181|gb|EEY98319.1| translation initiation factor 1 [Vibrio sp. RC586]
 gi|269827742|gb|EEZ82026.1| translation initiation factor IF-1 [Vibrio alginolyticus 40B]
 gi|269832060|gb|EEZ86184.1| translation initiation factor IF-1 [Vibrio harveyi 1DA3]
 gi|297536910|gb|EFH75743.1| translation initiation factor IF-1 [Vibrio cholerae RC385]
 gi|297542521|gb|EFH78571.1| translation initiation factor IF-1 [Vibrio cholerae MAK 757]
 gi|308089532|gb|EFO39227.1| translation initiation factor IF-1 [Vibrio parahaemolyticus
           Peru-466]
 gi|308093795|gb|EFO43490.1| translation initiation factor IF-1 [Vibrio parahaemolyticus
           AN-5034]
 gi|309367087|gb|EFP94661.1| translation initiation factor IF-1 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|319931150|gb|ADV86014.1| translation initiation factor 1 [Vibrio vulnificus MO6-24/O]
 gi|323311536|gb|EGA64687.1| translation initiation factor IF-1 [Vibrio brasiliensis LMG 20546]
 gi|323315480|gb|EGA68520.1| translation initiation factor IF-1 [Vibrio sinaloensis DSM 21326]
 gi|327484331|gb|AEA78738.1| Translation initiation factor 1 [Vibrio cholerae LMA3894-4]
 gi|328473234|gb|EGF44082.1| translation initiation factor IF-1 [Vibrio parahaemolyticus 10329]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|160942875|ref|ZP_02090114.1| hypothetical protein FAEPRAM212_00351 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445776|gb|EDP22779.1| hypothetical protein FAEPRAM212_00351 [Faecalibacterium prausnitzii
           M21/2]
          Length = 99

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 27/110 (24%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  GIV E +PNA F+V++++ D ++                           
Sbjct: 17  LSKEDVIEIEGIVREAMPNAIFKVEMLSEDKNTGKL------------------------ 52

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +++A+ +G++R + IRI  GDKV V M+PYD+++ RIT+R K
Sbjct: 53  ---TPSGHILLAHISGKLRTNFIRILPGDKVTVEMSPYDLSKGRITWRSK 99


>gi|152979571|ref|YP_001345200.1| translation initiation factor IF-1 [Actinobacillus succinogenes
           130Z]
 gi|190359559|sp|A6VQL8|IF1_ACTSZ RecName: Full=Translation initiation factor IF-1
 gi|150841294|gb|ABR75265.1| translation initiation factor IF-1 [Actinobacillus succinogenes
           130Z]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MRK+ IRI  GDKV V M PYD+T+ RI +R +
Sbjct: 27  ----ENGHVLTAHISGKMRKNYIRILTGDKVTVEMTPYDLTKGRIIFRAR 72


>gi|293402523|ref|ZP_06646658.1| translation initiation factor IF-1 [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291304037|gb|EFE45291.1| translation initiation factor IF-1 [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPNA F+VKL                                  
Sbjct: 1   MGKQDVIEMDGEVIDTLPNAMFKVKLG--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 28  -----NGHEILAHVSGKIRMHYIRILPGDRVTVEISPYDLTRGRITFRHK 72


>gi|86146452|ref|ZP_01064775.1| translation initiation factor IF-1 [Vibrio sp. MED222]
 gi|85835715|gb|EAQ53850.1| translation initiation factor IF-1 [Vibrio sp. MED222]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNFIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|327402762|ref|YP_004343600.1| translation initiation factor 1 (bIF-1) [Fluviicola taffensis DSM
           16823]
 gi|327318270|gb|AEA42762.1| bacterial translation initiation factor 1 (bIF-1) [Fluviicola
           taffensis DSM 16823]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQASIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR   I+I  GD+VKV M+PYD+T+ RI++R+K
Sbjct: 27  ----ENGHVITAHISGKMRMFYIKILPGDRVKVEMSPYDLTKGRISFRYK 72


>gi|257784940|ref|YP_003180157.1| translation initiation factor IF-1 [Atopobium parvulum DSM 20469]
 gi|257473447|gb|ACV51566.1| translation initiation factor IF-1 [Atopobium parvulum DSM 20469]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MAKQDAIELEGKVLEPLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGKTILCTISGKIRMNYIRILPGDKVVVEISPYDLTRGRITYRYK 72


>gi|325927854|ref|ZP_08189078.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           perforans 91-118]
 gi|325541694|gb|EGD13212.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           perforans 91-118]
          Length = 78

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRVKL                                  
Sbjct: 7   MSKDDSIEFEGSVSETLPNTTFRVKL---------------------------------- 32

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 33  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 78


>gi|118595314|ref|ZP_01552661.1| translation initiation factor IF-1 [Methylophilales bacterium
           HTCC2181]
 gi|118441092|gb|EAV47719.1| translation initiation factor IF-1 [Methylophilales bacterium
           HTCC2181]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEET+E  G + E LPNA F+VKL                                  
Sbjct: 1   MAKEETIEMEGEILENLPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ Y +G+MR + IRI  GDKV V M PYD+T+ARIT+R K
Sbjct: 27  ----ENGHEVLGYISGKMRMNYIRILPGDKVTVEMTPYDLTKARITFRAK 72


>gi|22126684|ref|NP_670107.1| translation initiation factor IF-1 [Yersinia pestis KIM 10]
 gi|37525542|ref|NP_928886.1| translation initiation factor IF-1 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|45441050|ref|NP_992589.1| translation initiation factor IF-1 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|50121577|ref|YP_050744.1| translation initiation factor IF-1 [Pectobacterium atrosepticum
           SCRI1043]
 gi|51595735|ref|YP_069926.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis IP
           32953]
 gi|85059081|ref|YP_454783.1| translation initiation factor IF-1 [Sodalis glossinidius str.
           'morsitans']
 gi|108806657|ref|YP_650573.1| translation initiation factor IF-1 [Yersinia pestis Antiqua]
 gi|108812771|ref|YP_648538.1| translation initiation factor IF-1 [Yersinia pestis Nepal516]
 gi|123441831|ref|YP_001005815.1| translation initiation factor IF-1 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|145599597|ref|YP_001163673.1| translation initiation factor IF-1 [Yersinia pestis Pestoides F]
 gi|146311065|ref|YP_001176139.1| translation initiation factor IF-1 [Enterobacter sp. 638]
 gi|149366627|ref|ZP_01888661.1| translation initiation factor IF-1 [Yersinia pestis CA88-4125]
 gi|153947908|ref|YP_001401569.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis IP
           31758]
 gi|157369918|ref|YP_001477907.1| translation initiation factor IF-1 [Serratia proteamaculans 568]
 gi|162420575|ref|YP_001606107.1| translation initiation factor IF-1 [Yersinia pestis Angola]
 gi|165924757|ref|ZP_02220589.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938959|ref|ZP_02227512.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009923|ref|ZP_02230821.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166211253|ref|ZP_02237288.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|167399980|ref|ZP_02305498.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167419417|ref|ZP_02311170.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167423980|ref|ZP_02315733.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|170024916|ref|YP_001721421.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis
           YPIII]
 gi|186894812|ref|YP_001871924.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis
           PB1/+]
 gi|188534287|ref|YP_001908084.1| translation initiation factor IF-1 [Erwinia tasmaniensis Et1/99]
 gi|218928518|ref|YP_002346393.1| translation initiation factor IF-1 [Yersinia pestis CO92]
 gi|227112010|ref|ZP_03825666.1| translation initiation factor IF-1 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227329567|ref|ZP_03833591.1| translation initiation factor IF-1 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|229841337|ref|ZP_04461496.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229843441|ref|ZP_04463587.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229895814|ref|ZP_04510984.1| translation initiation factor IF-1 [Yersinia pestis Pestoides A]
 gi|229903184|ref|ZP_04518297.1| translation initiation factor IF-1 [Yersinia pestis Nepal516]
 gi|237730848|ref|ZP_04561329.1| translation initiation factor IF-1 [Citrobacter sp. 30_2]
 gi|238749791|ref|ZP_04611296.1| Translation initiation factor IF-1 [Yersinia rohdei ATCC 43380]
 gi|238753483|ref|ZP_04614846.1| Translation initiation factor IF-1 [Yersinia ruckeri ATCC 29473]
 gi|238784509|ref|ZP_04628517.1| Translation initiation factor IF-1 [Yersinia bercovieri ATCC 43970]
 gi|238789629|ref|ZP_04633412.1| Translation initiation factor IF-1 [Yersinia frederiksenii ATCC
           33641]
 gi|238792419|ref|ZP_04636053.1| Translation initiation factor IF-1 [Yersinia intermedia ATCC 29909]
 gi|238795832|ref|ZP_04639345.1| Translation initiation factor IF-1 [Yersinia mollaretii ATCC 43969]
 gi|238920380|ref|YP_002933895.1| translation initiation factor IF-1 [Edwardsiella ictaluri 93-146]
 gi|242239692|ref|YP_002987873.1| translation initiation factor IF-1 [Dickeya dadantii Ech703]
 gi|251789965|ref|YP_003004686.1| translation initiation factor IF-1 [Dickeya zeae Ech1591]
 gi|253688100|ref|YP_003017290.1| translation initiation factor IF-1 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|253990325|ref|YP_003041681.1| translation initiation factor IF-1 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|261339222|ref|ZP_05967080.1| hypothetical protein ENTCAN_05452 [Enterobacter cancerogenus ATCC
           35316]
 gi|261821261|ref|YP_003259367.1| translation initiation factor IF-1 [Pectobacterium wasabiae WPP163]
 gi|269139551|ref|YP_003296252.1| translation initiation factor IF-1 [Edwardsiella tarda EIB202]
 gi|270261167|ref|ZP_06189440.1| translation initiation factor IF-1 [Serratia odorifera 4Rx13]
 gi|270486977|ref|ZP_06204051.1| translation initiation factor IF-1 [Yersinia pestis KIM D27]
 gi|271500835|ref|YP_003333860.1| translation initiation factor IF-1 [Dickeya dadantii Ech586]
 gi|283833824|ref|ZP_06353565.1| translation initiation factor IF-1 [Citrobacter youngae ATCC 29220]
 gi|290473956|ref|YP_003466830.1| protein chain initiation factor IF-1 [Xenorhabdus bovienii SS-2004]
 gi|291616888|ref|YP_003519630.1| InfA [Pantoea ananatis LMG 20103]
 gi|292487810|ref|YP_003530685.1| translation initiation factor IF-1 [Erwinia amylovora CFBP1430]
 gi|292899039|ref|YP_003538408.1| translation initiation factor IF-1 [Erwinia amylovora ATCC 49946]
 gi|293396846|ref|ZP_06641120.1| translation initiation factor IF1 [Serratia odorifera DSM 4582]
 gi|294636951|ref|ZP_06715275.1| translation initiation factor IF-1 [Edwardsiella tarda ATCC 23685]
 gi|296103110|ref|YP_003613256.1| translation initiation factor IF-1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|300716064|ref|YP_003740867.1| hypothetical protein EbC_14850 [Erwinia billingiae Eb661]
 gi|304397053|ref|ZP_07378932.1| translation initiation factor IF-1 [Pantoea sp. aB]
 gi|307130781|ref|YP_003882797.1| translation initiation factor IF-1 [Dickeya dadantii 3937]
 gi|308186238|ref|YP_003930369.1| Translation initiation factor IF-1 [Pantoea vagans C9-1]
 gi|317047540|ref|YP_004115188.1| translation initiation factor IF-1 [Pantoea sp. At-9b]
 gi|317491430|ref|ZP_07949866.1| translation initiation factor IF-1 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|320539588|ref|ZP_08039253.1| translation initiation factor IF-1 [Serratia symbiotica str.
           Tucson]
 gi|322832167|ref|YP_004212194.1| translation initiation factor IF-1 [Rahnella sp. Y9602]
 gi|329298244|ref|ZP_08255580.1| translation initiation factor IF-1 [Plautia stali symbiont]
 gi|332162226|ref|YP_004298803.1| translation initiation factor IF-1 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|54037367|sp|P65115|IF1_YERPE RecName: Full=Translation initiation factor IF-1
 gi|54041100|sp|P65114|IF1_PHOLL RecName: Full=Translation initiation factor IF-1
 gi|59797543|sp|Q6D3U1|IF1_ERWCT RecName: Full=Translation initiation factor IF-1
 gi|59798015|sp|Q66CK8|IF1_YERPS RecName: Full=Translation initiation factor IF-1
 gi|119371119|sp|Q2NTZ7|IF1_SODGM RecName: Full=Translation initiation factor IF-1
 gi|119371142|sp|Q1CA94|IF1_YERPA RecName: Full=Translation initiation factor IF-1
 gi|119371143|sp|Q1CGE2|IF1_YERPN RecName: Full=Translation initiation factor IF-1
 gi|190359640|sp|A4W8Q8|IF1_ENT38 RecName: Full=Translation initiation factor IF-1
 gi|190359689|sp|A8GCD9|IF1_SERP5 RecName: Full=Translation initiation factor IF-1
 gi|190359725|sp|A1JMD0|IF1_YERE8 RecName: Full=Translation initiation factor IF-1
 gi|190359726|sp|A7FJZ1|IF1_YERP3 RecName: Full=Translation initiation factor IF-1
 gi|190359727|sp|A4TN38|IF1_YERPP RecName: Full=Translation initiation factor IF-1
 gi|21959701|gb|AAM86358.1|AE013884_5 protein chain initiation factor IF-1 [Yersinia pestis KIM 10]
 gi|36784970|emb|CAE13888.1| translation initiation factor IF-1 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|45435909|gb|AAS61466.1| translation initiation factor IF-1 [Yersinia pestis biovar Microtus
           str. 91001]
 gi|49612103|emb|CAG75553.1| translation initiation factor IF-1 [Pectobacterium atrosepticum
           SCRI1043]
 gi|51589017|emb|CAH20635.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis IP
           32953]
 gi|84779601|dbj|BAE74378.1| translation initiation factor IF-1 [Sodalis glossinidius str.
           'morsitans']
 gi|108776419|gb|ABG18938.1| bacterial translation initiation factor 1 (bIF-1) [Yersinia pestis
           Nepal516]
 gi|108778570|gb|ABG12628.1| bacterial translation initiation factor 1 (bIF-1) [Yersinia pestis
           Antiqua]
 gi|115347129|emb|CAL20022.1| translation initiation factor IF-1 [Yersinia pestis CO92]
 gi|122088792|emb|CAL11598.1| translation initiation factor IF-1 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|145211293|gb|ABP40700.1| bacterial translation initiation factor 1 (bIF-1) [Yersinia pestis
           Pestoides F]
 gi|145317941|gb|ABP60088.1| bacterial translation initiation factor 1 (bIF-1) [Enterobacter sp.
           638]
 gi|149291001|gb|EDM41076.1| translation initiation factor IF-1 [Yersinia pestis CA88-4125]
 gi|152959403|gb|ABS46864.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis IP
           31758]
 gi|157321682|gb|ABV40779.1| translation initiation factor IF-1 [Serratia proteamaculans 568]
 gi|162353390|gb|ABX87338.1| translation initiation factor IF-1 [Yersinia pestis Angola]
 gi|165913106|gb|EDR31730.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165923817|gb|EDR40949.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991319|gb|EDR43620.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. E1979001]
 gi|166207024|gb|EDR51504.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. B42003004]
 gi|166962158|gb|EDR58179.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167050688|gb|EDR62096.1| translation initiation factor IF-1 [Yersinia pestis biovar Antiqua
           str. UG05-0454]
 gi|167056829|gb|EDR66592.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751450|gb|ACA68968.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis
           YPIII]
 gi|186697838|gb|ACC88467.1| translation initiation factor IF-1 [Yersinia pseudotuberculosis
           PB1/+]
 gi|188029329|emb|CAO97206.1| Translation initiation factor IF-1 [Erwinia tasmaniensis Et1/99]
 gi|226906387|gb|EEH92305.1| translation initiation factor IF-1 [Citrobacter sp. 30_2]
 gi|229678954|gb|EEO75057.1| translation initiation factor IF-1 [Yersinia pestis Nepal516]
 gi|229689788|gb|EEO81849.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229697703|gb|EEO87750.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700737|gb|EEO88766.1| translation initiation factor IF-1 [Yersinia pestis Pestoides A]
 gi|238708436|gb|EEQ00791.1| Translation initiation factor IF-1 [Yersinia ruckeri ATCC 29473]
 gi|238712446|gb|EEQ04659.1| Translation initiation factor IF-1 [Yersinia rohdei ATCC 43380]
 gi|238714572|gb|EEQ06576.1| Translation initiation factor IF-1 [Yersinia bercovieri ATCC 43970]
 gi|238720295|gb|EEQ12098.1| Translation initiation factor IF-1 [Yersinia mollaretii ATCC 43969]
 gi|238722182|gb|EEQ13839.1| Translation initiation factor IF-1 [Yersinia frederiksenii ATCC
           33641]
 gi|238728345|gb|EEQ19865.1| Translation initiation factor IF-1 [Yersinia intermedia ATCC 29909]
 gi|238869949|gb|ACR69660.1| translation initiation factor IF-1, putative [Edwardsiella ictaluri
           93-146]
 gi|242131749|gb|ACS86051.1| translation initiation factor IF-1 [Dickeya dadantii Ech703]
 gi|247538586|gb|ACT07207.1| translation initiation factor IF-1 [Dickeya zeae Ech1591]
 gi|251754678|gb|ACT12754.1| translation initiation factor IF-1 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|253781775|emb|CAQ84938.1| protein chain initiation factor if-1 [Photorhabdus asymbiotica]
 gi|261605274|gb|ACX87760.1| translation initiation factor IF-1 [Pectobacterium wasabiae WPP163]
 gi|267985212|gb|ACY85041.1| translation initiation factor IF-1 [Edwardsiella tarda EIB202]
 gi|270044651|gb|EFA17742.1| translation initiation factor IF-1 [Serratia odorifera 4Rx13]
 gi|270335481|gb|EFA46258.1| translation initiation factor IF-1 [Yersinia pestis KIM D27]
 gi|270344390|gb|ACZ77155.1| translation initiation factor IF-1 [Dickeya dadantii Ech586]
 gi|283478938|emb|CAY74854.1| Translation initiation factor IF-1 [Erwinia pyrifoliae DSM 12163]
 gi|288319073|gb|EFC58011.1| translation initiation factor IF-1 [Enterobacter cancerogenus ATCC
           35316]
 gi|289173263|emb|CBJ80038.1| protein chain initiation factor IF-1 [Xenorhabdus bovienii SS-2004]
 gi|291070492|gb|EFE08601.1| translation initiation factor IF-1 [Citrobacter youngae ATCC 29220]
 gi|291089844|gb|EFE22405.1| translation initiation factor IF-1 [Edwardsiella tarda ATCC 23685]
 gi|291151918|gb|ADD76502.1| InfA [Pantoea ananatis LMG 20103]
 gi|291198887|emb|CBJ45997.1| translation initiation factor IF-1 [Erwinia amylovora ATCC 49946]
 gi|291420317|gb|EFE93572.1| translation initiation factor IF1 [Serratia odorifera DSM 4582]
 gi|291553232|emb|CBA20277.1| Translation initiation factor IF-1 [Erwinia amylovora CFBP1430]
 gi|295057569|gb|ADF62307.1| translation initiation factor IF-1 [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295096408|emb|CBK85498.1| bacterial translation initiation factor 1 (bIF-1) [Enterobacter
           cloacae subsp. cloacae NCTC 9394]
 gi|299061900|emb|CAX59016.1| uncharacterized protein [Erwinia billingiae Eb661]
 gi|304355202|gb|EFM19570.1| translation initiation factor IF-1 [Pantoea sp. aB]
 gi|304559439|gb|ADM42103.1| Translation initiation factor 1 [Edwardsiella tarda FL6-60]
 gi|306528310|gb|ADM98240.1| translation initiation factor IF-1 [Dickeya dadantii 3937]
 gi|308056748|gb|ADO08920.1| Translation initiation factor IF-1 [Pantoea vagans C9-1]
 gi|310767162|gb|ADP12112.1| translation initiation factor IF-1 [Erwinia sp. Ejp617]
 gi|312171928|emb|CBX80185.1| Translation initiation factor IF-1 [Erwinia amylovora ATCC
           BAA-2158]
 gi|316920977|gb|EFV42300.1| translation initiation factor IF-1 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316949157|gb|ADU68632.1| translation initiation factor IF-1 [Pantoea sp. At-9b]
 gi|318606289|emb|CBY27787.1| unnamed protein product [Yersinia enterocolitica subsp. palearctica
           Y11]
 gi|320015775|gb|ADV99346.1| translation initiation factor IF-1 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
 gi|320030347|gb|EFW12361.1| translation initiation factor IF-1 [Serratia symbiotica str.
           Tucson]
 gi|321167368|gb|ADW73067.1| translation initiation factor IF-1 [Rahnella sp. Y9602]
 gi|325666456|gb|ADZ43100.1| translation initiation factor IF-1 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860569|emb|CBX70868.1| translation initiation factor IF-1 [Yersinia enterocolitica W22703]
          Length = 72

 Score =  112 bits (281), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR 72


>gi|332290187|ref|YP_004421039.1| translation initiation factor IF-1 [Gallibacterium anatis UMN179]
 gi|330433083|gb|AEC18142.1| translation initiation factor IF-1 [Gallibacterium anatis UMN179]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRSR 72


>gi|304311208|ref|YP_003810806.1| Translation initiation factor IF-1 [gamma proteobacterium HdN1]
 gi|301796941|emb|CBL45154.1| Translation initiation factor IF-1 [gamma proteobacterium HdN1]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V + LPN  FRV+L                                  
Sbjct: 1   MSKEDSIEMDGTVVDTLPNTTFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV M PYD+T+ RIT+R K
Sbjct: 28  -----NGHVVTAHISGKMRKNYIRILTGDKVKVEMTPYDLTKGRITFRVK 72


>gi|94266332|ref|ZP_01290034.1| Translation initiation factor IF-1 [delta proteobacterium MLMS-1]
 gi|93453086|gb|EAT03565.1| Translation initiation factor IF-1 [delta proteobacterium MLMS-1]
          Length = 75

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +   G + E LPNA FRV+L                                  
Sbjct: 1   MAKEEPITVEGTIIEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+TR R+T+R K
Sbjct: 27  ----ENGHRVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRSK 72


>gi|313891548|ref|ZP_07825158.1| translation initiation factor IF-1 [Dialister microaerophilus UPII
           345-E]
 gi|329121851|ref|ZP_08250466.1| translation initiation factor IF-1 [Dialister micraerophilus DSM
           19965]
 gi|313120007|gb|EFR43189.1| translation initiation factor IF-1 [Dialister microaerophilus UPII
           345-E]
 gi|327467789|gb|EGF13281.1| translation initiation factor IF-1 [Dialister micraerophilus DSM
           19965]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEDVIEVEGKVVEKLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G+MR + IRI  GDKV V +  YD+   RITYR+K
Sbjct: 27  ----ENGHIVLAHISGKMRMNFIRILPGDKVTVELTAYDLDHGRITYRYK 72


>gi|300113230|ref|YP_003759805.1| translation initiation factor IF-1 [Nitrosococcus watsonii C-113]
 gi|299539167|gb|ADJ27484.1| translation initiation factor IF-1 [Nitrosococcus watsonii C-113]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKV V + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDKVTVQLTPYDLSKGRIVYRAR 72


>gi|254419425|ref|ZP_05033149.1| translation initiation factor IF-1 [Brevundimonas sp. BAL3]
 gi|196185602|gb|EDX80578.1| translation initiation factor IF-1 [Brevundimonas sp. BAL3]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G VSELLPNA FRV L                                  
Sbjct: 1   MAKEELLEFPGTVSELLPNATFRVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|163794248|ref|ZP_02188220.1| bacterial protein translation initiation factor 1 (IF-1) [alpha
           proteobacterium BAL199]
 gi|159180416|gb|EDP64937.1| bacterial protein translation initiation factor 1 (IF-1) [alpha
           proteobacterium BAL199]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+ELLPNA FRV L                                  
Sbjct: 1   MSKDDVIELPGTVAELLPNAMFRVHLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+T+G+MRK+RIR+  GD+V V M PYD+T+ RIT+RFK
Sbjct: 28  -----NEHQVLAHTSGKMRKNRIRVLAGDRVNVEMTPYDLTKGRITFRFK 72


>gi|53804145|ref|YP_114228.1| translation initiation factor IF-1 [Methylococcus capsulatus str.
           Bath]
 gi|59798002|sp|Q607H0|IF1_METCA RecName: Full=Translation initiation factor IF-1
 gi|53757906|gb|AAU92197.1| translation initiation factor IF-1 [Methylococcus capsulatus str.
           Bath]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MSKEDHIEMEGKVIETLPNTTFRVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GD+VKV + PYD+++ARIT+R +
Sbjct: 28  -----NGHVVIAHISGKMRKNYIRILTGDRVKVELTPYDLSKARITFRHR 72


>gi|183598328|ref|ZP_02959821.1| hypothetical protein PROSTU_01719 [Providencia stuartii ATCC 25827]
 gi|197284586|ref|YP_002150458.1| translation initiation factor IF-1 [Proteus mirabilis HI4320]
 gi|212709757|ref|ZP_03317885.1| hypothetical protein PROVALCAL_00805 [Providencia alcalifaciens DSM
           30120]
 gi|226330744|ref|ZP_03806262.1| hypothetical protein PROPEN_04664 [Proteus penneri ATCC 35198]
 gi|227356768|ref|ZP_03841153.1| protein-synthesizing GTPase [Proteus mirabilis ATCC 29906]
 gi|268590193|ref|ZP_06124414.1| translation initiation factor IF-1 [Providencia rettgeri DSM 1131]
 gi|188020503|gb|EDU58543.1| hypothetical protein PROSTU_01719 [Providencia stuartii ATCC 25827]
 gi|194682073|emb|CAR41620.1| translation initiation factor IF-1 [Proteus mirabilis HI4320]
 gi|212687568|gb|EEB47096.1| hypothetical protein PROVALCAL_00805 [Providencia alcalifaciens DSM
           30120]
 gi|225201539|gb|EEG83893.1| hypothetical protein PROPEN_04664 [Proteus penneri ATCC 35198]
 gi|227163058|gb|EEI47993.1| protein-synthesizing GTPase [Proteus mirabilis ATCC 29906]
 gi|284007605|emb|CBA73207.1| translation initiation factor IF-1 [Arsenophonus nasoniae]
 gi|291314474|gb|EFE54927.1| translation initiation factor IF-1 [Providencia rettgeri DSM 1131]
          Length = 72

 Score =  112 bits (280), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIIFRSR 72


>gi|315633881|ref|ZP_07889170.1| translation initiation factor IF-1 [Aggregatibacter segnis ATCC
           33393]
 gi|315477131|gb|EFU67874.1| translation initiation factor IF-1 [Aggregatibacter segnis ATCC
           33393]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRSR 72


>gi|310659478|ref|YP_003937199.1| translation initiation factor if-1 [Clostridium sticklandii DSM
           519]
 gi|308826256|emb|CBH22294.1| translation initiation factor IF-1 [Clostridium sticklandii]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + + LPNA F+VKL                                  
Sbjct: 1   MSKKDVIELEGTIIDALPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+ +G++R H IRI  GDKV V ++PYD+T+ RIT+R K
Sbjct: 27  ----ENDHEIIAHISGKLRMHFIRILPGDKVTVELSPYDLTKGRITWRKK 72


>gi|159184358|ref|NP_353563.2| translation initiation factor IF-1 [Agrobacterium tumefaciens str.
           C58]
 gi|159139673|gb|AAK86348.2| translation initiation factor IF-1 [Agrobacterium tumefaciens str.
           C58]
          Length = 99

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF GIV+ELLPNA FRVKL                                  
Sbjct: 28  MTKEEVLEFPGIVTELLPNATFRVKL---------------------------------- 53

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 54  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 99


>gi|117621081|ref|YP_856389.1| translation initiation factor IF-1 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117562488|gb|ABK39436.1| translation initiation factor IF-1 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 79

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 8   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 33

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV VA+ PYD+++ RI +R +
Sbjct: 34  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVALTPYDLSKGRIVFRSR 79


>gi|89073387|ref|ZP_01159911.1| translation initiation factor IF-1 [Photobacterium sp. SKA34]
 gi|90579118|ref|ZP_01234928.1| translation initiation factor IF-1 [Vibrio angustum S14]
 gi|330446452|ref|ZP_08310104.1| translation initiation factor IF-1 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|89050874|gb|EAR56348.1| translation initiation factor IF-1 [Photobacterium sp. SKA34]
 gi|90439951|gb|EAS65132.1| translation initiation factor IF-1 [Vibrio angustum S14]
 gi|328490643|dbj|GAA04601.1| translation initiation factor IF-1 [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E +G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMAGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIVFRAR 72


>gi|172038948|ref|YP_001805449.1| translation initiation factor IF-1 [Cyanothece sp. ATCC 51142]
 gi|171700402|gb|ACB53383.1| translation initiation factor IF-1 [Cyanothece sp. ATCC 51142]
          Length = 81

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V+E LPNA FRV L                                   
Sbjct: 7   SKQDLIEMEGTVTESLPNAMFRVDLD---------------------------------- 32

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   V+A+ +G++R++ I+I  GD+VKV + PYD+T+ RITYR K
Sbjct: 33  ----NGFNVLAHISGKIRRNYIKILPGDRVKVELTPYDLTKGRITYRLK 77


>gi|153854994|ref|ZP_01996207.1| hypothetical protein DORLON_02213 [Dorea longicatena DSM 13814]
 gi|166031635|ref|ZP_02234464.1| hypothetical protein DORFOR_01335 [Dorea formicigenerans ATCC
           27755]
 gi|167759838|ref|ZP_02431965.1| hypothetical protein CLOSCI_02201 [Clostridium scindens ATCC 35704]
 gi|325663038|ref|ZP_08151488.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|331086645|ref|ZP_08335722.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|331091643|ref|ZP_08340477.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|149752491|gb|EDM62422.1| hypothetical protein DORLON_02213 [Dorea longicatena DSM 13814]
 gi|166028612|gb|EDR47369.1| hypothetical protein DORFOR_01335 [Dorea formicigenerans ATCC
           27755]
 gi|167662457|gb|EDS06587.1| hypothetical protein CLOSCI_02201 [Clostridium scindens ATCC 35704]
 gi|325470492|gb|EGC73722.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|330403400|gb|EGG82959.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330409811|gb|EGG89246.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNFIKILPGDKVTLELSPYDLSKGRIIWRDK 72


>gi|258621475|ref|ZP_05716509.1| translation initiation factor IF-1 [Vibrio mimicus VM573]
 gi|262165898|ref|ZP_06033635.1| translation initiation factor 1 [Vibrio mimicus VM223]
 gi|262171259|ref|ZP_06038937.1| translation initiation factor 1 [Vibrio mimicus MB-451]
 gi|258586863|gb|EEW11578.1| translation initiation factor IF-1 [Vibrio mimicus VM573]
 gi|261892335|gb|EEY38321.1| translation initiation factor 1 [Vibrio mimicus MB-451]
 gi|262025614|gb|EEY44282.1| translation initiation factor 1 [Vibrio mimicus VM223]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|229815748|ref|ZP_04446073.1| hypothetical protein COLINT_02798 [Collinsella intestinalis DSM
           13280]
 gi|229808664|gb|EEP44441.1| hypothetical protein COLINT_02798 [Collinsella intestinalis DSM
           13280]
          Length = 75

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KE+ +E  G V+E LPNA FRV+L                                  
Sbjct: 4   LKKEDAIELEGTVTEPLPNAMFRVEL---------------------------------- 29

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 30  ----ENGVSVLCSISGKIRMNYIRILPGDKVTVQLSPYDLTRGRITYRYK 75


>gi|288941989|ref|YP_003444229.1| translation initiation factor IF-1 [Allochromatium vinosum DSM 180]
 gi|288897361|gb|ADC63197.1| translation initiation factor IF-1 [Allochromatium vinosum DSM 180]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V+E LPN  FRV+L                                  
Sbjct: 1   MSKDDVIQMEGTVTETLPNTVFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V A+ +G+MRKH IRI  GDKV V + PYD+T+ RI YR +
Sbjct: 27  ----ENGHTVTAHISGKMRKHYIRILTGDKVTVELTPYDLTKGRIVYRAR 72


>gi|34541519|ref|NP_905998.1| translation initiation factor IF-1 [Porphyromonas gingivalis W83]
 gi|188995710|ref|YP_001929962.1| translation initiation factor IF-1 [Porphyromonas gingivalis ATCC
           33277]
 gi|44888006|sp|Q7MTN5|IF1_PORGI RecName: Full=Translation initiation factor IF-1
 gi|34397836|gb|AAQ66897.1| translation initiation factor IF-1 [Porphyromonas gingivalis W83]
 gi|188595390|dbj|BAG34365.1| translation initiation factor IF-1 [Porphyromonas gingivalis ATCC
           33277]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA F+V+L                                  
Sbjct: 1   MSKQTAIEQDGVILEALSNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI++R+K
Sbjct: 27  ----QNGHVITAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRISFRYK 72


>gi|192360176|ref|YP_001983027.1| translation initiation factor IF-1 [Cellvibrio japonicus Ueda107]
 gi|190686341|gb|ACE84019.1| translation initiation factor IF-1 [Cellvibrio japonicus Ueda107]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +EF G V + LPN  FRVKL                                  
Sbjct: 1   MAKDDCIEFDGEVIDTLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKVKV M PYD+T+ RITYR +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVKVEMTPYDLTKGRITYRAR 72


>gi|227487078|ref|ZP_03917394.1| translation initiation factor IF-1 [Corynebacterium
           glucuronolyticum ATCC 51867]
 gi|227093152|gb|EEI28464.1| translation initiation factor IF-1 [Corynebacterium
           glucuronolyticum ATCC 51867]
          Length = 79

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 8   MAKEGAIEVEGRIVEPLPNAMFRVELD--------------------------------- 34

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 35  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 79


>gi|163816000|ref|ZP_02207370.1| hypothetical protein COPEUT_02180 [Coprococcus eutactus ATCC 27759]
 gi|158448810|gb|EDP25805.1| hypothetical protein COPEUT_02180 [Coprococcus eutactus ATCC 27759]
 gi|295093656|emb|CBK82747.1| translation initiation factor IF-1 [Coprococcus sp. ART55/1]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEVEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNYIKILPGDKVTIELSPYDLTKGRIVWRDK 72


>gi|254495362|ref|ZP_05108286.1| translation initiation factor IF-1 [Polaribacter sp. MED152]
 gi|85819716|gb|EAQ40873.1| translation initiation factor IF-1 [Polaribacter sp. MED152]
          Length = 71

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G ++E L NA FRV+L                                  
Sbjct: 1   MAKQSAIQQDGTITEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +V A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHIVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|312880348|ref|ZP_07740148.1| bacterial translation initiation factor 1 (bIF-1) [Aminomonas
           paucivorans DSM 12260]
 gi|310783639|gb|EFQ24037.1| bacterial translation initiation factor 1 (bIF-1) [Aminomonas
           paucivorans DSM 12260]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVRGKVVEPLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 27  ----ENGHRILAHVSGKMRMHFIRILPGDKVLVQVSPYDLTRGRIVYRYK 72


>gi|56459782|ref|YP_155063.1| translation initiation factor 1 [Idiomarina loihiensis L2TR]
 gi|73920042|sp|Q5R0C5|IF1_IDILO RecName: Full=Translation initiation factor IF-1
 gi|56178792|gb|AAV81514.1| Translation initiation factor 1 [Idiomarina loihiensis L2TR]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GD V V + PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDTVTVQLTPYDLTKGRIVFRAR 72


>gi|89092939|ref|ZP_01165891.1| Translation initiation factor [Oceanospirillum sp. MED92]
 gi|89082964|gb|EAR62184.1| Translation initiation factor [Oceanospirillum sp. MED92]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMEGTVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|313204939|ref|YP_004043596.1| bacterial translation initiation factor 1 (bif-1) [Paludibacter
           propionicigenes WB4]
 gi|312444255|gb|ADQ80611.1| bacterial translation initiation factor 1 (bIF-1) [Paludibacter
           propionicigenes WB4]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQTAIEQDGKIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H I+I  GDKVKV M+PYD+++ RI++R+K
Sbjct: 27  ----ENGHVITAHISGKMRMHYIKILPGDKVKVEMSPYDLSKGRISFRYK 72


>gi|256826595|ref|YP_003150554.1| translation initiation factor 1 [Cryptobacterium curtum DSM 15641]
 gi|256582738|gb|ACU93872.1| bacterial translation initiation factor 1 (bIF-1) [Cryptobacterium
           curtum DSM 15641]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MGKEDVIELGGTVLEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKV V ++ YD+ R RITYRFK
Sbjct: 27  ----ENGHQILAHISGKMRMHYIKILPGDKVTVELSVYDLDRGRITYRFK 72


>gi|19551795|ref|NP_599797.1| translation initiation factor IF-1 [Corynebacterium glutamicum ATCC
           13032]
 gi|62389450|ref|YP_224852.1| translation initiation factor IF-1 [Corynebacterium glutamicum ATCC
           13032]
 gi|145294731|ref|YP_001137552.1| translation initiation factor IF-1 [Corynebacterium glutamicum R]
 gi|227502695|ref|ZP_03932744.1| translation initiation factor IF-1 [Corynebacterium accolens ATCC
           49725]
 gi|227541758|ref|ZP_03971807.1| translation initiation factor IF-1 [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227832269|ref|YP_002833976.1| translation initiation factor IF-1 [Corynebacterium aurimucosum
           ATCC 700975]
 gi|260579210|ref|ZP_05847100.1| translation initiation factor IF-1 [Corynebacterium jeikeium ATCC
           43734]
 gi|262183875|ref|ZP_06043296.1| translation initiation factor IF-1 [Corynebacterium aurimucosum
           ATCC 700975]
 gi|306835266|ref|ZP_07468298.1| translation initiation factor IF-1 [Corynebacterium accolens ATCC
           49726]
 gi|23821720|sp|Q8NSV7|IF1_CORGL RecName: Full=Translation initiation factor IF-1
 gi|119370856|sp|Q4JTB8|IF1_CORJK RecName: Full=Translation initiation factor IF-1
 gi|190359631|sp|A4QBQ3|IF1_CORGB RecName: Full=Translation initiation factor IF-1
 gi|21323325|dbj|BAB97953.1| Translation initiation factor IF-1 [Corynebacterium glutamicum ATCC
           13032]
 gi|41324784|emb|CAF19266.1| TRANSLATION INITIATION FACTOR IF-1 [Corynebacterium glutamicum ATCC
           13032]
 gi|73913587|gb|AAZ91708.1| translation initiation factor IF-1 [Corynebacterium stationis]
 gi|140844651|dbj|BAF53650.1| hypothetical protein [Corynebacterium glutamicum R]
 gi|227076425|gb|EEI14388.1| translation initiation factor IF-1 [Corynebacterium accolens ATCC
           49725]
 gi|227182464|gb|EEI63436.1| translation initiation factor IF-1 [Corynebacterium
           glucuronolyticum ATCC 51866]
 gi|227453285|gb|ACP32038.1| translation initiation factor IF-1 [Corynebacterium aurimucosum
           ATCC 700975]
 gi|258602696|gb|EEW15983.1| translation initiation factor IF-1 [Corynebacterium jeikeium ATCC
           43734]
 gi|304568859|gb|EFM44392.1| translation initiation factor IF-1 [Corynebacterium accolens ATCC
           49726]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRIVEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 72


>gi|157151340|ref|YP_001451213.1| translation initiation factor IF-1 [Streptococcus gordonii str.
           Challis substr. CH1]
 gi|157076134|gb|ABV10817.1| translation initiation factor IF-1 [Streptococcus gordonii str.
           Challis substr. CH1]
          Length = 90

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V + +PNA F V+L                                   
Sbjct: 20  AKDDVIEVEGKVIDTMPNAMFTVEL----------------------------------- 44

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++A  +G++RK+ IRI  GD+V V M+PYD+TR RITYRFK
Sbjct: 45  ---ENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK 90


>gi|118444119|ref|YP_877222.1| translation initiation factor IF-1 [Clostridium novyi NT]
 gi|168187790|ref|ZP_02622425.1| translation initiation factor IF-1 [Clostridium botulinum C str.
           Eklund]
 gi|190359628|sp|A0PXX0|IF1_CLONN RecName: Full=Translation initiation factor IF-1
 gi|118134575|gb|ABK61619.1| translation initiation factor IF-1 [Clostridium novyi NT]
 gi|169294312|gb|EDS76445.1| translation initiation factor IF-1 [Clostridium botulinum C str.
           Eklund]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+++L                                  
Sbjct: 1   MSKDDVIEMQGTVLEALPNAMFQIQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    ++ + +G++R + IRI  GDKV V ++PYD++R RIT+R K
Sbjct: 27  ----ESGQTILGHVSGKLRMNFIRILPGDKVTVELSPYDLSRGRITWRAK 72


>gi|120437153|ref|YP_862839.1| translation initiation factor IF-1 [Gramella forsetii KT0803]
 gi|190359742|sp|A0M577|IF1_GRAFK RecName: Full=Translation initiation factor IF-1
 gi|117579303|emb|CAL67772.1| translation initiation factor IF-1 [Gramella forsetii KT0803]
          Length = 71

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|91793191|ref|YP_562842.1| translation initiation factor IF-1 [Shewanella denitrificans OS217]
 gi|114563424|ref|YP_750937.1| translation initiation factor IF-1 [Shewanella frigidimarina NCIMB
           400]
 gi|119371111|sp|Q12N57|IF1_SHEDO RecName: Full=Translation initiation factor IF-1
 gi|119371112|sp|Q081G6|IF1_SHEFN RecName: Full=Translation initiation factor IF-1
 gi|91715193|gb|ABE55119.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           denitrificans OS217]
 gi|114334717|gb|ABI72099.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           frigidimarina NCIMB 400]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRAR 72


>gi|295425630|ref|ZP_06818317.1| translation initiation factor IF-1 [Lactobacillus amylolyticus DSM
           11664]
 gi|295064646|gb|EFG55567.1| translation initiation factor IF-1 [Lactobacillus amylolyticus DSM
           11664]
          Length = 73

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V + LPNA F+V+L                                  
Sbjct: 1   MAKDGVIEVEGKVVDTLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                + A ++A+ +G++R H IRI  GD+V V ++PYD+T+ RITYRF
Sbjct: 27  ----ENGATILAHVSGKIRMHYIRILPGDRVTVELSPYDLTKGRITYRF 71


>gi|154505146|ref|ZP_02041884.1| hypothetical protein RUMGNA_02659 [Ruminococcus gnavus ATCC 29149]
 gi|153794625|gb|EDN77045.1| hypothetical protein RUMGNA_02659 [Ruminococcus gnavus ATCC 29149]
          Length = 85

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 14  MSKADVIEIEGVVVEKLPNAMFKVEL---------------------------------- 39

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G++R + I+I  GDKV + M+PYD+++ RI +R K
Sbjct: 40  ----ENGHIVLAHISGKLRMNFIKILPGDKVTLEMSPYDLSKGRIVWRDK 85


>gi|289423636|ref|ZP_06425435.1| translation initiation factor IF-1 [Peptostreptococcus anaerobius
           653-L]
 gi|289155886|gb|EFD04552.1| translation initiation factor IF-1 [Peptostreptococcus anaerobius
           653-L]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G VSE LPNA F+VKL                                  
Sbjct: 1   MAKKDVIELEGTVSETLPNAMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R + IRI  GDKV + ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHEVLCHISGKLRMNFIRILEGDKVNIELSPYDLTRGRITWRKK 72


>gi|254468086|ref|ZP_05081492.1| translation initiation factor IF-1 [beta proteobacterium KB13]
 gi|207086896|gb|EDZ64179.1| translation initiation factor IF-1 [beta proteobacterium KB13]
          Length = 72

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPNA F+VKL                                  
Sbjct: 1   MAKEDIIEMQGEILENLPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MR + IRI  GDKV V M PYD+T+ RIT+R K
Sbjct: 27  ----ENGHEVLGFISGKMRMNYIRILPGDKVTVEMTPYDLTKGRITFREK 72


>gi|241664511|ref|YP_002982871.1| translation initiation factor IF-1 [Ralstonia pickettii 12D]
 gi|300702801|ref|YP_003744402.1| translation initiation factor if-1 [Ralstonia solanacearum
           CFBP2957]
 gi|309782855|ref|ZP_07677575.1| translation initiation factor IF-1 [Ralstonia sp. 5_7_47FAA]
 gi|240866538|gb|ACS64199.1| translation initiation factor IF-1 [Ralstonia pickettii 12D]
 gi|299070463|emb|CBJ41758.1| Translation initiation factor IF-1 [Ralstonia solanacearum
           CFBP2957]
 gi|308918279|gb|EFP63956.1| translation initiation factor IF-1 [Ralstonia sp. 5_7_47FAA]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDAIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|38233154|ref|NP_938921.1| translation initiation factor IF-1 [Corynebacterium diphtheriae
           NCTC 13129]
 gi|227505242|ref|ZP_03935291.1| translation initiation factor IF-1 [Corynebacterium striatum ATCC
           6940]
 gi|48428195|sp|P61685|IF1_CORDI RecName: Full=Translation initiation factor IF-1
 gi|38199413|emb|CAE49056.1| translation initiation factor IF-1 [Corynebacterium diphtheriae]
 gi|227198141|gb|EEI78189.1| translation initiation factor IF-1 [Corynebacterium striatum ATCC
           6940]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 72


>gi|288925693|ref|ZP_06419625.1| translation initiation factor IF-1 [Prevotella buccae D17]
 gi|294674749|ref|YP_003575365.1| translation initiation factor IF-1 [Prevotella ruminicola 23]
 gi|315606482|ref|ZP_07881497.1| translation initiation factor IF-1 [Prevotella buccae ATCC 33574]
 gi|317503958|ref|ZP_07961966.1| translation initiation factor IF-1 [Prevotella salivae DSM 15606]
 gi|288337631|gb|EFC75985.1| translation initiation factor IF-1 [Prevotella buccae D17]
 gi|294473082|gb|ADE82471.1| translation initiation factor IF-1 [Prevotella ruminicola 23]
 gi|315251888|gb|EFU31862.1| translation initiation factor IF-1 [Prevotella buccae ATCC 33574]
 gi|315664984|gb|EFV04643.1| translation initiation factor IF-1 [Prevotella salivae DSM 15606]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIVESLSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVQIIAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|210623211|ref|ZP_03293650.1| hypothetical protein CLOHIR_01600 [Clostridium hiranonis DSM 13275]
 gi|210153748|gb|EEA84754.1| hypothetical protein CLOHIR_01600 [Clostridium hiranonis DSM 13275]
          Length = 112

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+VKL                                  
Sbjct: 41  MAKKDVIELEGTVVESLPNAMFKVKL---------------------------------- 66

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 67  ----ENGHEILCHISGKLRMNFIRILEGDKVNVELSPYDLTRGRITWRKK 112


>gi|71902731|ref|YP_279534.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS6180]
 gi|94987697|ref|YP_595798.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS9429]
 gi|94989578|ref|YP_597678.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS10270]
 gi|94991566|ref|YP_599665.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS2096]
 gi|94993466|ref|YP_601564.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS10750]
 gi|195977230|ref|YP_002122474.1| translation initiation factor IF-1 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|251781540|ref|YP_002995841.1| translation initiation factor IF-1 [Streptococcus dysgalactiae
           subsp. equisimilis GGS_124]
 gi|71801826|gb|AAX71179.1| bacterial protein translation initiation factor 1 (IF-1)
           [Streptococcus pyogenes MGAS6180]
 gi|94541205|gb|ABF31254.1| bacterial protein translation initiation factor 1 (IF-1)
           [Streptococcus pyogenes MGAS9429]
 gi|94543086|gb|ABF33134.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Streptococcus pyogenes MGAS10270]
 gi|94545074|gb|ABF35121.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Streptococcus pyogenes MGAS2096]
 gi|94546974|gb|ABF37020.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Streptococcus pyogenes MGAS10750]
 gi|195973935|gb|ACG61461.1| translation initiation factor IF-1 [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|242390168|dbj|BAH80627.1| translation initiation factor 1 [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 90

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E +PNA F V+L                                   
Sbjct: 20  AKEDVIEIEGKVVETMPNAMFTVEL----------------------------------- 44

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++A  +G++RK+ IRI +GD+V V M+PYD+TR RITYRFK
Sbjct: 45  ---ENGHQILATVSGKIRKNYIRILVGDRVTVEMSPYDLTRGRITYRFK 90


>gi|223931042|ref|YP_002586902.1| translational initiation factor 1 [Syntrichia ruralis]
 gi|219562256|gb|ACL27587.1| translational initiation factor 1 [Syntrichia ruralis]
          Length = 78

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  GIV+E LPNA FRV L                                  
Sbjct: 1   MKKQNLIDMEGIVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R++ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCEVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRLR 72


>gi|114800246|ref|YP_760071.1| translation initiation factor IF-1 [Hyphomonas neptunium ATCC
           15444]
 gi|119371069|sp|Q0C2H2|IF1_HYPNA RecName: Full=Translation initiation factor IF-1
 gi|114740420|gb|ABI78545.1| translation initiation factor IF-1 [Hyphomonas neptunium ATCC
           15444]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +EF G V ELLPNA FRVKL                                  
Sbjct: 1   MSKEELIEFEGTVVELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLTGDKVMVEMTPYDLTKGRITYRFK 72


>gi|68249145|ref|YP_248257.1| translation initiation factor IF-1 [Haemophilus influenzae
           86-028NP]
 gi|260580995|ref|ZP_05848818.1| translation initiation factor IF-1 [Haemophilus influenzae RdAW]
 gi|260582748|ref|ZP_05850535.1| translation initiation factor IF-1 [Haemophilus influenzae NT127]
 gi|1573533|gb|AAC22206.1| translation initiation factor 1 (infA) [Haemophilus influenzae Rd
           KW20]
 gi|68057344|gb|AAX87597.1| translation initiation factor IF-1 [Haemophilus influenzae
           86-028NP]
 gi|260092354|gb|EEW76294.1| translation initiation factor IF-1 [Haemophilus influenzae RdAW]
 gi|260094198|gb|EEW78099.1| translation initiation factor IF-1 [Haemophilus influenzae NT127]
          Length = 84

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 13  MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 38

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 39  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRSR 84


>gi|302382820|ref|YP_003818643.1| translation initiation factor IF-1 [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193448|gb|ADL01020.1| translation initiation factor IF-1 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 73

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 58/110 (52%), Gaps = 37/110 (33%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+VSELLPNA FRV L                                  
Sbjct: 1   MAKEELLEFPGVVSELLPNATFRVLLEG-------------------------------- 28

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 29  -----NDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 73


>gi|154494402|ref|ZP_02033722.1| hypothetical protein PARMER_03757 [Parabacteroides merdae ATCC
           43184]
 gi|218262265|ref|ZP_03476788.1| hypothetical protein PRABACTJOHN_02462 [Parabacteroides johnsonii
           DSM 18315]
 gi|154085846|gb|EDN84891.1| hypothetical protein PARMER_03757 [Parabacteroides merdae ATCC
           43184]
 gi|218223488|gb|EEC96138.1| hypothetical protein PRABACTJOHN_02462 [Parabacteroides johnsonii
           DSM 18315]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIAFRYK 72


>gi|281422230|ref|ZP_06253229.1| translation initiation factor IF-1 [Prevotella copri DSM 18205]
 gi|281403735|gb|EFB34415.1| translation initiation factor IF-1 [Prevotella copri DSM 18205]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVDITAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|311748492|ref|ZP_07722277.1| translation initiation factor IF-1 [Algoriphagus sp. PR1]
 gi|126577009|gb|EAZ81257.1| translation initiation factor IF-1 [Algoriphagus sp. PR1]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G + E L NA F+V+L                                  
Sbjct: 1   MAKQTSIEQDGTIIEALSNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR + I+I  GD+VK+ ++PYD+++ RI YR+K
Sbjct: 27  ----ENGHQLIAHISGKMRMNYIKILPGDRVKLELSPYDLSKGRIVYRYK 72


>gi|77360663|ref|YP_340238.1| translation initiation factor IF-1 [Pseudoalteromonas haloplanktis
           TAC125]
 gi|119470165|ref|ZP_01612931.1| translation initiation factor IF-1 [Alteromonadales bacterium TW-7]
 gi|315126400|ref|YP_004068403.1| translation initiation factor IF-1 [Pseudoalteromonas sp. SM9913]
 gi|332535441|ref|ZP_08411226.1| translation initiation factor 1 [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|119371093|sp|Q3IH34|IF1_PSEHT RecName: Full=Translation initiation factor IF-1
 gi|76875574|emb|CAI86795.1| protein chain initiation factor IF-1 [Pseudoalteromonas
           haloplanktis TAC125]
 gi|119446586|gb|EAW27860.1| translation initiation factor IF-1 [Alteromonadales bacterium TW-7]
 gi|315014914|gb|ADT68252.1| translation initiation factor IF-1 [Pseudoalteromonas sp. SM9913]
 gi|332035124|gb|EGI71637.1| translation initiation factor 1 [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVVAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|56708866|ref|YP_164908.1| translation initiation factor IF-1 [Ruegeria pomeroyi DSS-3]
 gi|83949646|ref|ZP_00958379.1| translation initiation factor IF-1 [Roseovarius nubinhibens ISM]
 gi|84499992|ref|ZP_00998258.1| translation initiation factor IF-1 [Oceanicola batsensis HTCC2597]
 gi|85704675|ref|ZP_01035777.1| translation initiation factor [Roseovarius sp. 217]
 gi|110678988|ref|YP_681995.1| translation initiation factor IF-1 [Roseobacter denitrificans OCh
           114]
 gi|149203440|ref|ZP_01880410.1| translation initiation factor IF-1 [Roseovarius sp. TM1035]
 gi|149913554|ref|ZP_01902087.1| translation initiation factor IF-1 [Roseobacter sp. AzwK-3b]
 gi|163734095|ref|ZP_02141536.1| translation initiation factor IF-1 [Roseobacter litoralis Och 149]
 gi|163737331|ref|ZP_02144749.1| translation initiation factor IF-1 [Phaeobacter gallaeciensis
           BS107]
 gi|163742001|ref|ZP_02149390.1| translation initiation factor IF-1 [Phaeobacter gallaeciensis 2.10]
 gi|163747243|ref|ZP_02154598.1| translation initiation factor IF-1 [Oceanibulbus indolifex HEL-45]
 gi|254474498|ref|ZP_05087884.1| translation initiation factor IF-1 [Ruegeria sp. R11]
 gi|254512665|ref|ZP_05124731.1| translation initiation factor IF-1 [Rhodobacteraceae bacterium
           KLH11]
 gi|260431292|ref|ZP_05785263.1| translation initiation factor IF-1 [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|73920047|sp|Q5LLF0|IF1_SILPO RecName: Full=Translation initiation factor IF-1
 gi|119371107|sp|Q169N4|IF1_ROSDO RecName: Full=Translation initiation factor IF-1
 gi|56680551|gb|AAV97216.1| translation initiation factor IF-1 [Ruegeria pomeroyi DSS-3]
 gi|83837545|gb|EAP76841.1| translation initiation factor IF-1 [Roseovarius nubinhibens ISM]
 gi|84391926|gb|EAQ04194.1| translation initiation factor IF-1 [Oceanicola batsensis HTCC2597]
 gi|85671083|gb|EAQ25942.1| translation initiation factor [Roseovarius sp. 217]
 gi|109455104|gb|ABG31309.1| translation initiation factor IF-1 [Roseobacter denitrificans OCh
           114]
 gi|149143273|gb|EDM31312.1| translation initiation factor IF-1 [Roseovarius sp. TM1035]
 gi|149812674|gb|EDM72503.1| translation initiation factor IF-1 [Roseobacter sp. AzwK-3b]
 gi|161379518|gb|EDQ03932.1| translation initiation factor IF-1 [Oceanibulbus indolifex HEL-45]
 gi|161384722|gb|EDQ09102.1| translation initiation factor IF-1 [Phaeobacter gallaeciensis 2.10]
 gi|161389935|gb|EDQ14286.1| translation initiation factor IF-1 [Phaeobacter gallaeciensis
           BS107]
 gi|161392631|gb|EDQ16959.1| translation initiation factor IF-1 [Roseobacter litoralis Och 149]
 gi|214028741|gb|EEB69576.1| translation initiation factor IF-1 [Ruegeria sp. R11]
 gi|221532664|gb|EEE35659.1| translation initiation factor IF-1 [Rhodobacteraceae bacterium
           KLH11]
 gi|260415120|gb|EEX08379.1| translation initiation factor IF-1 [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEDTLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFK 72


>gi|323344658|ref|ZP_08084882.1| translation initiation factor IF-1 [Prevotella oralis ATCC 33269]
 gi|323093928|gb|EFZ36505.1| translation initiation factor IF-1 [Prevotella oralis ATCC 33269]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIIESLSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVQIIAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|157962352|ref|YP_001502386.1| translation initiation factor IF-1 [Shewanella pealeana ATCC
           700345]
 gi|163751224|ref|ZP_02158452.1| translation initiation factor IF-1 [Shewanella benthica KT99]
 gi|167623653|ref|YP_001673947.1| translation initiation factor IF-1 [Shewanella halifaxensis
           HAW-EB4]
 gi|212634696|ref|YP_002311221.1| translation initiation factor IF-1 [Shewanella piezotolerans WP3]
 gi|294140599|ref|YP_003556577.1| translation initiation factor IF-1 [Shewanella violacea DSS12]
 gi|190359694|sp|A8H5L4|IF1_SHEPA RecName: Full=Translation initiation factor IF-1
 gi|157847352|gb|ABV87851.1| translation initiation factor IF-1 [Shewanella pealeana ATCC
           700345]
 gi|161328938|gb|EDQ00012.1| translation initiation factor IF-1 [Shewanella benthica KT99]
 gi|167353675|gb|ABZ76288.1| translation initiation factor IF-1 [Shewanella halifaxensis
           HAW-EB4]
 gi|212556180|gb|ACJ28634.1| Protein chain initiation factor IF-1 [Shewanella piezotolerans WP3]
 gi|293327068|dbj|BAJ01799.1| translation initiation factor IF-1 [Shewanella violacea DSS12]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRSR 72


>gi|77166056|ref|YP_344581.1| translation initiation factor IF-1 [Nitrosococcus oceani ATCC
           19707]
 gi|254436356|ref|ZP_05049862.1| translation initiation factor IF-1 [Nitrosococcus oceani AFC27]
 gi|119371085|sp|Q3J7Z5|IF1_NITOC RecName: Full=Translation initiation factor IF-1
 gi|76884370|gb|ABA59051.1| bacterial translation initiation factor 1 (bIF-1) [Nitrosococcus
           oceani ATCC 19707]
 gi|207088046|gb|EDZ65319.1| translation initiation factor IF-1 [Nitrosococcus oceani AFC27]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MRKH IRI  GDKV V + PYD+++ RI YR +
Sbjct: 27  ----ENGHVITAHISGKMRKHYIRILTGDKVTVQLTPYDLSKGRIVYRAR 72


>gi|282858353|ref|ZP_06267533.1| translation initiation factor IF-1 [Prevotella bivia JCVIHMP010]
 gi|282588801|gb|EFB93926.1| translation initiation factor IF-1 [Prevotella bivia JCVIHMP010]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQTAIEQDGTILEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVEIIAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|78485457|ref|YP_391382.1| translation initiation factor IF-1 [Thiomicrospira crunogena XCL-2]
 gi|119371137|sp|Q31GL5|IF1_THICR RecName: Full=Translation initiation factor IF-1
 gi|78363743|gb|ABB41708.1| bacterial translation initiation factor 1 (bIF-1) [Thiomicrospira
           crunogena XCL-2]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +EF G V E LPN  F+V+L                                  
Sbjct: 1   MSKQDVIEFDGEVIETLPNTMFKVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +GRMRK+ IRI  GDKVKV + PYD+T+ RITYR K
Sbjct: 27  ----ENGHEILAHISGRMRKNYIRILAGDKVKVELTPYDLTKGRITYRGK 72


>gi|160914538|ref|ZP_02076753.1| hypothetical protein EUBDOL_00544 [Eubacterium dolichum DSM 3991]
 gi|158433696|gb|EDP11985.1| hypothetical protein EUBDOL_00544 [Eubacterium dolichum DSM 3991]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G+V + LPNA F+VKL                                  
Sbjct: 1   MGKQDVIEIDGVVEDTLPNAMFKVKLA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 28  -----NGHEILAHVSGKIRMHYIRILPGDRVTVEISPYDLTRGRITFRHK 72


>gi|121594041|ref|YP_985937.1| translation initiation factor IF-1 [Acidovorax sp. JS42]
 gi|222111226|ref|YP_002553490.1| translation initiation factor if-1 [Acidovorax ebreus TPSY]
 gi|190359536|sp|A1W6I6|IF12_ACISJ RecName: Full=Translation initiation factor IF-1 2
 gi|120606121|gb|ABM41861.1| bacterial translation initiation factor 1 (bIF-1) [Acidovorax sp.
           JS42]
 gi|221730670|gb|ACM33490.1| translation initiation factor IF-1 [Acidovorax ebreus TPSY]
          Length = 88

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|114569681|ref|YP_756361.1| translation initiation factor IF-1 [Maricaulis maris MCS10]
 gi|119371075|sp|Q0AQL4|IF1_MARMM RecName: Full=Translation initiation factor IF-1
 gi|114340143|gb|ABI65423.1| bacterial translation initiation factor 1 (bIF-1) [Maricaulis maris
           MCS10]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEELLEFPGEVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|163752896|ref|ZP_02160020.1| translation initiation factor IF-1 [Kordia algicida OT-1]
 gi|163786169|ref|ZP_02180617.1| translation initiation factor IF-1 [Flavobacteriales bacterium
           ALC-1]
 gi|332521610|ref|ZP_08398063.1| translation initiation factor IF-1 [Lacinutrix algicola 5H-3-7-4]
 gi|159878029|gb|EDP72085.1| translation initiation factor IF-1 [Flavobacteriales bacterium
           ALC-1]
 gi|161326628|gb|EDP97953.1| translation initiation factor IF-1 [Kordia algicida OT-1]
 gi|332042699|gb|EGI78899.1| translation initiation factor IF-1 [Lacinutrix algicola 5H-3-7-4]
          Length = 71

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +V A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHIVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|332530059|ref|ZP_08406009.1| translation initiation factor IF-1 [Hylemonella gracilis ATCC
           19624]
 gi|332040532|gb|EGI76908.1| translation initiation factor IF-1 [Hylemonella gracilis ATCC
           19624]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVVENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GDKV V + PYD+TRARI +R K
Sbjct: 27  ----ENGHIVLGHISGKMRMHYIRILPGDKVTVELTPYDLTRARIVFRAK 72


>gi|225873055|ref|YP_002754514.1| translation initiation factor IF-1 [Acidobacterium capsulatum ATCC
           51196]
 gi|225793784|gb|ACO33874.1| translation initiation factor IF-1 [Acidobacterium capsulatum ATCC
           51196]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E    V+E LPNA F+V L                                  
Sbjct: 1   MSKEDAIEVMATVAETLPNAMFKVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +GRMRK+ IRI  GD+V V ++PYD+ R RI YR+K
Sbjct: 27  ----ENGHEVLAHVSGRMRKNFIRILPGDRVAVELSPYDLNRGRIVYRYK 72


>gi|153878428|ref|ZP_02004583.1| translation initiation factor IF-1 [Beggiatoa sp. PS]
 gi|152065108|gb|EDN65417.1| translation initiation factor IF-1 [Beggiatoa sp. PS]
          Length = 87

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE++E  G V E LPN  FRV+L                                  
Sbjct: 15  MPKEESIEMEGKVIETLPNTMFRVQL---------------------------------- 40

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKVKV + PYD+++ RITYR +
Sbjct: 41  ----ENEHVVTAHISGKMRKHYIRILTGDKVKVQITPYDLSKGRITYRAR 86


>gi|127512496|ref|YP_001093693.1| translation initiation factor IF-1 [Shewanella loihica PV-4]
 gi|157375026|ref|YP_001473626.1| translation initiation factor IF-1 [Shewanella sediminis HAW-EB3]
 gi|170727043|ref|YP_001761069.1| translation initiation factor IF-1 [Shewanella woodyi ATCC 51908]
 gi|190359693|sp|A3QD86|IF1_SHELP RecName: Full=Translation initiation factor IF-1
 gi|190359697|sp|A8FUH5|IF1_SHESH RecName: Full=Translation initiation factor IF-1
 gi|126637791|gb|ABO23434.1| bacterial translation initiation factor 1 (bIF-1) [Shewanella
           loihica PV-4]
 gi|157317400|gb|ABV36498.1| translation initiation factor IF-1 [Shewanella sediminis HAW-EB3]
 gi|169812390|gb|ACA86974.1| translation initiation factor IF-1 [Shewanella woodyi ATCC 51908]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRSR 72


>gi|269792770|ref|YP_003317674.1| translation initiation factor IF-1 [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100405|gb|ACZ19392.1| translation initiation factor IF-1 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKDDVIEIKGKVVEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 28  -----NGHKILAHVSGKMRMHFIRILPGDKVLVQISPYDLTRGRIVYRYK 72


>gi|289523345|ref|ZP_06440199.1| translation initiation factor IF-1 [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
 gi|289503037|gb|EFD24201.1| translation initiation factor IF-1 [Anaerobaculum hydrogeniformans
           ATCC BAA-1850]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M +E+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAREDVIELRGTVLEPLPNAMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 27  ----ENGHILLAHVSGKMRMHFIRILPGDKVLVQVSPYDLTRGRIVYRYK 72


>gi|32035637|ref|ZP_00135548.1| COG0361: Translation initiation factor 1 (IF-1) [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208694|ref|YP_001053919.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           L20]
 gi|165976646|ref|YP_001652239.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190150546|ref|YP_001969071.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|240950286|ref|ZP_04754561.1| translation initiation factor IF-1 [Actinobacillus minor NM305]
 gi|257465742|ref|ZP_05630113.1| translation initiation factor IF-1 [Actinobacillus minor 202]
 gi|303250691|ref|ZP_07336888.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303252936|ref|ZP_07339092.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246143|ref|ZP_07528225.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248246|ref|ZP_07530273.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250476|ref|ZP_07532422.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252859|ref|ZP_07534748.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255125|ref|ZP_07536943.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257279|ref|ZP_07539049.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|307259562|ref|ZP_07541287.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|307261702|ref|ZP_07543368.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|307263891|ref|ZP_07545495.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|322513669|ref|ZP_08066765.1| translation initiation factor IF-1 [Actinobacillus ureae ATCC
           25976]
 gi|190359557|sp|A3N1M8|IF1_ACTP2 RecName: Full=Translation initiation factor IF-1
 gi|190359558|sp|B0BQG0|IF1_ACTPJ RecName: Full=Translation initiation factor IF-1
 gi|126097486|gb|ABN74314.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165876747|gb|ABY69795.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189915677|gb|ACE61929.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|240295188|gb|EER45996.1| translation initiation factor IF-1 [Actinobacillus minor NM305]
 gi|257451402|gb|EEV25445.1| translation initiation factor IF-1 [Actinobacillus minor 202]
 gi|302648194|gb|EFL78394.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302650679|gb|EFL80838.1| translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306853078|gb|EFM85301.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306855263|gb|EFM87439.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857498|gb|EFM89608.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859648|gb|EFM91672.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861998|gb|EFM93974.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306864129|gb|EFM96042.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 10 str. D13039]
 gi|306866498|gb|EFM98361.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 11 str. 56153]
 gi|306868520|gb|EFN00331.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 12 str. 1096]
 gi|306870756|gb|EFN02496.1| Translation initiation factor IF-1 [Actinobacillus pleuropneumoniae
           serovar 13 str. N273]
 gi|322120540|gb|EFX92443.1| translation initiation factor IF-1 [Actinobacillus ureae ATCC
           25976]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ARI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKARIIFRAR 72


>gi|237653975|ref|YP_002890289.1| translation initiation factor IF-1 [Thauera sp. MZ1T]
 gi|237625222|gb|ACR01912.1| translation initiation factor IF-1 [Thauera sp. MZ1T]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V+E LPNA FRV+L                                  
Sbjct: 1   MTKEDVIEMQGEVTENLPNATFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGHMVLGHISGKMRMHYIRILPGDKVTVQLTPYDLTKGRIVFRTK 72


>gi|332828208|gb|EGK00920.1| translation initiation factor IF-1 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GD+V+V M+PYD+++ RI++R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDRVRVEMSPYDLSKGRISFRYK 72


>gi|71281895|ref|YP_269477.1| translation initiation factor IF-1 [Colwellia psychrerythraea 34H]
 gi|119370855|sp|Q480P2|IF1_COLP3 RecName: Full=Translation initiation factor IF-1
 gi|71147635|gb|AAZ28108.1| translation initiation factor IF-1 [Colwellia psychrerythraea 34H]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEENIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIIFRAR 72


>gi|308049697|ref|YP_003913263.1| bacterial translation initiation factor 1 (bIF-1) [Ferrimonas
           balearica DSM 9799]
 gi|307631887|gb|ADN76189.1| bacterial translation initiation factor 1 (bIF-1) [Ferrimonas
           balearica DSM 9799]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTVLETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GD V VA+ PYD+T+ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDTVTVALTPYDLTKGRIVFRSR 72


>gi|229825297|ref|ZP_04451366.1| hypothetical protein GCWU000182_00651 [Abiotrophia defectiva ATCC
           49176]
 gi|229790669|gb|EEP26783.1| hypothetical protein GCWU000182_00651 [Abiotrophia defectiva ATCC
           49176]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + LE  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVLEIEGTVIEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + M+PYD+T+ RI +R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNFIRILPGDKVTLEMSPYDLTKGRIIWRDK 72


>gi|261367779|ref|ZP_05980662.1| translation initiation factor IF-1 [Subdoligranulum variabile DSM
           15176]
 gi|282570577|gb|EFB76112.1| translation initiation factor IF-1 [Subdoligranulum variabile DSM
           15176]
          Length = 78

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 32/110 (29%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIV E +PN  F+V+L+  +                              
Sbjct: 1   MSKEDVIEVEGIVREAMPNTVFKVELLNKEGKP--------------------------- 33

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + M+PYD+T+ARIT+R K
Sbjct: 34  -----NGHTVLAHISGKLRTNFIRILPGDKVTMEMSPYDLTKARITWRSK 78


>gi|329889112|ref|ZP_08267455.1| translation initiation factor IF-1 [Brevundimonas diminuta ATCC
           11568]
 gi|328844413|gb|EGF93977.1| translation initiation factor IF-1 [Brevundimonas diminuta ATCC
           11568]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+VSELLPNA FRV L                                  
Sbjct: 1   MAKEELLEFPGVVSELLPNATFRVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|325299110|ref|YP_004259027.1| Translation initiation factor IF-1 [Bacteroides salanitronis DSM
           18170]
 gi|324318663|gb|ADY36554.1| Translation initiation factor IF-1 [Bacteroides salanitronis DSM
           18170]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GI+ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGIIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIVFRYK 72


>gi|167627995|ref|YP_001678495.1| translation initiation factor IF-1 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241668549|ref|ZP_04756127.1| translation initiation factor IF-1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254877084|ref|ZP_05249794.1| translation initiation factor IF-1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|167597996|gb|ABZ87994.1| translation initiation factor IF-1 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254843105|gb|EET21519.1| translation initiation factor IF-1 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGVVLEALPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK 72


>gi|58582175|ref|YP_201191.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188576736|ref|YP_001913665.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188576927|ref|YP_001913856.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|289666024|ref|ZP_06487605.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|325915385|ref|ZP_08177702.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           vesicatoria ATCC 35937]
 gi|58426769|gb|AAW75806.1| initiation factor IF-1 [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188521188|gb|ACD59133.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521379|gb|ACD59324.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|325538432|gb|EGD10111.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 78

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRVKL                                  
Sbjct: 7   MSKDDSIEFEGSVSETLPNTTFRVKL---------------------------------- 32

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 33  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 78


>gi|225574725|ref|ZP_03783335.1| hypothetical protein RUMHYD_02802 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038054|gb|EEG48300.1| hypothetical protein RUMHYD_02802 [Blautia hydrogenotrophica DSM
           10507]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKADVIEVEGTVLEKLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENKHVVLAHISGKLRMNFIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|225010538|ref|ZP_03701009.1| translation initiation factor IF-1 [Flavobacteria bacterium
           MS024-3C]
 gi|225005367|gb|EEG43318.1| translation initiation factor IF-1 [Flavobacteria bacterium
           MS024-3C]
          Length = 71

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GD+VK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDRVKLEMSPYDLTKARITYRY 71


>gi|148244911|ref|YP_001219605.1| translation initiation factor IF-1 [Candidatus Vesicomyosocius
           okutanii HA]
 gi|190359722|sp|A5CW05|IF1_VESOH RecName: Full=Translation initiation factor IF-1
 gi|146326738|dbj|BAF61881.1| translation initiation factor IF-1 [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPN  F V+L                                  
Sbjct: 1   MSKSDYIELEGFVKEKLPNTTFMVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++RKH IRI  GDKV V M PYD+T+ RIT+R K
Sbjct: 27  ----ENGHCILAHISGKIRKHYIRILPGDKVTVEMTPYDLTKGRITFRHK 72


>gi|300728421|ref|ZP_07061783.1| translation initiation factor IF-1 [Prevotella bryantii B14]
 gi|299774340|gb|EFI70970.1| translation initiation factor IF-1 [Prevotella bryantii B14]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTILESLSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVQIVAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|285018230|ref|YP_003375941.1| initiation factor if-1 protein [Xanthomonas albilineans GPE PC73]
 gi|283473448|emb|CBA15953.1| probable initiation factor if-1 protein [Xanthomonas albilineans]
          Length = 72

 Score =  112 bits (279), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRVKL                                  
Sbjct: 1   MSKDDSIEFEGTVSETLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|254362329|ref|ZP_04978441.1| initiation factor IF1 [Mannheimia haemolytica PHL213]
 gi|261493269|ref|ZP_05989796.1| translation initiation factor IF-1 [Mannheimia haemolytica serotype
           A2 str. BOVINE]
 gi|261496488|ref|ZP_05992868.1| translation initiation factor IF-1 [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|153093909|gb|EDN74837.1| initiation factor IF1 [Mannheimia haemolytica PHL213]
 gi|261307691|gb|EEY09014.1| translation initiation factor IF-1 [Mannheimia haemolytica serotype
           A2 str. OVINE]
 gi|261311119|gb|EEY12295.1| translation initiation factor IF-1 [Mannheimia haemolytica serotype
           A2 str. BOVINE]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V M PYD+++ARI +R +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKARIIFRAR 72


>gi|86137055|ref|ZP_01055633.1| translation initiation factor IF-1 [Roseobacter sp. MED193]
 gi|99078530|ref|YP_611788.1| translation initiation factor IF-1 [Ruegeria sp. TM1040]
 gi|126729155|ref|ZP_01744969.1| translation initiation factor IF-1 [Sagittula stellata E-37]
 gi|126738146|ref|ZP_01753867.1| translation initiation factor IF-1 [Roseobacter sp. SK209-2-6]
 gi|254465199|ref|ZP_05078610.1| translation initiation factor IF-1 [Rhodobacterales bacterium Y4I]
 gi|259415534|ref|ZP_05739455.1| translation initiation factor IF-1 [Silicibacter sp. TrichCH4B]
 gi|119371118|sp|Q1GLE0|IF1_SILST RecName: Full=Translation initiation factor IF-1
 gi|85826379|gb|EAQ46576.1| translation initiation factor IF-1 [Roseobacter sp. MED193]
 gi|99035668|gb|ABF62526.1| bacterial translation initiation factor 1 (bIF-1) [Ruegeria sp.
           TM1040]
 gi|126710145|gb|EBA09197.1| translation initiation factor IF-1 [Sagittula stellata E-37]
 gi|126720643|gb|EBA17348.1| translation initiation factor IF-1 [Roseobacter sp. SK209-2-6]
 gi|206686107|gb|EDZ46589.1| translation initiation factor IF-1 [Rhodobacterales bacterium Y4I]
 gi|259348764|gb|EEW60526.1| translation initiation factor IF-1 [Silicibacter sp. TrichCH4B]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEDTLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GD+V+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDRVQVEMTPYDLTKGRINYRFK 72


>gi|260592743|ref|ZP_05858201.1| translation initiation factor IF-1 [Prevotella veroralis F0319]
 gi|288803955|ref|ZP_06409378.1| translation initiation factor IF-1 [Prevotella melaninogenica D18]
 gi|302345096|ref|YP_003813449.1| translation initiation factor IF-1 [Prevotella melaninogenica ATCC
           25845]
 gi|303237492|ref|ZP_07324057.1| translation initiation factor IF-1 [Prevotella disiens FB035-09AN]
 gi|325269513|ref|ZP_08136129.1| translation initiation factor IF-1 [Prevotella multiformis DSM
           16608]
 gi|325856032|ref|ZP_08171921.1| translation initiation factor IF-1 [Prevotella denticola CRIS
           18C-A]
 gi|327313212|ref|YP_004328649.1| translation initiation factor IF-1 [Prevotella denticola F0289]
 gi|260535274|gb|EEX17891.1| translation initiation factor IF-1 [Prevotella veroralis F0319]
 gi|288333588|gb|EFC72040.1| translation initiation factor IF-1 [Prevotella melaninogenica D18]
 gi|302150166|gb|ADK96428.1| translation initiation factor IF-1 [Prevotella melaninogenica ATCC
           25845]
 gi|302482312|gb|EFL45342.1| translation initiation factor IF-1 [Prevotella disiens FB035-09AN]
 gi|324988132|gb|EGC20099.1| translation initiation factor IF-1 [Prevotella multiformis DSM
           16608]
 gi|325483704|gb|EGC86668.1| translation initiation factor IF-1 [Prevotella denticola CRIS
           18C-A]
 gi|326945625|gb|AEA21510.1| translation initiation factor IF-1 [Prevotella denticola F0289]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQTAIEQDGTILEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVDITAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|34501439|ref|NP_904226.1| translation initiation factor 1 [Physcomitrella patens subsp.
           patens]
 gi|68052158|sp|Q6YXL2|IF1C_PHYPA RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|34494809|dbj|BAC85076.1| initiation factor 1 [Physcomitrella patens subsp. patens]
          Length = 78

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G+V+E LPNA FRV L                                  
Sbjct: 1   MKKQNLIDMEGVVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R++ IRI  GD+VKV + PYD+T+ RITYR +
Sbjct: 28  -----NGCEVLTHISGKIRRNYIRILPGDRVKVELTPYDLTKGRITYRLR 72


>gi|32266898|ref|NP_860930.1| translation initiation factor IF-1 [Helicobacter hepaticus ATCC
           51449]
 gi|44888009|sp|Q7VGC3|IF1_HELHP RecName: Full=Translation initiation factor IF-1
 gi|32262950|gb|AAP77996.1| translation initiation factor IF-1 [Helicobacter hepaticus ATCC
           51449]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGKVIEALPNATFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + AG+MR H I+I  GD VK+ + PY + + RITYR K
Sbjct: 27  ----ENGHIVLCHIAGKMRMHYIKILPGDMVKIELTPYSLDKGRITYRHK 72


>gi|84516472|ref|ZP_01003831.1| translation initiation factor IF-1 [Loktanella vestfoldensis SKA53]
 gi|84683714|ref|ZP_01011617.1| translation initiation factor IF-1 [Maritimibacter alkaliphilus
           HTCC2654]
 gi|126735249|ref|ZP_01750995.1| translation initiation factor IF-1 [Roseobacter sp. CCS2]
 gi|159043531|ref|YP_001532325.1| translation initiation factor IF-1 [Dinoroseobacter shibae DFL 12]
 gi|255262794|ref|ZP_05342136.1| translation initiation factor IF-1 [Thalassiobium sp. R2A62]
 gi|190359637|sp|A8LS17|IF1_DINSH RecName: Full=Translation initiation factor IF-1
 gi|84509508|gb|EAQ05966.1| translation initiation factor IF-1 [Loktanella vestfoldensis SKA53]
 gi|84668457|gb|EAQ14924.1| translation initiation factor IF-1 [Rhodobacterales bacterium
           HTCC2654]
 gi|126715804|gb|EBA12669.1| translation initiation factor IF-1 [Roseobacter sp. CCS2]
 gi|157911291|gb|ABV92724.1| translation initiation factor IF-1 [Dinoroseobacter shibae DFL 12]
 gi|255105129|gb|EET47803.1| translation initiation factor IF-1 [Thalassiobium sp. R2A62]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFK 72


>gi|323342811|ref|ZP_08083043.1| translation initiation factor IF-1 [Erysipelothrix rhusiopathiae
           ATCC 19414]
 gi|322463923|gb|EFY09117.1| translation initiation factor IF-1 [Erysipelothrix rhusiopathiae
           ATCC 19414]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G+V + LP A F+V+L                                  
Sbjct: 1   MSKENVIEVDGVVLDTLPGAMFKVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD++R RIT+R K
Sbjct: 28  -----NGHEILAHVSGKIRMHYIRILPGDRVTVEISPYDLSRGRITFRHK 72


>gi|118593153|ref|ZP_01550539.1| translation initiation factor IF-1 [Stappia aggregata IAM 12614]
 gi|254500405|ref|ZP_05112556.1| translation initiation factor IF-1 [Labrenzia alexandrii DFL-11]
 gi|307945967|ref|ZP_07661302.1| translation initiation factor IF-1 [Roseibium sp. TrichSKD4]
 gi|118434238|gb|EAV40893.1| translation initiation factor IF-1 [Stappia aggregata IAM 12614]
 gi|222436476|gb|EEE43155.1| translation initiation factor IF-1 [Labrenzia alexandrii DFL-11]
 gi|307769631|gb|EFO28857.1| translation initiation factor IF-1 [Roseibium sp. TrichSKD4]
          Length = 72

 Score =  111 bits (278), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEALEFPGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|149279642|ref|ZP_01885771.1| translation initiation factor IF-1 [Pedobacter sp. BAL39]
 gi|255530536|ref|YP_003090908.1| translation initiation factor IF-1 [Pedobacter heparinus DSM 2366]
 gi|149229678|gb|EDM35068.1| translation initiation factor IF-1 [Pedobacter sp. BAL39]
 gi|255343520|gb|ACU02846.1| translation initiation factor IF-1 [Pedobacter heparinus DSM 2366]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQASIEQDGVIREALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVK+ M+PYD+++ RITYR+K
Sbjct: 27  ----ENGHEIIAHISGKMRMHYIKILPGDKVKLEMSPYDLSKGRITYRYK 72


>gi|281423817|ref|ZP_06254730.1| translation initiation factor IF-1 [Prevotella oris F0302]
 gi|299141169|ref|ZP_07034306.1| translation initiation factor IF-1 [Prevotella oris C735]
 gi|281402044|gb|EFB32875.1| translation initiation factor IF-1 [Prevotella oris F0302]
 gi|298577129|gb|EFI48998.1| translation initiation factor IF-1 [Prevotella oris C735]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIVESLSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVQIVAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|312130527|ref|YP_003997867.1| bacterial translation initiation factor 1 (bif-1) [Leadbetterella
           byssophila DSM 17132]
 gi|311907073|gb|ADQ17514.1| bacterial translation initiation factor 1 (bIF-1) [Leadbetterella
           byssophila DSM 17132]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA F+V+L                                  
Sbjct: 1   MAKQSNIEVDGVILEALSNAMFKVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR + IRI  GDKVK+ M+PYD+++ARITYR+K
Sbjct: 28  -----NKHEVIAHISGKMRMNYIRILPGDKVKLEMSPYDLSKARITYRYK 72


>gi|298345439|ref|YP_003718126.1| translation initiation factor IF-1 [Mobiluncus curtisii ATCC 43063]
 gi|304390995|ref|ZP_07372947.1| translation initiation factor IF-1 [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315655845|ref|ZP_07908743.1| translation initiation factor IF-1 [Mobiluncus curtisii ATCC 51333]
 gi|315656229|ref|ZP_07909120.1| translation initiation factor IF-1 [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
 gi|298235500|gb|ADI66632.1| translation initiation factor IF-1 [Mobiluncus curtisii ATCC 43063]
 gi|304325878|gb|EFL93124.1| translation initiation factor IF-1 [Mobiluncus curtisii subsp.
           curtisii ATCC 35241]
 gi|315489909|gb|EFU79536.1| translation initiation factor IF-1 [Mobiluncus curtisii ATCC 51333]
 gi|315493231|gb|EFU82831.1| translation initiation factor IF-1 [Mobiluncus curtisii subsp.
           holmesii ATCC 35242]
          Length = 86

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K+  +E  G V E LPNA FRV+L                                    
Sbjct: 17  KDGVIEVEGTVVEALPNAMFRVQLA----------------------------------- 41

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +  VV+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 42  ---NEHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 86


>gi|221195511|ref|ZP_03568566.1| translation initiation factor IF-1 [Atopobium rimae ATCC 49626]
 gi|221184698|gb|EEE17090.1| translation initiation factor IF-1 [Atopobium rimae ATCC 49626]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKQDAIELEGKVLEPLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGKTILCTISGKIRMNYIRILPGDKVVVEISPYDLTRGRITYRYK 72


>gi|154250982|ref|YP_001411806.1| translation initiation factor IF-1 [Parvibaculum lavamentivorans
           DS-1]
 gi|190359663|sp|A7HQG6|IF1_PARL1 RecName: Full=Translation initiation factor IF-1
 gi|154154932|gb|ABS62149.1| translation initiation factor IF-1 [Parvibaculum lavamentivorans
           DS-1]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MSKEELLEFPGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|302669984|ref|YP_003829944.1| translation initiation factor IF-1 InfA [Butyrivibrio
           proteoclasticus B316]
 gi|302394457|gb|ADL33362.1| translation initiation factor IF-1 InfA [Butyrivibrio
           proteoclasticus B316]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPN  F+V+L                                  
Sbjct: 1   MSKADVIEIEGKVIEKLPNTMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R++ IRI  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHVVLAHISGKLRQNFIRILPGDKVTLELSPYDLTKGRIIWRDK 72


>gi|262274509|ref|ZP_06052320.1| translation initiation factor IF-1 [Grimontia hollisae CIP 101886]
 gi|262221072|gb|EEY72386.1| translation initiation factor IF-1 [Grimontia hollisae CIP 101886]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIELQGVVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRAR 72


>gi|297569400|ref|YP_003690744.1| translation initiation factor IF-1 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925315|gb|ADH86125.1| translation initiation factor IF-1 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 75

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +   G + E LPNA FRV+L                                  
Sbjct: 1   MSKEEPITVEGTIIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR H I+I  GD+V V ++PYD+TR R+T+R K
Sbjct: 28  -----NGHRVLAHISGKMRMHFIKILPGDRVTVELSPYDLTRGRVTFRSK 72


>gi|223983943|ref|ZP_03634103.1| hypothetical protein HOLDEFILI_01384 [Holdemania filiformis DSM
           12042]
 gi|223964135|gb|EEF68487.1| hypothetical protein HOLDEFILI_01384 [Holdemania filiformis DSM
           12042]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV + LPNA F+VKL                                  
Sbjct: 1   MGKQDVIEIDGIVEDTLPNAMFKVKLA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 28  -----NGHTILAHVSGKIRMHYIRILPGDRVTVEISPYDLTRGRITFRHK 72


>gi|68536852|ref|YP_251557.1| translation initiation factor IF-1 [Corynebacterium jeikeium K411]
 gi|68264451|emb|CAI37939.1| translation initiation factor IF-1 [Corynebacterium jeikeium K411]
          Length = 75

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 4   MAKEGAIEVEGRIVEPLPNAMFRVELD--------------------------------- 30

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 31  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 75


>gi|221235364|ref|YP_002517801.1| translation initiation factor IF-1 [Caulobacter crescentus NA1000]
 gi|220964537|gb|ACL95893.1| bacterial protein translation initiation factor 1 (IF-1)
           [Caulobacter crescentus NA1000]
          Length = 76

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G VSELLPNA FRVKL                                  
Sbjct: 5   MAKEELLEFPGTVSELLPNATFRVKL---------------------------------- 30

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 31  ----ENDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 76


>gi|83748170|ref|ZP_00945197.1| Bacterial Protein Translation Initiation Factor 1 (IF-1) [Ralstonia
           solanacearum UW551]
 gi|187930343|ref|YP_001900830.1| translation initiation factor IF-1 [Ralstonia pickettii 12J]
 gi|300690181|ref|YP_003751176.1| translation initiation factor IF-1 [Ralstonia solanacearum PSI07]
 gi|83725138|gb|EAP72289.1| Bacterial Protein Translation Initiation Factor 1 (IF-1) [Ralstonia
           solanacearum UW551]
 gi|187727233|gb|ACD28398.1| translation initiation factor IF-1 [Ralstonia pickettii 12J]
 gi|299077241|emb|CBJ49867.1| Translation initiation factor IF-1 [Ralstonia solanacearum PSI07]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|88860138|ref|ZP_01134777.1| translation initiation factor IF-1 [Pseudoalteromonas tunicata D2]
 gi|88818132|gb|EAR27948.1| translation initiation factor IF-1 [Pseudoalteromonas tunicata D2]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTILDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|88803729|ref|ZP_01119253.1| translation initiation factor IF-1 [Polaribacter irgensii 23-P]
 gi|88780462|gb|EAR11643.1| translation initiation factor IF-1 [Polaribacter irgensii 23-P]
          Length = 71

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G ++E L NA FRV+L                                  
Sbjct: 1   MAKQSAIQQDGTITEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +V A+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHIVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|118497438|ref|YP_898488.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           novicida U112]
 gi|254372799|ref|ZP_04988288.1| protein-synthesizing GTPase [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374259|ref|ZP_04989741.1| hypothetical protein FTDG_00424 [Francisella novicida GA99-3548]
 gi|190359699|sp|A0Q669|IF1_FRATN RecName: Full=Translation initiation factor IF-1
 gi|118423344|gb|ABK89734.1| translation initiation factor IF-1 [Francisella novicida U112]
 gi|151570526|gb|EDN36180.1| protein-synthesizing GTPase [Francisella novicida GA99-3549]
 gi|151571979|gb|EDN37633.1| hypothetical protein FTDG_00424 [Francisella novicida GA99-3548]
 gi|328676933|gb|AEB27803.1| Translation initiation factor 1 [Francisella cf. novicida Fx1]
 gi|332183989|gb|AEE26243.1| Translation initiation factor 1 [Francisella cf. novicida 3523]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGVVLEALPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK 72


>gi|227538696|ref|ZP_03968745.1| initiation factor IF1 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300770229|ref|ZP_07080108.1| translation initiation factor IF-1 [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|227241615|gb|EEI91630.1| initiation factor IF1 [Sphingobacterium spiritivorum ATCC 33300]
 gi|300762705|gb|EFK59522.1| translation initiation factor IF-1 [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  GI+ E L NA FRV+L                                  
Sbjct: 1   MAKQASIEQDGIIREALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVK+ M+PYD+T+ RITYR+K
Sbjct: 27  ----ENGHEIIAHISGKMRMHYIKILPGDKVKLEMSPYDLTKGRITYRYK 72


>gi|154483165|ref|ZP_02025613.1| hypothetical protein EUBVEN_00866 [Eubacterium ventriosum ATCC
           27560]
 gi|149735973|gb|EDM51859.1| hypothetical protein EUBVEN_00866 [Eubacterium ventriosum ATCC
           27560]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA FRV+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G++R + I+I  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHIVLAHISGKLRMNYIKILPGDKVTIEMSPYDLSKGRIIWRDK 72


>gi|17547717|ref|NP_521119.1| translation initiation factor IF-1 [Ralstonia solanacearum GMI1000]
 gi|20138608|sp|Q8XV33|IF11_RALSO RecName: Full=Translation initiation factor IF-1 1
 gi|17430022|emb|CAD16707.1| probable translation initiation factor if-1 1 protein [Ralstonia
           solanacearum GMI1000]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVQENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|315122074|ref|YP_004062563.1| translation initiation factor IF-1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495476|gb|ADR52075.1| translation initiation factor IF-1 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 119

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 68/119 (57%), Positives = 85/119 (71%), Gaps = 9/119 (7%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSS---------ADCKLDSKVKSNFSESG 51
           M KEE LEFS +VSELLPNANFRV+LI  +D+SS         +D   DS   S+   SG
Sbjct: 1   MAKEEILEFSAVVSELLPNANFRVQLIALEDNSSYCKSDSDSDSDSDSDSDSDSDLKSSG 60

Query: 52  SESGNDGVDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
           S+  +  +D IS +  + VIAYT+GRMRKHRIRIS+GD+VK+ ++P DMTRARITYRFK
Sbjct: 61  SKLNSKDIDFISLIGKSKVIAYTSGRMRKHRIRISVGDRVKLEISPCDMTRARITYRFK 119


>gi|86141161|ref|ZP_01059707.1| translation initiation factor IF-1 [Leeuwenhoekiella blandensis
           MED217]
 gi|85831720|gb|EAQ50175.1| translation initiation factor IF-1 [Leeuwenhoekiella blandensis
           MED217]
          Length = 71

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQQAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +V A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHIVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|319944774|ref|ZP_08019038.1| translation initiation factor IF-1 [Lautropia mirabilis ATCC 51599]
 gi|319742023|gb|EFV94446.1| translation initiation factor IF-1 [Lautropia mirabilis ATCC 51599]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|319762543|ref|YP_004126480.1| translation initiation factor if-1 [Alicycliphilus denitrificans
           BC]
 gi|330824560|ref|YP_004387863.1| translation initiation factor IF-1 [Alicycliphilus denitrificans
           K601]
 gi|317117104|gb|ADU99592.1| translation initiation factor IF-1 [Alicycliphilus denitrificans
           BC]
 gi|329309932|gb|AEB84347.1| translation initiation factor IF-1 [Alicycliphilus denitrificans
           K601]
          Length = 86

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|261867557|ref|YP_003255479.1| translation initiation factor IF-1 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|293391435|ref|ZP_06635769.1| translation initiation factor IF-1 [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|261412889|gb|ACX82260.1| translation initiation factor IF-1 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|290951969|gb|EFE02088.1| translation initiation factor IF-1 [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MSKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIIFRSR 72


>gi|213962764|ref|ZP_03391024.1| translation initiation factor IF-1 [Capnocytophaga sputigena Capno]
 gi|256820003|ref|YP_003141282.1| translation initiation factor IF-1 [Capnocytophaga ochracea DSM
           7271]
 gi|315225422|ref|ZP_07867236.1| translation initiation factor IF-1 [Capnocytophaga ochracea F0287]
 gi|332881077|ref|ZP_08448745.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           329 str. F0087]
 gi|213954421|gb|EEB65743.1| translation initiation factor IF-1 [Capnocytophaga sputigena Capno]
 gi|256581586|gb|ACU92721.1| translation initiation factor IF-1 [Capnocytophaga ochracea DSM
           7271]
 gi|314944695|gb|EFS96730.1| translation initiation factor IF-1 [Capnocytophaga ochracea F0287]
 gi|332680989|gb|EGJ53918.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           329 str. F0087]
          Length = 71

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIVEALSNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VVIA+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 28  -----NGHVVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|238025953|ref|YP_002910184.1| translation initiation factor IF-1 [Burkholderia glumae BGR1]
 gi|330815270|ref|YP_004358975.1| Translation initiation factor IF-1 [Burkholderia gladioli BSR3]
 gi|237875147|gb|ACR27480.1| Translation initiation factor IF-1 [Burkholderia glumae BGR1]
 gi|299065436|emb|CBJ36605.1| Translation initiation factor IF-1 [Ralstonia solanacearum CMR15]
 gi|327367663|gb|AEA59019.1| Translation initiation factor IF-1 [Burkholderia gladioli BSR3]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVVENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|24380347|ref|NP_722302.1| translation initiation factor IF-1 [Streptococcus mutans UA159]
 gi|290581267|ref|YP_003485659.1| putative translation initiation factor IF-1 [Streptococcus mutans
           NN2025]
 gi|29427451|sp|Q8DS34|IF1_STRMU RecName: Full=Translation initiation factor IF-1
 gi|24378365|gb|AAN59608.1|AE015023_9 putative translation initiation factor IF-1 [Streptococcus mutans
           UA159]
 gi|254998166|dbj|BAH88767.1| putative translation initiation factor IF-1 [Streptococcus mutans
           NN2025]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E +PNA F V+L                                  
Sbjct: 1   MAKEDVIEIEGKVVETMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++RK+ IRI +GDKV V M+PYD+TR RITYRFK
Sbjct: 27  ----ENGHQILATVSGKIRKNYIRILVGDKVTVEMSPYDLTRGRITYRFK 72


>gi|88854654|ref|ZP_01129320.1| translation initiation factor IF-1 [marine actinobacterium
           PHSC20C1]
 gi|88815815|gb|EAR25671.1| translation initiation factor IF-1 [marine actinobacterium
           PHSC20C1]
          Length = 73

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 53/111 (47%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGAVVEALPNAMFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+A+ +G+MR++ IRI   D+V V ++PYD+TR RITYR+K
Sbjct: 29  ------NGHVVLAHISGKMRQNYIRILPEDRVVVELSPYDLTRGRITYRYK 73


>gi|238897686|ref|YP_002923365.1| protein chain initiation factor IF-1 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465443|gb|ACQ67217.1| protein chain initiation factor IF-1 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPNA FRV+L                                  
Sbjct: 1   MAKEDNIEMQGTVRDALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V A+ +G+MRK+ IRI  GDKV + + PYD+++ARIT+R +
Sbjct: 27  ----ENGHHVTAHISGKMRKNYIRILTGDKVTLELTPYDLSKARITFRSR 72


>gi|330850664|ref|YP_004376545.1| translational initiation factor 1 [Ptilidium pulcherrimum]
 gi|302024793|gb|ADK89639.1| translational initiation factor 1 [Ptilidium pulcherrimum]
          Length = 78

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G+V+E LPNA FRV L                                  
Sbjct: 1   MKKQNLIDMEGVVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +GR+R++ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCEVLTHISGRIRRNFIRILPGDRVKVELSPYDLTKGRITYRLR 72


>gi|172040037|ref|YP_001799751.1| translation initiation factor IF-1 [Corynebacterium urealyticum DSM
           7109]
 gi|171851341|emb|CAQ04317.1| translation initiation factor IF-1 [Corynebacterium urealyticum DSM
           7109]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 28  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 72


>gi|15602896|ref|NP_245968.1| translation initiation factor IF-1 [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|260914475|ref|ZP_05920944.1| initiation factor IF1 [Pasteurella dagmatis ATCC 43325]
 gi|13431560|sp|P57898|IF1_PASMU RecName: Full=Translation initiation factor IF-1
 gi|59798013|sp|Q65UU9|IF1_MANSM RecName: Full=Translation initiation factor IF-1
 gi|12721364|gb|AAK03115.1| InfA [Pasteurella multocida subsp. multocida str. Pm70]
 gi|260631576|gb|EEX49758.1| initiation factor IF1 [Pasteurella dagmatis ATCC 43325]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV + M PYD+ + RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTIEMTPYDLNKGRIIFRSR 72


>gi|33151590|ref|NP_872943.1| translation initiation factor IF-1 [Haemophilus ducreyi 35000HP]
 gi|44888010|sp|Q7VNW5|IF1_HAEDU RecName: Full=Translation initiation factor IF-1
 gi|33147810|gb|AAP95332.1| translation initiation factor IF-1 [Haemophilus ducreyi 35000HP]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V M PYD+++ARI +R +
Sbjct: 27  ----ENGHIVAAHISGKMRKNYIRILTGDKVTVEMTPYDLSKARIIFRAR 72


>gi|57238603|ref|YP_179734.1| translation initiation factor IF-1 [Campylobacter jejuni RM1221]
 gi|86149274|ref|ZP_01067505.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|86152273|ref|ZP_01070484.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|86152784|ref|ZP_01070989.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|88596579|ref|ZP_01099816.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|121613429|ref|YP_001001233.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|148925734|ref|ZP_01809422.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|153951803|ref|YP_001398871.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|157415810|ref|YP_001483066.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|167006126|ref|ZP_02271884.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|205355604|ref|ZP_03222374.1| translation initiation factor IF1 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|218563179|ref|YP_002344959.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|283956975|ref|ZP_06374447.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|305432396|ref|ZP_07401558.1| translation initiation factor IF-1 [Campylobacter coli JV20]
 gi|9910711|sp|Q9PM85|IF1_CAMJE RecName: Full=Translation initiation factor IF-1
 gi|73621047|sp|Q5HSK1|IF1_CAMJR RecName: Full=Translation initiation factor IF-1
 gi|190359585|sp|A8FNQ2|IF1_CAMJ8 RecName: Full=Translation initiation factor IF-1
 gi|190359586|sp|A7H5U1|IF1_CAMJD RecName: Full=Translation initiation factor IF-1
 gi|190359587|sp|A1W1J2|IF1_CAMJJ RecName: Full=Translation initiation factor IF-1
 gi|57167407|gb|AAW36186.1| translation initiation factor IF-1 [Campylobacter jejuni RM1221]
 gi|85840056|gb|EAQ57314.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni CF93-6]
 gi|85840762|gb|EAQ58013.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 260.94]
 gi|85843669|gb|EAQ60879.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|87249908|gb|EAQ72867.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 81-176]
 gi|88191420|gb|EAQ95392.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 84-25]
 gi|107784842|gb|ABF83912.1| translation initiation factor-IF1 [Campylobacter jejuni subsp.
           doylei]
 gi|112360886|emb|CAL35687.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|145845744|gb|EDK22835.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni CG8486]
 gi|152939249|gb|ABS43990.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           doylei 269.97]
 gi|157386774|gb|ABV53089.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 81116]
 gi|205346381|gb|EDZ33014.1| translation initiation factor IF1 [Campylobacter jejuni subsp.
           jejuni CG8421]
 gi|283791476|gb|EFC30273.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 1336]
 gi|304444435|gb|EFM37086.1| translation initiation factor IF-1 [Campylobacter coli JV20]
 gi|307748448|gb|ADN91718.1| Translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni M1]
 gi|315059041|gb|ADT73370.1| Translation initiation factor 1 [Campylobacter jejuni subsp. jejuni
           S3]
 gi|315927664|gb|EFV06995.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni DFVF1099]
 gi|315929461|gb|EFV08658.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 305]
 gi|315931270|gb|EFV10240.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 72

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNANF+V+L                                  
Sbjct: 1   MAKDDVIEIDGTVLEALPNANFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H IRI  GDKVKV + PY + + RIT+R+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIRIMPGDKVKVELTPYSLDKGRITFRYK 72


>gi|262038690|ref|ZP_06012050.1| translation initiation factor IF-1 [Leptotrichia goodfellowii
           F0264]
 gi|261747242|gb|EEY34721.1| translation initiation factor IF-1 [Leptotrichia goodfellowii
           F0264]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ LE  G + E LPNA F+V+L                                  
Sbjct: 1   MAKQDVLELEGEILEALPNAMFQVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MR + I+I  GDKV V ++PYD++R RI YR K
Sbjct: 27  ----ENGHEVLGHISGKMRMNYIKILPGDKVTVEVSPYDLSRGRIVYRKK 72


>gi|282878779|ref|ZP_06287547.1| translation initiation factor IF-1 [Prevotella buccalis ATCC 35310]
 gi|282880979|ref|ZP_06289670.1| translation initiation factor IF-1 [Prevotella timonensis CRIS
           5C-B1]
 gi|281299170|gb|EFA91571.1| translation initiation factor IF-1 [Prevotella buccalis ATCC 35310]
 gi|281305202|gb|EFA97271.1| translation initiation factor IF-1 [Prevotella timonensis CRIS
           5C-B1]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIVESLSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDKVKV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVEIIAHISGKMRMHYIKILPGDKVKVEMSPYDLTKGRIVFRYK 72


>gi|145219083|ref|YP_001129792.1| translation initiation factor 1 [Prosthecochloris vibrioformis DSM
           265]
 gi|190359667|sp|A4SCT1|IF1_PROVI RecName: Full=Translation initiation factor IF-1
 gi|145205247|gb|ABP36290.1| bacterial translation initiation factor 1 (bIF-1) [Chlorobium
           phaeovibrioides DSM 265]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G++ E LPNA F+V+L                                  
Sbjct: 1   MAKEESIEIEGVILEALPNAQFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R H IRI  GDKVKV ++PYD+++ RITYR+K
Sbjct: 27  ----ENGLVVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRYK 72


>gi|53720800|ref|YP_109786.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           K96243]
 gi|76810919|ref|YP_335119.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1710b]
 gi|78064945|ref|YP_367714.1| translation initiation factor IF-1 [Burkholderia sp. 383]
 gi|83721653|ref|YP_443551.1| translation initiation factor IF-1 [Burkholderia thailandensis
           E264]
 gi|91785444|ref|YP_560650.1| translation initiation factor IF-1 [Burkholderia xenovorans LB400]
 gi|107024282|ref|YP_622609.1| translation initiation factor IF-1 [Burkholderia cenocepacia AU
           1054]
 gi|115350343|ref|YP_772182.1| translation initiation factor IF-1 [Burkholderia ambifaria AMMD]
 gi|116688393|ref|YP_834016.1| translation initiation factor IF-1 [Burkholderia cenocepacia
           HI2424]
 gi|126441065|ref|YP_001060729.1| translation initiation factor IF-1 [Burkholderia pseudomallei 668]
 gi|126454890|ref|YP_001068013.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1106a]
 gi|134283341|ref|ZP_01770042.1| translation initiation factor IF-1 [Burkholderia pseudomallei 305]
 gi|134294464|ref|YP_001118199.1| translation initiation factor IF-1 [Burkholderia vietnamiensis G4]
 gi|161523450|ref|YP_001578462.1| translation initiation factor IF-1 [Burkholderia multivorans ATCC
           17616]
 gi|167564396|ref|ZP_02357312.1| translation initiation factor IF-1 [Burkholderia oklahomensis
           EO147]
 gi|167571542|ref|ZP_02364416.1| translation initiation factor IF-1 [Burkholderia oklahomensis
           C6786]
 gi|167582602|ref|ZP_02375476.1| translation initiation factor IF-1 [Burkholderia thailandensis
           TXDOH]
 gi|167587751|ref|ZP_02380139.1| translation initiation factor IF-1 [Burkholderia ubonensis Bu]
 gi|167620716|ref|ZP_02389347.1| translation initiation factor IF-1 [Burkholderia thailandensis Bt4]
 gi|167721556|ref|ZP_02404792.1| translation initiation factor IF-1 [Burkholderia pseudomallei DM98]
 gi|167740530|ref|ZP_02413304.1| translation initiation factor IF-1 [Burkholderia pseudomallei 14]
 gi|167817735|ref|ZP_02449415.1| translation initiation factor IF-1 [Burkholderia pseudomallei 91]
 gi|167826132|ref|ZP_02457603.1| translation initiation factor IF-1 [Burkholderia pseudomallei 9]
 gi|167838191|ref|ZP_02465050.1| translation initiation factor IF-1 [Burkholderia thailandensis
           MSMB43]
 gi|167847644|ref|ZP_02473152.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           B7210]
 gi|167896216|ref|ZP_02483618.1| translation initiation factor IF-1 [Burkholderia pseudomallei 7894]
 gi|167904598|ref|ZP_02491803.1| translation initiation factor IF-1 [Burkholderia pseudomallei NCTC
           13177]
 gi|167912863|ref|ZP_02499954.1| translation initiation factor IF-1 [Burkholderia pseudomallei 112]
 gi|167920822|ref|ZP_02507913.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           BCC215]
 gi|170695702|ref|ZP_02886844.1| translation initiation factor IF-1 [Burkholderia graminis C4D1M]
 gi|170700715|ref|ZP_02891710.1| translation initiation factor IF-1 [Burkholderia ambifaria
           IOP40-10]
 gi|170731703|ref|YP_001763650.1| translation initiation factor IF-1 [Burkholderia cenocepacia MC0-3]
 gi|171318369|ref|ZP_02907527.1| translation initiation factor IF-1 [Burkholderia ambifaria MEX-5]
 gi|172059362|ref|YP_001807014.1| translation initiation factor IF-1 [Burkholderia ambifaria MC40-6]
 gi|186477566|ref|YP_001859036.1| translation initiation factor IF-1 [Burkholderia phymatum STM815]
 gi|187925595|ref|YP_001897237.1| translation initiation factor IF-1 [Burkholderia phytofirmans PsJN]
 gi|189351777|ref|YP_001947405.1| translation initiation factor IF-1 [Burkholderia multivorans ATCC
           17616]
 gi|206558662|ref|YP_002229422.1| translation initiation factor IF-1 [Burkholderia cenocepacia J2315]
 gi|209521364|ref|ZP_03270077.1| translation initiation factor IF-1 [Burkholderia sp. H160]
 gi|217424838|ref|ZP_03456335.1| translation initiation factor IF-1 [Burkholderia pseudomallei 576]
 gi|221201586|ref|ZP_03574624.1| translation initiation factor IF-1 [Burkholderia multivorans CGD2M]
 gi|221207339|ref|ZP_03580349.1| translation initiation factor IF-1 [Burkholderia multivorans CGD2]
 gi|221213477|ref|ZP_03586452.1| translation initiation factor IF-1 [Burkholderia multivorans CGD1]
 gi|237814124|ref|YP_002898575.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           MSHR346]
 gi|242317251|ref|ZP_04816267.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1106b]
 gi|254180360|ref|ZP_04886958.1| translation initiation factor IF-1 [Burkholderia pseudomallei 1655]
 gi|254190323|ref|ZP_04896831.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|254198449|ref|ZP_04904870.1| translation initiation factor IF-1 [Burkholderia pseudomallei S13]
 gi|254258382|ref|ZP_04949436.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1710a]
 gi|254300597|ref|ZP_04968042.1| translation initiation factor IF-1 [Burkholderia pseudomallei 406e]
 gi|257137663|ref|ZP_05585925.1| translation initiation factor IF-1 [Burkholderia thailandensis
           E264]
 gi|295677911|ref|YP_003606435.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1002]
 gi|296163300|ref|ZP_06846061.1| translation initiation factor IF-1 [Burkholderia sp. Ch1-1]
 gi|307731234|ref|YP_003908458.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1003]
 gi|323527581|ref|YP_004229734.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1001]
 gi|59797690|sp|Q63Q32|IF12_BURPS RecName: Full=Translation initiation factor IF-1 2
 gi|119370809|sp|Q1BRW9|IF11_BURCA RecName: Full=Translation initiation factor IF-1 1
 gi|119370812|sp|Q13TJ1|IF11_BURXL RecName: Full=Translation initiation factor IF-1 1
 gi|119370823|sp|Q3JMT4|IF12_BURP1 RecName: Full=Translation initiation factor IF-1 2
 gi|119370824|sp|Q39KE6|IF12_BURS3 RecName: Full=Translation initiation factor IF-1 2
 gi|119370846|sp|Q2SU48|IF1_BURTA RecName: Full=Translation initiation factor IF-1
 gi|122324245|sp|Q0BJ25|IF11_BURCM RecName: Full=Translation initiation factor IF-1 1
 gi|190359529|sp|A0K3P6|IF11_BURCH RecName: Full=Translation initiation factor IF-1 1
 gi|190359532|sp|A4JAR1|IF11_BURVG RecName: Full=Translation initiation factor IF-1 1
 gi|190359538|sp|A3P092|IF12_BURP0 RecName: Full=Translation initiation factor IF-1 2
 gi|190359539|sp|A3NEF8|IF12_BURP6 RecName: Full=Translation initiation factor IF-1 2
 gi|52211214|emb|CAH37203.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           K96243]
 gi|76580372|gb|ABA49847.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1710b]
 gi|77965690|gb|ABB07070.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia sp.
           383]
 gi|83655478|gb|ABC39541.1| translation initiation factor IF-1 [Burkholderia thailandensis
           E264]
 gi|91689398|gb|ABE32598.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia
           xenovorans LB400]
 gi|105894471|gb|ABF77636.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia
           cenocepacia AU 1054]
 gi|115280331|gb|ABI85848.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia
           ambifaria AMMD]
 gi|116646482|gb|ABK07123.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia
           cenocepacia HI2424]
 gi|126220558|gb|ABN84064.1| translation initiation factor IF-1 [Burkholderia pseudomallei 668]
 gi|126228532|gb|ABN92072.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1106a]
 gi|134137621|gb|ABO53364.1| bacterial translation initiation factor 1 (bIF-1) [Burkholderia
           vietnamiensis G4]
 gi|134245536|gb|EBA45629.1| translation initiation factor IF-1 [Burkholderia pseudomallei 305]
 gi|157810595|gb|EDO87765.1| translation initiation factor IF-1 [Burkholderia pseudomallei 406e]
 gi|157937999|gb|EDO93669.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           Pasteur 52237]
 gi|160340879|gb|ABX13965.1| translation initiation factor IF-1 [Burkholderia multivorans ATCC
           17616]
 gi|169655189|gb|EDS87882.1| translation initiation factor IF-1 [Burkholderia pseudomallei S13]
 gi|169814945|gb|ACA89528.1| translation initiation factor IF-1 [Burkholderia cenocepacia MC0-3]
 gi|170134385|gb|EDT02718.1| translation initiation factor IF-1 [Burkholderia ambifaria
           IOP40-10]
 gi|170139307|gb|EDT07493.1| translation initiation factor IF-1 [Burkholderia graminis C4D1M]
 gi|171096447|gb|EDT41346.1| translation initiation factor IF-1 [Burkholderia ambifaria MEX-5]
 gi|171991879|gb|ACB62798.1| translation initiation factor IF-1 [Burkholderia ambifaria MC40-6]
 gi|184194025|gb|ACC71990.1| translation initiation factor IF-1 [Burkholderia phymatum STM815]
 gi|184210899|gb|EDU07942.1| translation initiation factor IF-1 [Burkholderia pseudomallei 1655]
 gi|187716789|gb|ACD18013.1| translation initiation factor IF-1 [Burkholderia phytofirmans PsJN]
 gi|189335799|dbj|BAG44869.1| translation initiation factor IF-1 [Burkholderia multivorans ATCC
           17616]
 gi|198034699|emb|CAR50566.1| translation initiation factor IF-1 1 [Burkholderia cenocepacia
           J2315]
 gi|209498184|gb|EDZ98326.1| translation initiation factor IF-1 [Burkholderia sp. H160]
 gi|217392294|gb|EEC32319.1| translation initiation factor IF-1 [Burkholderia pseudomallei 576]
 gi|221166929|gb|EED99400.1| translation initiation factor IF-1 [Burkholderia multivorans CGD1]
 gi|221172927|gb|EEE05364.1| translation initiation factor IF-1 [Burkholderia multivorans CGD2]
 gi|221178402|gb|EEE10811.1| translation initiation factor IF-1 [Burkholderia multivorans CGD2M]
 gi|237506085|gb|ACQ98403.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           MSHR346]
 gi|242140490|gb|EES26892.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1106b]
 gi|254217071|gb|EET06455.1| translation initiation factor IF-1 [Burkholderia pseudomallei
           1710a]
 gi|295437754|gb|ADG16924.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1002]
 gi|295886439|gb|EFG66296.1| translation initiation factor IF-1 [Burkholderia sp. Ch1-1]
 gi|307585769|gb|ADN59167.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1003]
 gi|323384583|gb|ADX56674.1| translation initiation factor IF-1 [Burkholderia sp. CCGE1001]
 gi|325529699|gb|EGD06562.1| translation initiation factor IF-1 [Burkholderia sp. TJI49]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVIENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|296119328|ref|ZP_06837896.1| translation initiation factor IF-1 [Corynebacterium ammoniagenes
           DSM 20306]
 gi|295967720|gb|EFG80977.1| translation initiation factor IF-1 [Corynebacterium ammoniagenes
           DSM 20306]
          Length = 80

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 9   MAKEGAIEVEGRIVEPLPNAMFRVELD--------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 36  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 80


>gi|320120544|gb|EFE28901.2| translation initiation factor IF-1 [Filifactor alocis ATCC 35896]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + LPN  F+VKL                                  
Sbjct: 1   MSKKDVIELEGTVIDALPNTMFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+ +G++R + IRI  GD V V ++PYD+T+ RIT+R K
Sbjct: 27  ----ENDHEIMAHISGKLRMNFIRILPGDTVTVELSPYDLTKGRITWRKK 72


>gi|295135680|ref|YP_003586356.1| translation initiation factor IF-1 [Zunongwangia profunda SM-A87]
 gi|294983695|gb|ADF54160.1| translation initiation factor IF-1 [Zunongwangia profunda SM-A87]
          Length = 71

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQPAIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|225011668|ref|ZP_03702106.1| translation initiation factor IF-1 [Flavobacteria bacterium
           MS024-2A]
 gi|225004171|gb|EEG42143.1| translation initiation factor IF-1 [Flavobacteria bacterium
           MS024-2A]
          Length = 71

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQEGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+++ARIT+RF
Sbjct: 27  ----ENGHVVTAHISGKMRLHYIKLLPGDKVKLEMSPYDLSKARITFRF 71


>gi|114320602|ref|YP_742285.1| translation initiation factor 1 [Alkalilimnicola ehrlichii MLHE-1]
 gi|119370839|sp|Q0A8P2|IF1_ALHEH RecName: Full=Translation initiation factor IF-1
 gi|114226996|gb|ABI56795.1| bacterial translation initiation factor 1 (bIF-1) [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE+++ +G V E LPN  FRV+L                                  
Sbjct: 1   MAKEESIKMNGTVIETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKV V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDKVTVELTPYDLSKGRITYRAR 72


>gi|269837089|ref|YP_003319317.1| translation initiation factor IF-1 [Sphaerobacter thermophilus DSM
           20745]
 gi|269786352|gb|ACZ38495.1| translation initiation factor IF-1 [Sphaerobacter thermophilus DSM
           20745]
          Length = 73

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V+E LPNA FRV+L +                                
Sbjct: 1   MAKKDVIEVEGRVTEPLPNAMFRVELDS-------------------------------- 28

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    V+A+ +G++R + IRI  GD+V+V ++PYD+ R RITYR +
Sbjct: 29  ------GHEVLAHISGKLRLNFIRILPGDRVRVELSPYDLARGRITYRLR 72


>gi|313681340|ref|YP_004059078.1| bacterial translation initiation factor 1 (bif-1) [Sulfuricurvum
           kujiense DSM 16994]
 gi|313154200|gb|ADR32878.1| bacterial translation initiation factor 1 (bIF-1) [Sulfuricurvum
           kujiense DSM 16994]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGKIIEALPNATFRVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H I+I  GD VK+ + PY + + RITYR+K
Sbjct: 28  -----NGHVILCHIAGKMRMHYIKILPGDTVKIELTPYSLDKGRITYRYK 72


>gi|257126743|ref|YP_003164857.1| translation initiation factor IF-1 [Leptotrichia buccalis C-1013-b]
 gi|260891353|ref|ZP_05902616.1| translation initiation factor IF-1 [Leptotrichia hofstadii F0254]
 gi|257050682|gb|ACV39866.1| translation initiation factor IF-1 [Leptotrichia buccalis C-1013-b]
 gi|260858736|gb|EEX73236.1| translation initiation factor IF-1 [Leptotrichia hofstadii F0254]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ LE  G + E LPNA F+V+L                                  
Sbjct: 1   MAKQDVLELEGEIIEALPNAMFQVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MR + I+I  GDKV V ++PYD++R RI YR K
Sbjct: 27  ----ENGHEVLGHISGKMRMNYIKILPGDKVTVEVSPYDLSRGRIVYRKK 72


>gi|332286123|ref|YP_004418034.1| Bacterial Protein Translation Initiation Factor 1 [Pusillimonas sp.
           T7-7]
 gi|330430076|gb|AEC21410.1| Bacterial Protein Translation Initiation Factor 1 [Pusillimonas sp.
           T7-7]
          Length = 72

 Score =  111 bits (277), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRSK 72


>gi|254294128|ref|YP_003060151.1| translation initiation factor IF-1 [Hirschia baltica ATCC 49814]
 gi|254042659|gb|ACT59454.1| translation initiation factor IF-1 [Hirschia baltica ATCC 49814]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEFSG + ELLPNA FRVKL                                  
Sbjct: 1   MAKEELLEFSGTIVELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|225571577|ref|ZP_03780573.1| hypothetical protein CLOHYLEM_07675 [Clostridium hylemonae DSM
           15053]
 gi|225159654|gb|EEG72273.1| hypothetical protein CLOHYLEM_07675 [Clostridium hylemonae DSM
           15053]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGKVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNFIKILPGDKVTLELSPYDLSKGRIIWRDK 72


>gi|120611617|ref|YP_971295.1| translation initiation factor IF-1 [Acidovorax citrulli AAC00-1]
 gi|190359535|sp|A1TRD3|IF12_ACIAC RecName: Full=Translation initiation factor IF-1 2
 gi|120590081|gb|ABM33521.1| bacterial translation initiation factor 1 (bIF-1) [Acidovorax
           citrulli AAC00-1]
          Length = 85

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|291542054|emb|CBL15164.1| bacterial translation initiation factor 1 (bIF-1) [Ruminococcus
           bromii L2-63]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA F+V+L                                  
Sbjct: 1   MSKQDVIEIEGIVKEALPNAQFKVELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A  +G++R + IRI  GDKVKV M+PYD+TR RIT+R K
Sbjct: 28  -----NGHVILAVISGKLRMNFIRILPGDKVKVEMSPYDLTRGRITWRTK 72


>gi|237809062|ref|YP_002893502.1| translation initiation factor IF-1 [Tolumonas auensis DSM 9187]
 gi|237501323|gb|ACQ93916.1| translation initiation factor IF-1 [Tolumonas auensis DSM 9187]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MSKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRSR 72


>gi|15674309|ref|NP_268482.1| translation initiation factor IF-1 [Streptococcus pyogenes M1 GAS]
 gi|19745263|ref|NP_606399.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS8232]
 gi|21909598|ref|NP_663866.1| translation initiation factor IF-1 [Streptococcus pyogenes MGAS315]
 gi|22536265|ref|NP_687116.1| translation initiation factor IF-1 [Streptococcus agalactiae
           2603V/R]
 gi|25010155|ref|NP_734550.1| translation initiation factor IF-1 [Streptococcus agalactiae
           NEM316]
 gi|55821883|ref|YP_140325.1| translation initiation factor IF-1 [Streptococcus thermophilus LMG
           18311]
 gi|55823799|ref|YP_142240.1| translation initiation factor IF-1 [Streptococcus thermophilus
           CNRZ1066]
 gi|56807659|ref|ZP_00365548.1| COG0361: Translation initiation factor 1 (IF-1) [Streptococcus
           pyogenes M49 591]
 gi|71909880|ref|YP_281430.1| translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS5005]
 gi|76788620|ref|YP_328806.1| translation initiation factor IF-1 [Streptococcus agalactiae A909]
 gi|76798204|ref|ZP_00780454.1| translation initiation factor IF-1 [Streptococcus agalactiae
           18RS21]
 gi|77406099|ref|ZP_00783173.1| translation initiation factor IF-1 [Streptococcus agalactiae H36B]
 gi|77412630|ref|ZP_00788909.1| translation initiation factor IF-1 [Streptococcus agalactiae
           CJB111]
 gi|77414572|ref|ZP_00790715.1| translation initiation factor IF-1 [Streptococcus agalactiae 515]
 gi|116628576|ref|YP_821195.1| translation initiation factor IF-1 [Streptococcus thermophilus
           LMD-9]
 gi|139472949|ref|YP_001127664.1| translation initiation factor IF-1 [Streptococcus pyogenes str.
           Manfredo]
 gi|171778398|ref|ZP_02919577.1| hypothetical protein STRINF_00428 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|209558649|ref|YP_002285121.1| translation initiation factor IF-1 [Streptococcus pyogenes NZ131]
 gi|222152287|ref|YP_002561462.1| translation initiation factor IF-1 [Streptococcus uberis 0140J]
 gi|225867687|ref|YP_002743635.1| translation initiation factor IF-1 [Streptococcus equi subsp.
           zooepidemicus]
 gi|225869558|ref|YP_002745505.1| translation initiation factor IF-1 [Streptococcus equi subsp. equi
           4047]
 gi|228478061|ref|ZP_04062672.1| translation initiation factor IF-1 [Streptococcus salivarius SK126]
 gi|288904295|ref|YP_003429516.1| translation initiation factor IF-1 [Streptococcus gallolyticus
           UCN34]
 gi|306828238|ref|ZP_07461498.1| translation initiation factor IF-1 [Streptococcus pyogenes ATCC
           10782]
 gi|306830324|ref|ZP_07463495.1| translation initiation factor IF-1 [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|306832569|ref|ZP_07465709.1| translation initiation factor IF-1 [Streptococcus bovis ATCC
           700338]
 gi|312862360|ref|ZP_07722603.1| translation initiation factor IF-1 [Streptococcus vestibularis
           F0396]
 gi|312866540|ref|ZP_07726757.1| translation initiation factor IF-1 [Streptococcus downei F0415]
 gi|313889586|ref|ZP_07823231.1| translation initiation factor IF-1 [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|320548033|ref|ZP_08042313.1| translation initiation factor IF-1 [Streptococcus equinus ATCC
           9812]
 gi|322374067|ref|ZP_08048601.1| translation initiation factor IF-1 [Streptococcus sp. C150]
 gi|322515889|ref|ZP_08068831.1| translation initiation factor IF-1 [Streptococcus vestibularis ATCC
           49124]
 gi|325977274|ref|YP_004286990.1| translation initiation factor IF-1 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|329115755|ref|ZP_08244472.1| translation initiation factor IF-1 [Streptococcus parauberis NCFD
           2020]
 gi|332523991|ref|ZP_08400243.1| translation initiation factor IF-1 [Streptococcus porcinus str.
           Jelinkova 176]
 gi|54037372|sp|P65124|IF1_STRP3 RecName: Full=Translation initiation factor IF-1
 gi|54037373|sp|P65125|IF1_STRP8 RecName: Full=Translation initiation factor IF-1
 gi|54037374|sp|P65126|IF1_STRA3 RecName: Full=Translation initiation factor IF-1
 gi|54037375|sp|P65127|IF1_STRA5 RecName: Full=Translation initiation factor IF-1
 gi|54041105|sp|P65123|IF1_STRP1 RecName: Full=Translation initiation factor IF-1
 gi|73920048|sp|Q5XEB3|IF1_STRP6 RecName: Full=Translation initiation factor IF-1
 gi|73920049|sp|Q5LXT3|IF1_STRT1 RecName: Full=Translation initiation factor IF-1
 gi|73920050|sp|Q5M2D5|IF1_STRT2 RecName: Full=Translation initiation factor IF-1
 gi|119371126|sp|Q3K3U7|IF1_STRA1 RecName: Full=Translation initiation factor IF-1
 gi|119371127|sp|Q1JE37|IF1_STRPB RecName: Full=Translation initiation factor IF-1
 gi|119371128|sp|Q1JNZ5|IF1_STRPC RecName: Full=Translation initiation factor IF-1
 gi|119371129|sp|Q1JJ39|IF1_STRPD RecName: Full=Translation initiation factor IF-1
 gi|119371130|sp|Q1J8Z1|IF1_STRPF RecName: Full=Translation initiation factor IF-1
 gi|119371131|sp|Q48VS7|IF1_STRPM RecName: Full=Translation initiation factor IF-1
 gi|122266830|sp|Q03IH3|IF1_STRTD RecName: Full=Translation initiation factor IF-1
 gi|190359713|sp|A2RC36|IF1_STRPG RecName: Full=Translation initiation factor IF-1
 gi|22533086|gb|AAM98988.1|AE014195_7 translation initiation factor IF-1 [Streptococcus agalactiae
           2603V/R]
 gi|13621390|gb|AAK33204.1| putative translation initiation factor IF-1 [Streptococcus pyogenes
           M1 GAS]
 gi|19747358|gb|AAL96898.1| putative translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS8232]
 gi|21903779|gb|AAM78669.1| putative translation initiation factor IF-1 [Streptococcus pyogenes
           MGAS315]
 gi|23094506|emb|CAD45725.1| translation initiation factor IF-1 [Streptococcus agalactiae
           NEM316]
 gi|55737868|gb|AAV61510.1| translation initiation factor IF-1 [Streptococcus thermophilus LMG
           18311]
 gi|55739784|gb|AAV63425.1| translation initiation factor IF-1 [Streptococcus thermophilus
           CNRZ1066]
 gi|71852662|gb|AAZ50685.1| bacterial protein translation initiation factor 1 [Streptococcus
           pyogenes MGAS5005]
 gi|76563677|gb|ABA46261.1| translation initiation factor IF-1 [Streptococcus agalactiae A909]
 gi|76586413|gb|EAO62921.1| translation initiation factor IF-1 [Streptococcus agalactiae
           18RS21]
 gi|77159370|gb|EAO70538.1| translation initiation factor IF-1 [Streptococcus agalactiae 515]
 gi|77161322|gb|EAO72354.1| translation initiation factor IF-1 [Streptococcus agalactiae
           CJB111]
 gi|77175280|gb|EAO78075.1| translation initiation factor IF-1 [Streptococcus agalactiae H36B]
 gi|116101853|gb|ABJ66999.1| bacterial translation initiation factor 1 (bIF-1) [Streptococcus
           thermophilus LMD-9]
 gi|134271195|emb|CAM29408.1| translation initiation factor IF-1 [Streptococcus pyogenes str.
           Manfredo]
 gi|171282929|gb|EDT48353.1| hypothetical protein STRINF_00428 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|209539850|gb|ACI60426.1| Translation initiation factor 1 [Streptococcus pyogenes NZ131]
 gi|222113098|emb|CAR40479.1| translation initiation factor IF-1 [Streptococcus uberis 0140J]
 gi|225698962|emb|CAW92008.1| translation initiation factor IF-1 [Streptococcus equi subsp. equi
           4047]
 gi|225700963|emb|CAW97683.1| translation initiation factor IF-1 [Streptococcus equi subsp.
           zooepidemicus]
 gi|228250241|gb|EEK09494.1| translation initiation factor IF-1 [Streptococcus salivarius SK126]
 gi|288731020|emb|CBI12564.1| translation initiation factor IF-1 [Streptococcus gallolyticus
           UCN34]
 gi|304425327|gb|EFM28453.1| translation initiation factor IF-1 [Streptococcus bovis ATCC
           700338]
 gi|304427571|gb|EFM30672.1| translation initiation factor IF-1 [Streptococcus gallolyticus
           subsp. gallolyticus TX20005]
 gi|304429549|gb|EFM32598.1| translation initiation factor IF-1 [Streptococcus pyogenes ATCC
           10782]
 gi|311097971|gb|EFQ56198.1| translation initiation factor IF-1 [Streptococcus downei F0415]
 gi|311102003|gb|EFQ60203.1| translation initiation factor IF-1 [Streptococcus vestibularis
           F0396]
 gi|312279237|gb|ADQ63894.1| Protein translation initiation factor 1 [Streptococcus thermophilus
           ND03]
 gi|313122095|gb|EFR45189.1| translation initiation factor IF-1 [Streptococcus pseudoporcinus
           SPIN 20026]
 gi|319743973|gb|EFV96353.1| translation initiation factor IF-1 [Streptococcus agalactiae ATCC
           13813]
 gi|320447275|gb|EFW88038.1| translation initiation factor IF-1 [Streptococcus equinus ATCC
           9812]
 gi|321277033|gb|EFX54104.1| translation initiation factor IF-1 [Streptococcus sp. C150]
 gi|322125676|gb|EFX97003.1| translation initiation factor IF-1 [Streptococcus vestibularis ATCC
           49124]
 gi|322410880|gb|EFY01788.1| translation initiation factor IF-1 [Streptococcus dysgalactiae
           subsp. dysgalactiae ATCC 27957]
 gi|323126333|gb|ADX23630.1| translation initiation factor IF-1 [Streptococcus dysgalactiae
           subsp. equisimilis ATCC 12394]
 gi|325177202|emb|CBZ47246.1| Translation initiation factor IF-1 [Streptococcus gallolyticus
           subsp. gallolyticus ATCC BAA-2069]
 gi|326906160|gb|EGE53074.1| translation initiation factor IF-1 [Streptococcus parauberis NCFD
           2020]
 gi|332315255|gb|EGJ28240.1| translation initiation factor IF-1 [Streptococcus porcinus str.
           Jelinkova 176]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E +PNA F V+L                                  
Sbjct: 1   MAKEDVIEIEGKVVETMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++RK+ IRI +GD+V V M+PYD+TR RITYRFK
Sbjct: 27  ----ENGHQILATVSGKIRKNYIRILVGDRVTVEMSPYDLTRGRITYRFK 72


>gi|97976|pir||S17988 translation initiation factor IF-1 - Lactococcus lactis subsp.
           lactis
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + K++ +E  G V + +PNA F V+L                                  
Sbjct: 1   LAKDDVIEVDGKVVDTMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++RK+ IRI  GDKV+V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHQVLATISGKIRKNYIRILPGDKVQVELSPYDLTRGRITYRFK 72


>gi|254488116|ref|ZP_05101321.1| translation initiation factor IF-1 [Roseobacter sp. GAI101]
 gi|214044985|gb|EEB85623.1| translation initiation factor IF-1 [Roseobacter sp. GAI101]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLEF GIV ELLPNA FRV+L                                  
Sbjct: 1   MAKEDTLEFPGIVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFK 72


>gi|62289250|ref|YP_221043.1| translation initiation factor IF-1 [Brucella abortus bv. 1 str.
           9-941]
 gi|82699182|ref|YP_413756.1| translation initiation factor IF-1 [Brucella melitensis biovar
           Abortus 2308]
 gi|153007668|ref|YP_001368883.1| translation initiation factor IF-1 [Ochrobactrum anthropi ATCC
           49188]
 gi|163842534|ref|YP_001626938.1| translation initiation factor IF-1 [Brucella suis ATCC 23445]
 gi|225851801|ref|YP_002732034.1| translation initiation factor IF-1 [Brucella melitensis ATCC 23457]
 gi|254690568|ref|ZP_05153822.1| translation initiation factor IF-1 [Brucella abortus bv. 6 str.
           870]
 gi|254695059|ref|ZP_05156887.1| translation initiation factor IF-1 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696693|ref|ZP_05158521.1| translation initiation factor IF-1 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254701073|ref|ZP_05162901.1| translation initiation factor IF-1 [Brucella suis bv. 5 str. 513]
 gi|254708001|ref|ZP_05169829.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M163/99/10]
 gi|254709419|ref|ZP_05171230.1| translation initiation factor IF-1 [Brucella pinnipedialis B2/94]
 gi|254713161|ref|ZP_05174972.1| translation initiation factor IF-1 [Brucella ceti M644/93/1]
 gi|254716485|ref|ZP_05178296.1| translation initiation factor IF-1 [Brucella ceti M13/05/1]
 gi|254718457|ref|ZP_05180268.1| translation initiation factor IF-1 [Brucella sp. 83/13]
 gi|254731601|ref|ZP_05190179.1| translation initiation factor IF-1 [Brucella abortus bv. 4 str.
           292]
 gi|256030913|ref|ZP_05444527.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M292/94/1]
 gi|256046064|ref|ZP_05448936.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060406|ref|ZP_05450579.1| translation initiation factor IF-1 [Brucella neotomae 5K33]
 gi|256112776|ref|ZP_05453697.1| translation initiation factor IF-1 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158953|ref|ZP_05456796.1| translation initiation factor IF-1 [Brucella ceti M490/95/1]
 gi|256254318|ref|ZP_05459854.1| translation initiation factor IF-1 [Brucella ceti B1/94]
 gi|256258823|ref|ZP_05464359.1| translation initiation factor IF-1 [Brucella abortus bv. 9 str.
           C68]
 gi|256264682|ref|ZP_05467214.1| translation initiation factor IF-1 [Brucella melitensis bv. 2 str.
           63/9]
 gi|256368710|ref|YP_003106216.1| translation initiation factor IF-1 [Brucella microti CCM 4915]
 gi|260169814|ref|ZP_05756625.1| translation initiation factor IF-1 [Brucella sp. F5/99]
 gi|260563342|ref|ZP_05833828.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           16M]
 gi|260756137|ref|ZP_05868485.1| translation initiation factor IF-1 [Brucella abortus bv. 6 str.
           870]
 gi|260759361|ref|ZP_05871709.1| translation initiation factor IF-1 [Brucella abortus bv. 4 str.
           292]
 gi|260761082|ref|ZP_05873425.1| translation initiation factor IF-1 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260885156|ref|ZP_05896770.1| translation initiation factor IF-1 [Brucella abortus bv. 9 str.
           C68]
 gi|261215411|ref|ZP_05929692.1| translation initiation factor IF-1 [Brucella abortus bv. 3 str.
           Tulya]
 gi|261218276|ref|ZP_05932557.1| translation initiation factor IF-1 [Brucella ceti M13/05/1]
 gi|261221475|ref|ZP_05935756.1| translation initiation factor IF-1 [Brucella ceti B1/94]
 gi|261315495|ref|ZP_05954692.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M163/99/10]
 gi|261316937|ref|ZP_05956134.1| translation initiation factor IF-1 [Brucella pinnipedialis B2/94]
 gi|261320876|ref|ZP_05960073.1| translation initiation factor IF-1 [Brucella ceti M644/93/1]
 gi|261324392|ref|ZP_05963589.1| translation initiation factor IF-1 [Brucella neotomae 5K33]
 gi|261751605|ref|ZP_05995314.1| translation initiation factor IF-1 [Brucella suis bv. 5 str. 513]
 gi|261759359|ref|ZP_06003068.1| translation initiation factor IF-1 [Brucella sp. F5/99]
 gi|265983424|ref|ZP_06096159.1| translation initiation factor IF-1 [Brucella sp. 83/13]
 gi|265987974|ref|ZP_06100531.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M292/94/1]
 gi|265992478|ref|ZP_06105035.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994219|ref|ZP_06106776.1| translation initiation factor IF-1 [Brucella melitensis bv. 3 str.
           Ether]
 gi|265997436|ref|ZP_06109993.1| translation initiation factor IF-1 [Brucella ceti M490/95/1]
 gi|294851644|ref|ZP_06792317.1| translation initiation factor IF-1 [Brucella sp. NVSL 07-0026]
 gi|306840165|ref|ZP_07472949.1| translation initiation factor IF-1 [Brucella sp. NF 2653]
 gi|306842473|ref|ZP_07475124.1| translation initiation factor IF-1 [Brucella sp. BO2]
 gi|306844898|ref|ZP_07477480.1| translation initiation factor IF-1 [Brucella sp. BO1]
 gi|51702277|sp|P62923|IF1_BRUME RecName: Full=Translation initiation factor IF-1
 gi|88911342|sp|Q2YPC1|IF1_BRUA2 RecName: Full=Translation initiation factor IF-1
 gi|90110663|sp|P0C108|IF1_BRUAB RecName: Full=Translation initiation factor IF-1
 gi|190359576|sp|B0CJM7|IF1_BRUSI RecName: Full=Translation initiation factor IF-1
 gi|190359600|sp|A5VNK0|IF1_BRUO2 RecName: Full=Translation initiation factor IF-1
 gi|190359661|sp|A6WVQ0|IF1_OCHA4 RecName: Full=Translation initiation factor IF-1
 gi|13021756|gb|AAK11548.1|AF288531_1 translation initiation factor-like protein [Brucella abortus]
 gi|62195382|gb|AAX73682.1| InfA, translation initiation factor IF-1 [Brucella abortus bv. 1
           str. 9-941]
 gi|82615283|emb|CAJ10238.1| RNA binding S1:Translation initiation factor IF-1:S1 domain, IF1
           type [Brucella melitensis biovar Abortus 2308]
 gi|151559556|gb|ABS13054.1| translation initiation factor IF-1 [Ochrobactrum anthropi ATCC
           49188]
 gi|163673257|gb|ABY37368.1| translation initiation factor IF-1 [Brucella suis ATCC 23445]
 gi|225640166|gb|ACO00080.1| translation initiation factor IF-1 [Brucella melitensis ATCC 23457]
 gi|255998868|gb|ACU47267.1| translation initiation factor IF-1 [Brucella microti CCM 4915]
 gi|260153358|gb|EEW88450.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           16M]
 gi|260669679|gb|EEX56619.1| translation initiation factor IF-1 [Brucella abortus bv. 4 str.
           292]
 gi|260671514|gb|EEX58335.1| translation initiation factor IF-1 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260676245|gb|EEX63066.1| translation initiation factor IF-1 [Brucella abortus bv. 6 str.
           870]
 gi|260874684|gb|EEX81753.1| translation initiation factor IF-1 [Brucella abortus bv. 9 str.
           C68]
 gi|260917018|gb|EEX83879.1| translation initiation factor IF-1 [Brucella abortus bv. 3 str.
           Tulya]
 gi|260920059|gb|EEX86712.1| translation initiation factor IF-1 [Brucella ceti B1/94]
 gi|260923365|gb|EEX89933.1| translation initiation factor IF-1 [Brucella ceti M13/05/1]
 gi|261293566|gb|EEX97062.1| translation initiation factor IF-1 [Brucella ceti M644/93/1]
 gi|261296160|gb|EEX99656.1| translation initiation factor IF-1 [Brucella pinnipedialis B2/94]
 gi|261300372|gb|EEY03869.1| translation initiation factor IF-1 [Brucella neotomae 5K33]
 gi|261304521|gb|EEY08018.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M163/99/10]
 gi|261739343|gb|EEY27339.1| translation initiation factor IF-1 [Brucella sp. F5/99]
 gi|261741358|gb|EEY29284.1| translation initiation factor IF-1 [Brucella suis bv. 5 str. 513]
 gi|262551904|gb|EEZ07894.1| translation initiation factor IF-1 [Brucella ceti M490/95/1]
 gi|262765200|gb|EEZ11121.1| translation initiation factor IF-1 [Brucella melitensis bv. 3 str.
           Ether]
 gi|263003544|gb|EEZ15837.1| translation initiation factor IF-1 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263095090|gb|EEZ18759.1| translation initiation factor IF-1 [Brucella melitensis bv. 2 str.
           63/9]
 gi|264660171|gb|EEZ30432.1| translation initiation factor IF-1 [Brucella pinnipedialis
           M292/94/1]
 gi|264662016|gb|EEZ32277.1| translation initiation factor IF-1 [Brucella sp. 83/13]
 gi|294820233|gb|EFG37232.1| translation initiation factor IF-1 [Brucella sp. NVSL 07-0026]
 gi|306274727|gb|EFM56511.1| translation initiation factor IF-1 [Brucella sp. BO1]
 gi|306287329|gb|EFM58809.1| translation initiation factor IF-1 [Brucella sp. BO2]
 gi|306404763|gb|EFM61058.1| translation initiation factor IF-1 [Brucella sp. NF 2653]
 gi|326408295|gb|ADZ65360.1| translation initiation factor IF-1 [Brucella melitensis M28]
 gi|326538009|gb|ADZ86224.1| translation initiation factor IF-1 [Brucella melitensis M5-90]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|163847945|ref|YP_001635989.1| translation initiation factor IF-1 [Chloroflexus aurantiacus
           J-10-fl]
 gi|219849865|ref|YP_002464298.1| translation initiation factor IF-1 [Chloroflexus aggregans DSM
           9485]
 gi|222525825|ref|YP_002570296.1| translation initiation factor IF-1 [Chloroflexus sp. Y-400-fl]
 gi|190359588|sp|A9WH88|IF1_CHLAA RecName: Full=Translation initiation factor IF-1
 gi|163669234|gb|ABY35600.1| translation initiation factor IF-1 [Chloroflexus aurantiacus
           J-10-fl]
 gi|219544124|gb|ACL25862.1| translation initiation factor IF-1 [Chloroflexus aggregans DSM
           9485]
 gi|222449704|gb|ACM53970.1| translation initiation factor IF-1 [Chloroflexus sp. Y-400-fl]
          Length = 73

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +E  G ++E LPNA FRV+L                                    
Sbjct: 4   KKDVIEMEGTITEPLPNAMFRVQLD----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR + IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 29  ---NGHEVLAHISGKMRMNYIRILKGDRVLVELSPYDLTRGRITYRYK 73


>gi|315158622|gb|EFU02639.1| translation initiation factor IF-1 [Enterococcus faecalis TX0312]
          Length = 84

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/109 (33%), Positives = 49/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPNA F+V+L                                   
Sbjct: 14  AKEDMIEVEGTVVETLPNAMFKVEL----------------------------------- 38

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   V+A  +G++R H IRI  G KV V ++PYD+TR RITYRFK
Sbjct: 39  ---ENGHQVLATVSGKIRMHYIRILPGAKVTVELSPYDLTRGRITYRFK 84


>gi|221067842|ref|ZP_03543947.1| translation initiation factor IF-1 [Comamonas testosteroni KF-1]
 gi|264677822|ref|YP_003277728.1| translation initiation factor IF-1 [Comamonas testosteroni CNB-2]
 gi|299531708|ref|ZP_07045113.1| translation initiation factor IF-1 [Comamonas testosteroni S44]
 gi|220712865|gb|EED68233.1| translation initiation factor IF-1 [Comamonas testosteroni KF-1]
 gi|262208334|gb|ACY32432.1| translation initiation factor IF-1 [Comamonas testosteroni CNB-2]
 gi|298720424|gb|EFI61376.1| translation initiation factor IF-1 [Comamonas testosteroni S44]
          Length = 85

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|114766900|ref|ZP_01445821.1| translation initiation factor IF-1 [Pelagibaca bermudensis
           HTCC2601]
 gi|260425257|ref|ZP_05779237.1| translation initiation factor IF-1 [Citreicella sp. SE45]
 gi|114540878|gb|EAU43939.1| translation initiation factor IF-1 [Roseovarius sp. HTCC2601]
 gi|260423197|gb|EEX16447.1| translation initiation factor IF-1 [Citreicella sp. SE45]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEDILEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GD+V+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDRVQVEMTPYDLTKGRINYRFK 72


>gi|329894888|ref|ZP_08270687.1| Translation initiation factor 1 [gamma proteobacterium IMCC3088]
 gi|328922617|gb|EGG29952.1| Translation initiation factor 1 [gamma proteobacterium IMCC3088]
          Length = 83

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRVKL                                  
Sbjct: 12  MAKEDQIEMDGEVIDTLPNTTFRVKL---------------------------------- 37

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKV+V + PYD+T+ RITYR +
Sbjct: 38  ----ENGHVVTAHISGKMRKHYIRILTGDKVRVELTPYDLTKGRITYRER 83


>gi|49082546|gb|AAT50673.1| PA2619 [synthetic construct]
          Length = 73

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE++ E  G V + LPN  FRV+L                                  
Sbjct: 1   MSKEDSFEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRAR 72


>gi|302558971|ref|ZP_07311313.1| translation initiation factor IF-1 [Streptomyces griseoflavus
           Tu4000]
 gi|302476589|gb|EFL39682.1| translation initiation factor IF-1 [Streptomyces griseoflavus
           Tu4000]
          Length = 73

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K +  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKQGAIEIEGTVVESLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----QNGHQVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|153812440|ref|ZP_01965108.1| hypothetical protein RUMOBE_02839 [Ruminococcus obeum ATCC 29174]
 gi|253580642|ref|ZP_04857906.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|255282629|ref|ZP_05347184.1| translation initiation factor IF-1 [Bryantella formatexigens DSM
           14469]
 gi|149831365|gb|EDM86453.1| hypothetical protein RUMOBE_02839 [Ruminococcus obeum ATCC 29174]
 gi|251848013|gb|EES75979.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
 gi|255266922|gb|EET60127.1| translation initiation factor IF-1 [Bryantella formatexigens DSM
           14469]
 gi|291548002|emb|CBL21110.1| translation initiation factor IF-1 [Ruminococcus sp. SR1/5]
 gi|295109497|emb|CBL23450.1| translation initiation factor IF-1 [Ruminococcus obeum A2-162]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEVEGTVLEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENKHVVLAHISGKLRMNFIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|113869410|ref|YP_727899.1| translation initiation factor IF-1 [Ralstonia eutropha H16]
 gi|194291001|ref|YP_002006908.1| translation initiation factor if-1 [Cupriavidus taiwanensis LMG
           19424]
 gi|122946547|sp|Q0K640|IF12_RALEH RecName: Full=Translation initiation factor IF-1 2
 gi|113528186|emb|CAJ94531.1| translation initiation factor 1 (IF-1) [Ralstonia eutropha H16]
 gi|193224836|emb|CAQ70847.1| Translation initiation factor IF-1 [Cupriavidus taiwanensis LMG
           19424]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRTK 72


>gi|257095019|ref|YP_003168660.1| translation initiation factor IF-1 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257047543|gb|ACV36731.1| translation initiation factor IF-1 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEDLIEMQGEVIENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGFISGKMRMHYIRILPGDKVTVQLTPYDLSRARIVFRAK 72


>gi|325291924|ref|YP_004277788.1| translation initiation factor IF-1 [Agrobacterium sp. H13-3]
 gi|325059777|gb|ADY63468.1| translation initiation factor IF-1 [Agrobacterium sp. H13-3]
          Length = 99

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF GIV+ELLPNA FRVKL                                  
Sbjct: 28  MTKEEVLEFPGIVTELLPNATFRVKL---------------------------------- 53

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+++ RITYRFK
Sbjct: 54  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLSKGRITYRFK 99


>gi|315918289|ref|ZP_07914529.1| translation initiation factor 1 [Fusobacterium gonidiaformans ATCC
           25563]
 gi|317059781|ref|ZP_07924266.1| translation initiation factor 1 [Fusobacterium sp. 3_1_5R]
 gi|317061508|ref|ZP_07925993.1| translation initiation factor 1 [Fusobacterium sp. D12]
 gi|313685457|gb|EFS22292.1| translation initiation factor 1 [Fusobacterium sp. 3_1_5R]
 gi|313687184|gb|EFS24019.1| translation initiation factor 1 [Fusobacterium sp. D12]
 gi|313692164|gb|EFS28999.1| translation initiation factor 1 [Fusobacterium gonidiaformans ATCC
           25563]
          Length = 82

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 10  MSKKDVIELEGTILEALPNAMFKVEL---------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 36  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 81


>gi|190574287|ref|YP_001972132.1| translation initiation factor IF-1 [Stenotrophomonas maltophilia
           K279a]
 gi|194365704|ref|YP_002028314.1| translation initiation factor IF-1 [Stenotrophomonas maltophilia
           R551-3]
 gi|254522722|ref|ZP_05134777.1| translation initiation factor IF-1 [Stenotrophomonas sp. SKA14]
 gi|190012209|emb|CAQ45832.1| putative initiation factor IF-1 [Stenotrophomonas maltophilia
           K279a]
 gi|194348508|gb|ACF51631.1| translation initiation factor IF-1 [Stenotrophomonas maltophilia
           R551-3]
 gi|219720313|gb|EED38838.1| translation initiation factor IF-1 [Stenotrophomonas sp. SKA14]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRV+L                                  
Sbjct: 1   MSKDDSIEFEGTVSETLPNTTFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|305665116|ref|YP_003861403.1| translation initiation factor IF-1 [Maribacter sp. HTCC2170]
 gi|325287069|ref|YP_004262859.1| translation initiation factor IF-1 [Cellulophaga lytica DSM 7489]
 gi|88709868|gb|EAR02100.1| translation initiation factor IF-1 [Maribacter sp. HTCC2170]
 gi|324322523|gb|ADY29988.1| translation initiation factor IF-1 [Cellulophaga lytica DSM 7489]
          Length = 71

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|78776508|ref|YP_392823.1| translation initiation factor IF-1 [Sulfurimonas denitrificans DSM
           1251]
 gi|254458788|ref|ZP_05072212.1| translation initiation factor IF-1 [Campylobacterales bacterium GD
           1]
 gi|119371138|sp|Q30TU3|IF1_SULDN RecName: Full=Translation initiation factor IF-1
 gi|78497048|gb|ABB43588.1| bacterial translation initiation factor 1 (bIF-1) [Sulfurimonas
           denitrificans DSM 1251]
 gi|207084554|gb|EDZ61842.1| translation initiation factor IF-1 [Campylobacterales bacterium GD
           1]
          Length = 72

 Score =  111 bits (277), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKSDVIEVDGKIIEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AG+MR H I+I  GDKVK+ + PY + + RITYR+K
Sbjct: 27  ----ENGHIILCHIAGKMRMHYIKILPGDKVKLELTPYSLDKGRITYRYK 72


>gi|319787141|ref|YP_004146616.1| translation initiation factor IF-1 [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465653|gb|ADV27385.1| translation initiation factor IF-1 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 72

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G V E LPN  FRV+L                                  
Sbjct: 1   MSKDDSIEFEGTVIETLPNTTFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|291613257|ref|YP_003523414.1| translation initiation factor IF-1 [Sideroxydans lithotrophicus
           ES-1]
 gi|291583369|gb|ADE11027.1| translation initiation factor IF-1 [Sideroxydans lithotrophicus
           ES-1]
          Length = 72

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEDVIQMQGEVEESLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V ++PYD+++ARI +R K
Sbjct: 27  ----ENGFVVLGHISGKMRMHYIRILPGDKVTVEVSPYDLSKARIVFRAK 72


>gi|33594502|ref|NP_882146.1| translation initiation factor IF-1 [Bordetella pertussis Tohama I]
 gi|33594773|ref|NP_882416.1| translation initiation factor IF-1 [Bordetella parapertussis 12822]
 gi|33599045|ref|NP_886605.1| translation initiation factor IF-1 [Bordetella bronchiseptica RB50]
 gi|163859250|ref|YP_001633548.1| translation initiation factor IF-1 [Bordetella petrii DSM 12804]
 gi|187476569|ref|YP_784593.1| translation initiation factor IF-1 [Bordetella avium 197N]
 gi|293602602|ref|ZP_06685045.1| translation initiation factor IF-1 [Achromobacter piechaudii ATCC
           43553]
 gi|311109581|ref|YP_003982434.1| translation initiation factor IF-1 2 [Achromobacter xylosoxidans
           A8]
 gi|44888040|sp|Q7VTB0|IF12_BORPE RecName: Full=Translation initiation factor IF-1 2
 gi|44888042|sp|Q7W2D4|IF11_BORPA RecName: Full=Translation initiation factor IF-1 1
 gi|44888047|sp|Q7WRA2|IF11_BORBR RecName: Full=Translation initiation factor IF-1 1
 gi|119370808|sp|Q2L254|IF11_BORA1 RecName: Full=Translation initiation factor IF-1 1
 gi|33564578|emb|CAE43894.1| translation initiation factor IF-1 [Bordetella pertussis Tohama I]
 gi|33564849|emb|CAE39793.1| translation initiation factor IF-1 [Bordetella parapertussis]
 gi|33575091|emb|CAE30554.1| translation initiation factor IF-1 [Bordetella bronchiseptica RB50]
 gi|115421155|emb|CAJ47639.1| translation initiation factor IF-1 [Bordetella avium 197N]
 gi|163262978|emb|CAP45281.1| translation initiation factor IF-1 [Bordetella petrii]
 gi|292818974|gb|EFF78012.1| translation initiation factor IF-1 [Achromobacter piechaudii ATCC
           43553]
 gi|310764270|gb|ADP19719.1| translation initiation factor IF-1 2 [Achromobacter xylosoxidans
           A8]
 gi|332383913|gb|AEE68760.1| translation initiation factor IF-1 [Bordetella pertussis CS]
          Length = 72

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD+TRARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLTRARIVFRSK 72


>gi|149371650|ref|ZP_01891066.1| translation initiation factor IF-1 [unidentified eubacterium SCB49]
 gi|149355277|gb|EDM43837.1| translation initiation factor IF-1 [unidentified eubacterium SCB49]
          Length = 71

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQPAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|108796787|ref|YP_636426.1| translational initiation factor 1 [Staurastrum punctulatum]
 gi|61393555|gb|AAX45696.1| translational initiation factor 1 [Staurastrum punctulatum]
          Length = 84

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GIV+E LPNA FRV L                                  
Sbjct: 8   MRKQNLIEMEGIVTESLPNAMFRVCLD--------------------------------- 34

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++RK+ IRI LGD+VKV ++PYD+T+ RITYR +
Sbjct: 35  -----NGCQVLAHISGKIRKNYIRILLGDRVKVELSPYDLTKGRITYRLR 79


>gi|326332222|ref|ZP_08198502.1| translation initiation factor IF-1 [Nocardioidaceae bacterium
           Broad-1]
 gi|325949928|gb|EGD41988.1| translation initiation factor IF-1 [Nocardioidaceae bacterium
           Broad-1]
          Length = 82

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE  +E  G V E LPNA FRV+L                                    
Sbjct: 13  KEGVIEIEGTVVEALPNAMFRVELS----------------------------------- 37

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 38  ---NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 82


>gi|256831849|ref|YP_003160576.1| translation initiation factor IF-1 [Jonesia denitrificans DSM
           20603]
 gi|256685380|gb|ACV08273.1| translation initiation factor IF-1 [Jonesia denitrificans DSM
           20603]
          Length = 73

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGTVVEALPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|119944515|ref|YP_942195.1| translation initiation factor IF-1 [Psychromonas ingrahamii 37]
 gi|190359673|sp|A1SSY1|IF1_PSYIN RecName: Full=Translation initiation factor IF-1
 gi|119863119|gb|ABM02596.1| bacterial translation initiation factor 1 (bIF-1) [Psychromonas
           ingrahamii 37]
          Length = 72

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTIIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRAR 72


>gi|19704622|ref|NP_604184.1| protein translation initiation factor 1 [Fusobacterium nucleatum
           subsp. nucleatum ATCC 25586]
 gi|34764213|ref|ZP_00145070.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|254302861|ref|ZP_04970219.1| initiation factor IF1 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|256845562|ref|ZP_05551020.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_36A2]
 gi|19714922|gb|AAL95483.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|27886009|gb|EAA23328.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|148323053|gb|EDK88303.1| initiation factor IF1 [Fusobacterium nucleatum subsp. polymorphum
           ATCC 10953]
 gi|256719121|gb|EEU32676.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_36A2]
          Length = 82

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 10  MSKKDVIELEGTIVEALPNAMFKVEL---------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 36  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 81


>gi|126662243|ref|ZP_01733242.1| translation initiation factor IF-1 [Flavobacteria bacterium BAL38]
 gi|126625622|gb|EAZ96311.1| translation initiation factor IF-1 [Flavobacteria bacterium BAL38]
          Length = 71

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +VIA+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHIVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|94312227|ref|YP_585437.1| translation initiation factor IF-1 [Cupriavidus metallidurans CH34]
 gi|119370832|sp|Q1LI58|IF12_RALME RecName: Full=Translation initiation factor IF-1 2
 gi|93356079|gb|ABF10168.1| translation initiation factor IF-1 [Cupriavidus metallidurans CH34]
          Length = 72

 Score =  110 bits (276), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHIVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRTK 72


>gi|15900168|ref|NP_344772.1| translation initiation factor IF-1 [Streptococcus pneumoniae TIGR4]
 gi|111658779|ref|ZP_01409410.1| hypothetical protein SpneT_02000076 [Streptococcus pneumoniae
           TIGR4]
 gi|116517117|ref|YP_815734.1| translation initiation factor IF-1 [Streptococcus pneumoniae D39]
 gi|125717008|ref|YP_001034141.1| translation initiation factor IF-1 [Streptococcus sanguinis SK36]
 gi|148983631|ref|ZP_01816950.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP3-BS71]
 gi|148987969|ref|ZP_01819432.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP6-BS73]
 gi|148992809|ref|ZP_01822452.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP9-BS68]
 gi|148996654|ref|ZP_01824372.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP11-BS70]
 gi|149001661|ref|ZP_01826634.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP14-BS69]
 gi|149005983|ref|ZP_01829712.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP18-BS74]
 gi|149011102|ref|ZP_01832407.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP19-BS75]
 gi|149017922|ref|ZP_01834381.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168483869|ref|ZP_02708821.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC1873-00]
 gi|168486001|ref|ZP_02710509.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC1087-00]
 gi|168489709|ref|ZP_02713908.1| translation initiation factor IF-1 [Streptococcus pneumoniae SP195]
 gi|168492186|ref|ZP_02716329.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC0288-04]
 gi|168493926|ref|ZP_02718069.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC3059-06]
 gi|168576341|ref|ZP_02722224.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           MLV-016]
 gi|169834296|ref|YP_001693763.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|194396958|ref|YP_002036932.1| translation initiation factor IF-1 [Streptococcus pneumoniae G54]
 gi|221231135|ref|YP_002510287.1| translation initiation factor IF-1 [Streptococcus pneumoniae ATCC
           700669]
 gi|225853837|ref|YP_002735349.1| translation initiation factor IF-1 [Streptococcus pneumoniae JJA]
 gi|225855996|ref|YP_002737507.1| translation initiation factor IF-1 [Streptococcus pneumoniae P1031]
 gi|225858085|ref|YP_002739595.1| translation initiation factor IF-1 [Streptococcus pneumoniae 70585]
 gi|225860273|ref|YP_002741782.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|237649701|ref|ZP_04523953.1| translation initiation factor IF-1 [Streptococcus pneumoniae CCRI
           1974]
 gi|237821399|ref|ZP_04597244.1| translation initiation factor IF-1 [Streptococcus pneumoniae CCRI
           1974M2]
 gi|270292022|ref|ZP_06198237.1| bacterial protein translation initiation factor 1 (IF-1)
           [Streptococcus sp. M143]
 gi|289168710|ref|YP_003446979.1| translation initiation factor 1 (IF-1) [Streptococcus mitis B6]
 gi|293364325|ref|ZP_06611051.1| translation initiation factor IF1 [Streptococcus oralis ATCC 35037]
 gi|298230388|ref|ZP_06964069.1| translation initiation factor IF-1 [Streptococcus pneumoniae str.
           Canada MDR_19F]
 gi|298256009|ref|ZP_06979595.1| translation initiation factor IF-1 [Streptococcus pneumoniae str.
           Canada MDR_19A]
 gi|298502045|ref|YP_003723985.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303255073|ref|ZP_07341149.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS455]
 gi|303259283|ref|ZP_07345261.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP-BS293]
 gi|303261038|ref|ZP_07346987.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP14-BS292]
 gi|303263366|ref|ZP_07349289.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS397]
 gi|303265531|ref|ZP_07351431.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS457]
 gi|303267911|ref|ZP_07353713.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS458]
 gi|306825964|ref|ZP_07459300.1| translation initiation factor IF-1 [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|306828805|ref|ZP_07461997.1| translation initiation factor IF-1 [Streptococcus mitis ATCC 6249]
 gi|307066909|ref|YP_003875875.1| hypothetical protein SPAP_0280 [Streptococcus pneumoniae AP200]
 gi|307126451|ref|YP_003878482.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           670-6B]
 gi|307702708|ref|ZP_07639660.1| translation initiation factor IF-1 [Streptococcus oralis ATCC
           35037]
 gi|307704087|ref|ZP_07641016.1| translation initiation factor IF-1 [Streptococcus mitis SK597]
 gi|307708082|ref|ZP_07644550.1| translation initiation factor IF-1 [Streptococcus mitis NCTC 12261]
 gi|307709932|ref|ZP_07646379.1| translation initiation factor IF-1 [Streptococcus mitis SK564]
 gi|307711034|ref|ZP_07647456.1| translation initiation factor IF-1 [Streptococcus mitis SK321]
 gi|309799080|ref|ZP_07693333.1| translation initiation factor IF-1 [Streptococcus infantis SK1302]
 gi|312867034|ref|ZP_07727245.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           F0405]
 gi|315222797|ref|ZP_07864683.1| translation initiation factor IF-1 [Streptococcus anginosus F0211]
 gi|315612354|ref|ZP_07887267.1| translation initiation factor IF-1 [Streptococcus sanguinis ATCC
           49296]
 gi|319940038|ref|ZP_08014392.1| translation initiation factor IF-1 [Streptococcus anginosus
           1_2_62CV]
 gi|322375017|ref|ZP_08049531.1| translation initiation factor IF-1 [Streptococcus sp. C300]
 gi|322377208|ref|ZP_08051700.1| translation initiation factor IF-1 [Streptococcus sp. M334]
 gi|322386331|ref|ZP_08059961.1| translation initiation factor IF-1 [Streptococcus cristatus ATCC
           51100]
 gi|322388379|ref|ZP_08061982.1| translation initiation factor IF-1 [Streptococcus infantis ATCC
           700779]
 gi|322390682|ref|ZP_08064196.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           ATCC 903]
 gi|322391221|ref|ZP_08064693.1| translation initiation factor IF-1 [Streptococcus peroris ATCC
           700780]
 gi|323350962|ref|ZP_08086620.1| translation initiation factor IF-1 [Streptococcus sanguinis VMC66]
 gi|331267113|ref|YP_004326743.1| translation initiation factor IF-1 [Streptococcus oralis Uo5]
 gi|54037371|sp|P65122|IF1_STRR6 RecName: Full=Translation initiation factor IF-1
 gi|54041104|sp|P65121|IF1_STRPN RecName: Full=Translation initiation factor IF-1
 gi|122279380|sp|Q04ML4|IF1_STRP2 RecName: Full=Translation initiation factor IF-1
 gi|190359750|sp|A3CK86|IF1_STRSV RecName: Full=Translation initiation factor IF-1
 gi|14971701|gb|AAK74412.1| translation initiation factor IF-1 [Streptococcus pneumoniae TIGR4]
 gi|116077693|gb|ABJ55413.1| translation initiation factor IF-1 [Streptococcus pneumoniae D39]
 gi|125496925|gb|ABN43591.1| Translation initiation factor IF-1, putative [Streptococcus
           sanguinis SK36]
 gi|147757229|gb|EDK64268.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP11-BS70]
 gi|147760119|gb|EDK67108.1| 30S ribosomal protein S13 [Streptococcus pneumoniae SP14-BS69]
 gi|147762339|gb|EDK69300.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP18-BS74]
 gi|147764738|gb|EDK71668.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP19-BS75]
 gi|147923778|gb|EDK74890.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP3-BS71]
 gi|147926433|gb|EDK77506.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP6-BS73]
 gi|147928535|gb|EDK79550.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP9-BS68]
 gi|147931486|gb|EDK82464.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP23-BS72]
 gi|168996798|gb|ACA37410.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|172042874|gb|EDT50920.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC1873-00]
 gi|183570850|gb|EDT91378.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC1087-00]
 gi|183571811|gb|EDT92339.1| translation initiation factor IF-1 [Streptococcus pneumoniae SP195]
 gi|183573615|gb|EDT94143.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC0288-04]
 gi|183576123|gb|EDT96651.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           CDC3059-06]
 gi|183577896|gb|EDT98424.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           MLV-016]
 gi|194356625|gb|ACF55073.1| translation initiation factor IF-1 [Streptococcus pneumoniae G54]
 gi|220673595|emb|CAR68081.1| translation initiation factor IF-1 [Streptococcus pneumoniae ATCC
           700669]
 gi|225720176|gb|ACO16030.1| translation initiation factor IF-1 [Streptococcus pneumoniae 70585]
 gi|225724013|gb|ACO19866.1| translation initiation factor IF-1 [Streptococcus pneumoniae JJA]
 gi|225725275|gb|ACO21127.1| translation initiation factor IF-1 [Streptococcus pneumoniae P1031]
 gi|225727052|gb|ACO22903.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|270279550|gb|EFA25392.1| bacterial protein translation initiation factor 1 (IF-1)
           [Streptococcus sp. M143]
 gi|288908277|emb|CBJ23119.1| translation initiation factor 1 (IF-1) [Streptococcus mitis B6]
 gi|291317171|gb|EFE57598.1| translation initiation factor IF1 [Streptococcus oralis ATCC 35037]
 gi|298237640|gb|ADI68771.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301793504|emb|CBW35877.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           INV104]
 gi|301799380|emb|CBW31915.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           OXC141]
 gi|301801175|emb|CBW33848.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           INV200]
 gi|302597903|gb|EFL64973.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS455]
 gi|302637875|gb|EFL68361.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP14-BS292]
 gi|302639701|gb|EFL70158.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           SP-BS293]
 gi|302642607|gb|EFL72952.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS458]
 gi|302644971|gb|EFL75218.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS457]
 gi|302647139|gb|EFL77363.1| translation initiation factor IF-1 [Streptococcus pneumoniae BS397]
 gi|304428983|gb|EFM32071.1| translation initiation factor IF-1 [Streptococcus mitis ATCC 6249]
 gi|304431680|gb|EFM34660.1| translation initiation factor IF-1 [Streptococcus sp. oral taxon
           071 str. 73H25AP]
 gi|306408446|gb|ADM83873.1| hypothetical protein SPAP_0280 [Streptococcus pneumoniae AP200]
 gi|306483513|gb|ADM90382.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           670-6B]
 gi|307615867|gb|EFN95072.1| translation initiation factor IF-1 [Streptococcus mitis NCTC 12261]
 gi|307616996|gb|EFN96174.1| translation initiation factor IF-1 [Streptococcus mitis SK321]
 gi|307619303|gb|EFN98432.1| translation initiation factor IF-1 [Streptococcus mitis SK564]
 gi|307622377|gb|EFO01385.1| translation initiation factor IF-1 [Streptococcus mitis SK597]
 gi|307623824|gb|EFO02809.1| translation initiation factor IF-1 [Streptococcus oralis ATCC
           35037]
 gi|308117315|gb|EFO54738.1| translation initiation factor IF-1 [Streptococcus infantis SK1302]
 gi|311097516|gb|EFQ55749.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           F0405]
 gi|315188100|gb|EFU21829.1| translation initiation factor IF-1 [Streptococcus anginosus F0211]
 gi|315315335|gb|EFU63374.1| translation initiation factor IF-1 [Streptococcus sanguinis ATCC
           49296]
 gi|319810752|gb|EFW07079.1| translation initiation factor IF-1 [Streptococcus anginosus
           1_2_62CV]
 gi|321140692|gb|EFX36194.1| translation initiation factor IF-1 [Streptococcus infantis ATCC
           700779]
 gi|321142655|gb|EFX38119.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           ATCC 903]
 gi|321145974|gb|EFX41363.1| translation initiation factor IF-1 [Streptococcus peroris ATCC
           700780]
 gi|321269555|gb|EFX52485.1| translation initiation factor IF-1 [Streptococcus cristatus ATCC
           51100]
 gi|321280517|gb|EFX57556.1| translation initiation factor IF-1 [Streptococcus sp. C300]
 gi|321281921|gb|EFX58929.1| translation initiation factor IF-1 [Streptococcus sp. M334]
 gi|322122944|gb|EFX94650.1| translation initiation factor IF-1 [Streptococcus sanguinis VMC66]
 gi|324989980|gb|EGC21921.1| translation initiation factor IF-1 [Streptococcus sanguinis SK353]
 gi|324991837|gb|EGC23762.1| translation initiation factor IF-1 [Streptococcus sanguinis SK405]
 gi|324996273|gb|EGC28181.1| translation initiation factor IF-1 [Streptococcus sanguinis SK678]
 gi|325686427|gb|EGD28457.1| translation initiation factor IF-1 [Streptococcus sanguinis SK72]
 gi|325689209|gb|EGD31215.1| translation initiation factor IF-1 [Streptococcus sanguinis SK115]
 gi|325695788|gb|EGD37685.1| translation initiation factor IF-1 [Streptococcus sanguinis SK150]
 gi|325697998|gb|EGD39881.1| translation initiation factor IF-1 [Streptococcus sanguinis SK160]
 gi|326683785|emb|CBZ01403.1| translation initiation factor IF-1 [Streptococcus oralis Uo5]
 gi|327390650|gb|EGE88990.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA04375]
 gi|327458453|gb|EGF04809.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1]
 gi|327463700|gb|EGF10016.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1057]
 gi|327467357|gb|EGF12857.1| translation initiation factor IF-1 [Streptococcus sanguinis SK330]
 gi|327471720|gb|EGF17161.1| translation initiation factor IF-1 [Streptococcus sanguinis SK408]
 gi|327490441|gb|EGF22223.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1058]
 gi|328945195|gb|EGG39349.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1087]
 gi|332075896|gb|EGI86363.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA17570]
 gi|332076677|gb|EGI87139.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA17545]
 gi|332077532|gb|EGI87993.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA41301]
 gi|332202146|gb|EGJ16215.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA41317]
 gi|332203396|gb|EGJ17463.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA47368]
 gi|332204239|gb|EGJ18304.1| translation initiation factor IF-1 [Streptococcus pneumoniae
           GA47901]
 gi|332358900|gb|EGJ36722.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1056]
 gi|332363773|gb|EGJ41553.1| translation initiation factor IF-1 [Streptococcus sanguinis SK49]
 gi|332364012|gb|EGJ41790.1| translation initiation factor IF-1 [Streptococcus sanguinis SK1059]
 gi|332364985|gb|EGJ42753.1| translation initiation factor IF-1 [Streptococcus sanguinis SK355]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + +PNA F V+L                                  
Sbjct: 1   MAKDDVIEVEGKVVDTMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++RK+ IRI  GD+V V M+PYD+TR RITYRFK
Sbjct: 27  ----ENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK 72


>gi|124302941|ref|YP_001023736.1| translation initiation factor 1 [Angiopteris evecta]
 gi|190359546|sp|A2T368|IF1C_ANGEV RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|110628339|gb|ABG79635.1| translational initiation factor 1 [Angiopteris evecta]
          Length = 89

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  GIV+E LPNA FRV L                                  
Sbjct: 1   MKKQDLIDMEGIVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R++ IRI  GD+V+V ++PYD+T+ RI YR +
Sbjct: 28  -----NGCQVLTHISGKIRRNYIRILPGDRVRVELSPYDLTKGRIIYRLR 72


>gi|284926785|gb|ADC29137.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni IA3902]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNANF+V+L                                  
Sbjct: 1   MAKDDVIEIDGTVLEALPNANFKVELG--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H IRI  GDKVKV + PY + + RIT+R+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIRIMPGDKVKVELTPYSLDKGRITFRYK 72


>gi|297180256|gb|ADI16475.1| hypothetical protein [uncultured bacterium HF4000_05M23]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK+E +E  G+V+E LPNA F+++L                                  
Sbjct: 1   MPKKEAIEVEGLVNEALPNAFFKIELP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++RK+ IRI  GDKV V ++ YD+TR RITYRFK
Sbjct: 28  -----NGHEVLAHASGKIRKNFIRILPGDKVLVELSAYDLTRGRITYRFK 72


>gi|307720157|ref|YP_003891297.1| bacterial translation initiation factor 1 (bIF-1) [Sulfurimonas
           autotrophica DSM 16294]
 gi|306978250|gb|ADN08285.1| bacterial translation initiation factor 1 (bIF-1) [Sulfurimonas
           autotrophica DSM 16294]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKADVIEVDGKIIEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AG+MR H I+I  GDKVK+ + PY + + RITYR+K
Sbjct: 27  ----ENGHIILCHIAGKMRMHYIKILPGDKVKLELTPYSLDKGRITYRYK 72


>gi|304405592|ref|ZP_07387251.1| translation initiation factor IF-1 [Paenibacillus curdlanolyticus
           YK9]
 gi|304345631|gb|EFM11466.1| translation initiation factor IF-1 [Paenibacillus curdlanolyticus
           YK9]
          Length = 71

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGTVVEPLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   ++A+ +G++R H IRI  GDKV + ++PYD++R RITYR
Sbjct: 27  ----ENGHQILAHVSGKLRMHFIRILTGDKVVIQLSPYDLSRGRITYR 70


>gi|326317149|ref|YP_004234821.1| translation initiation factor IF-1 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323373985|gb|ADX46254.1| translation initiation factor IF-1 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 84

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|296137044|ref|YP_003644286.1| translation initiation factor IF-1 [Thiomonas intermedia K12]
 gi|294341221|emb|CAZ89622.1| protein chain initiation factor IF-1 [Thiomonas sp. 3As]
 gi|295797166|gb|ADG31956.1| translation initiation factor IF-1 [Thiomonas intermedia K12]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEILENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHTVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|225026387|ref|ZP_03715579.1| hypothetical protein EUBHAL_00636 [Eubacterium hallii DSM 3353]
 gi|224956276|gb|EEG37485.1| hypothetical protein EUBHAL_00636 [Eubacterium hallii DSM 3353]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEVEGKVVEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R + I+I  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHQVLGHISGKLRMNFIKILPGDKVTIELSPYDLTKGRIIWRDK 72


>gi|297242948|ref|ZP_06926886.1| translation initiation factor 1 (IF-1) [Gardnerella vaginalis AMD]
 gi|298253055|ref|ZP_06976847.1| translation initiation factor 1 (IF-1) [Gardnerella vaginalis 5-1]
 gi|311115145|ref|YP_003986366.1| translation initiation factor IF-1 [Gardnerella vaginalis ATCC
           14019]
 gi|296889159|gb|EFH27893.1| translation initiation factor 1 (IF-1) [Gardnerella vaginalis AMD]
 gi|297532450|gb|EFH71336.1| translation initiation factor 1 (IF-1) [Gardnerella vaginalis 5-1]
 gi|310946639|gb|ADP39343.1| translation initiation factor IF-1 [Gardnerella vaginalis ATCC
           14019]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGTVVEALPNAMFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+ R RITYR+K
Sbjct: 27  ----ENEHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLNRGRITYRYK 72


>gi|253722723|pdb|1AH9|A Chain A, The Structure Of The Translational Initiation Factor If1
           From Escherichia Coli, Nmr, 19 Structures
          Length = 71

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 48/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            KE+ +E  G V E LPN  FRV+L                                   
Sbjct: 1   AKEDNIEMQGTVLETLPNTMFRVEL----------------------------------- 25

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 26  ---ENGHVVTAHISGKMRKNYIRILTGDKVTVELTPYDLSKGRIVFRSR 71


>gi|300857805|ref|YP_003782788.1| translation initiation factor IF-1 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|300685259|gb|ADK28181.1| translation initiation factor IF-1 [Corynebacterium
           pseudotuberculosis FRC41]
 gi|302205540|gb|ADL09882.1| translation initiation factor IF-1 [Corynebacterium
           pseudotuberculosis C231]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 28  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLNRGRIVYRYK 72


>gi|212697276|ref|ZP_03305404.1| hypothetical protein ANHYDRO_01844 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325848787|ref|ZP_08170297.1| translation initiation factor IF-1 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
 gi|212675725|gb|EEB35332.1| hypothetical protein ANHYDRO_01844 [Anaerococcus hydrogenalis DSM
           7454]
 gi|325480431|gb|EGC83493.1| translation initiation factor IF-1 [Anaerococcus hydrogenalis
           ACS-025-V-Sch4]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E +G+V E LPNA F+V+L                                  
Sbjct: 1   MSKKDAIEVTGVVKEALPNAIFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GD V V ++PYD+T+ RIT+R K
Sbjct: 27  ----ENGHEIQAHISGKLRMNYIRILPGDTVTVELSPYDLTQGRITWRKK 72


>gi|330813608|ref|YP_004357847.1| translation initiation factor 1 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327486703|gb|AEA81108.1| translation initiation factor 1 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF+G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEMLEFNGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +N  ++A+++G++RK+RIR+  GDKV V + PYD+T+ RIT+R K
Sbjct: 27  ----ENNHEILAHSSGKLRKNRIRVLTGDKVLVEVTPYDLTKGRITFRLK 72


>gi|227871778|ref|ZP_03990183.1| initiation factor IF1 [Oribacterium sinus F0268]
 gi|227842379|gb|EEJ52604.1| initiation factor IF1 [Oribacterium sinus F0268]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E +G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEITGKVIEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDKVTIELSPYDLSKGRIIWRDK 72


>gi|251799618|ref|YP_003014349.1| translation initiation factor IF-1 [Paenibacillus sp. JDR-2]
 gi|247547244|gb|ACT04263.1| translation initiation factor IF-1 [Paenibacillus sp. JDR-2]
          Length = 71

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEDVIEVEGTVIEPLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   ++A+ +G++R H IRI  GDKV + ++PYD++R RITYR
Sbjct: 27  ----ENGHQILAHVSGKLRMHFIRILTGDKVVIQLSPYDLSRGRITYR 70


>gi|312795797|ref|YP_004028719.1| protein translation Initiation Factor 1 (IF-1) [Burkholderia
           rhizoxinica HKI 454]
 gi|312167572|emb|CBW74575.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Burkholderia rhizoxinica HKI 454]
          Length = 77

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 6   MAKDDVIQMQGEVIENLPNATFRVKL---------------------------------- 31

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GD+V V + PYD++RARI +R K
Sbjct: 32  ----ENGHVVLGHISGKMRMHYIRILPGDRVTVELTPYDLSRARIVFRAK 77


>gi|262283560|ref|ZP_06061325.1| translation initiation factor IF-1 [Streptococcus sp. 2_1_36FAA]
 gi|190359776|sp|A8AZK3|IF1_STRGC RecName: Full=Translation initiation factor IF-1
 gi|262260617|gb|EEY79318.1| translation initiation factor IF-1 [Streptococcus sp. 2_1_36FAA]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + +PNA F V+L                                  
Sbjct: 1   MAKDDVIEVEGKVIDTMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++RK+ IRI  GD+V V M+PYD+TR RITYRFK
Sbjct: 27  ----ENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK 72


>gi|217976944|ref|YP_002361091.1| translation initiation factor IF-1 [Methylocella silvestris BL2]
 gi|217502320|gb|ACK49729.1| translation initiation factor IF-1 [Methylocella silvestris BL2]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MSKEELLEFPGVVVELLPNATFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGKMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|319789261|ref|YP_004150894.1| translation initiation factor IF-1 [Thermovibrio ammonificans HB-1]
 gi|317113763|gb|ADU96253.1| translation initiation factor IF-1 [Thermovibrio ammonificans HB-1]
          Length = 85

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA F+V+L                                  
Sbjct: 14  MAKEKGIQVEGKVVEALPNAYFKVELD--------------------------------- 40

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MR H IRI  GD+V V ++PYD+TR RI YR
Sbjct: 41  -----NGHQVLAHASGKMRVHFIRILPGDRVVVELSPYDLTRGRIVYR 83


>gi|328544718|ref|YP_004304827.1| translation initiation factor IF-1-like protein [polymorphum gilvum
           SL003B-26A1]
 gi|326414460|gb|ADZ71523.1| putative Translation initiation factor IF-1-like protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GD+V V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDRVLVEMTPYDLTKGRITYRFK 72


>gi|296875382|ref|ZP_06899456.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           ATCC 15912]
 gi|319945813|ref|ZP_08020063.1| translation initiation factor IF-1 [Streptococcus australis ATCC
           700641]
 gi|296433575|gb|EFH19348.1| translation initiation factor IF-1 [Streptococcus parasanguinis
           ATCC 15912]
 gi|319747878|gb|EFW00122.1| translation initiation factor IF-1 [Streptococcus australis ATCC
           700641]
          Length = 82

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V + +PNA F V+L                                   
Sbjct: 12  AKDDVIEVEGKVVDTMPNAMFTVEL----------------------------------- 36

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++A  +G++RK+ IRI  GD+V V M+PYD+TR RITYRFK
Sbjct: 37  ---ENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK 82


>gi|325981826|ref|YP_004294228.1| translation initiation factor IF-1 [Nitrosomonas sp. AL212]
 gi|325531345|gb|ADZ26066.1| translation initiation factor IF-1 [Nitrosomonas sp. AL212]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEET++  G + E LPNA FRVKL                                  
Sbjct: 1   MAKEETIQMQGEILETLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GDKV V + PYD+TRARIT+R K
Sbjct: 27  ----ENGHIVLGHISGKMRMHYIRILPGDKVTVDLTPYDLTRARITFRAK 72


>gi|226939207|ref|YP_002794278.1| InfA2 [Laribacter hongkongensis HLHK9]
 gi|226714131|gb|ACO73269.1| InfA2 [Laribacter hongkongensis HLHK9]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKEDTIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GD+V V + PYD++RARI +R K
Sbjct: 27  ----ENGHIVLGHISGKMRMHYIRILPGDRVTVELTPYDLSRARIVFRSK 72


>gi|15964367|ref|NP_384720.1| translation initiation factor IF-1 [Sinorhizobium meliloti 1021]
 gi|163761347|ref|ZP_02168422.1| translation initiation factor IF-1 [Hoeflea phototrophica DFL-43]
 gi|222147502|ref|YP_002548459.1| translation initiation factor IF-1 [Agrobacterium vitis S4]
 gi|307307085|ref|ZP_07586824.1| translation initiation factor IF-1 [Sinorhizobium meliloti BL225C]
 gi|307321487|ref|ZP_07600883.1| translation initiation factor IF-1 [Sinorhizobium meliloti AK83]
 gi|20138493|sp|Q92S23|IF1_RHIME RecName: Full=Translation initiation factor IF-1
 gi|190359778|sp|A6U5Z0|IF1_SINMW RecName: Full=Translation initiation factor IF-1
 gi|15073544|emb|CAC45186.1| Probable translation initiation factor IF-1 protein [Sinorhizobium
           meliloti 1021]
 gi|162281504|gb|EDQ31800.1| translation initiation factor IF-1 [Hoeflea phototrophica DFL-43]
 gi|221734492|gb|ACM35455.1| translation initiation factor IF-1 [Agrobacterium vitis S4]
 gi|306892872|gb|EFN23662.1| translation initiation factor IF-1 [Sinorhizobium meliloti AK83]
 gi|306902025|gb|EFN32624.1| translation initiation factor IF-1 [Sinorhizobium meliloti BL225C]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|15597815|ref|NP_251309.1| translation initiation factor IF-1 [Pseudomonas aeruginosa PAO1]
 gi|26990712|ref|NP_746137.1| translation initiation factor IF-1 [Pseudomonas putida KT2440]
 gi|66046411|ref|YP_236252.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           syringae B728a]
 gi|70731243|ref|YP_260984.1| translation initiation factor IF-1 [Pseudomonas fluorescens Pf-5]
 gi|71737438|ref|YP_275266.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|77459811|ref|YP_349318.1| translation initiation factor IF-1 [Pseudomonas fluorescens Pf0-1]
 gi|104781334|ref|YP_607832.1| translation initiation factor IF-1 [Pseudomonas entomophila L48]
 gi|116050606|ref|YP_790575.1| translation initiation factor IF-1 [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|146282645|ref|YP_001172798.1| translation initiation factor IF-1 [Pseudomonas stutzeri A1501]
 gi|146307415|ref|YP_001187880.1| translation initiation factor IF-1 [Pseudomonas mendocina ymp]
 gi|148547061|ref|YP_001267163.1| translation initiation factor IF-1 [Pseudomonas putida F1]
 gi|152984281|ref|YP_001347952.1| translation initiation factor IF-1 [Pseudomonas aeruginosa PA7]
 gi|167034608|ref|YP_001669839.1| translation initiation factor IF-1 [Pseudomonas putida GB-1]
 gi|170722576|ref|YP_001750264.1| translation initiation factor IF-1 [Pseudomonas putida W619]
 gi|213970049|ref|ZP_03398181.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           T1]
 gi|218891220|ref|YP_002440086.1| translation initiation factor IF-1 [Pseudomonas aeruginosa LESB58]
 gi|226944900|ref|YP_002799973.1| translation initiation factor IF-1 [Azotobacter vinelandii DJ]
 gi|229591239|ref|YP_002873358.1| translation initiation factor IF-1 [Pseudomonas fluorescens SBW25]
 gi|237800561|ref|ZP_04589022.1| translation initiation factor IF-1 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|254235605|ref|ZP_04928928.1| initiation factor [Pseudomonas aeruginosa C3719]
 gi|254241052|ref|ZP_04934374.1| initiation factor [Pseudomonas aeruginosa 2192]
 gi|257485423|ref|ZP_05639464.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|289625411|ref|ZP_06458365.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289649306|ref|ZP_06480649.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289679170|ref|ZP_06500060.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           syringae FF5]
 gi|296388922|ref|ZP_06878397.1| translation initiation factor IF-1 [Pseudomonas aeruginosa PAb1]
 gi|298487535|ref|ZP_07005577.1| Translation initiation factor 1 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|301381404|ref|ZP_07229822.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302058402|ref|ZP_07249943.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           K40]
 gi|302130349|ref|ZP_07256339.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|302185008|ref|ZP_07261681.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           syringae 642]
 gi|312961672|ref|ZP_07776170.1| translation initiation factor IF-1 [Pseudomonas fluorescens WH6]
 gi|313107656|ref|ZP_07793839.1| initiation factor [Pseudomonas aeruginosa 39016]
 gi|325273420|ref|ZP_08139673.1| translation initiation factor IF-1 [Pseudomonas sp. TJI-51]
 gi|330503292|ref|YP_004380161.1| translation initiation factor IF-1 [Pseudomonas mendocina NK-01]
 gi|330810448|ref|YP_004354910.1| translation initiation factor IF-1 [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|54037368|sp|P65117|IF1_PSEPK RecName: Full=Translation initiation factor IF-1
 gi|54041102|sp|P65116|IF1_PSEAE RecName: Full=Translation initiation factor IF-1
 gi|75501534|sp|Q4ZRK8|IF1_PSEU2 RecName: Full=Translation initiation factor IF-1
 gi|119371090|sp|Q48H67|IF1_PSE14 RecName: Full=Translation initiation factor IF-1
 gi|119371092|sp|Q4K9U9|IF1_PSEF5 RecName: Full=Translation initiation factor IF-1
 gi|119371094|sp|Q3KA77|IF1_PSEPF RecName: Full=Translation initiation factor IF-1
 gi|122259729|sp|Q02NB1|IF1_PSEAB RecName: Full=Translation initiation factor IF-1
 gi|122985876|sp|Q1IBD7|IF1_PSEE4 RecName: Full=Translation initiation factor IF-1
 gi|190359668|sp|A6V4G7|IF1_PSEA7 RecName: Full=Translation initiation factor IF-1
 gi|190359669|sp|A4XUY2|IF1_PSEMY RecName: Full=Translation initiation factor IF-1
 gi|190359670|sp|A5W1G9|IF1_PSEP1 RecName: Full=Translation initiation factor IF-1
 gi|190359671|sp|B0KLX5|IF1_PSEPG RecName: Full=Translation initiation factor IF-1
 gi|190359672|sp|A4VLV5|IF1_PSEU5 RecName: Full=Translation initiation factor IF-1
 gi|9948685|gb|AAG06007.1|AE004690_7 initiation factor [Pseudomonas aeruginosa PAO1]
 gi|24985705|gb|AAN69601.1|AE016593_9 translation initiation factor IF-1 [Pseudomonas putida KT2440]
 gi|63257118|gb|AAY38214.1| Translation initiation factor IF-1 [Pseudomonas syringae pv.
           syringae B728a]
 gi|68345542|gb|AAY93148.1| translation initiation factor IF-1 [Pseudomonas fluorescens Pf-5]
 gi|71557991|gb|AAZ37202.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|77383814|gb|ABA75327.1| putative translation initiation factor IF-1 [Pseudomonas
           fluorescens Pf0-1]
 gi|95110321|emb|CAK15028.1| protein chain initiation factor IF-1 [Pseudomonas entomophila L48]
 gi|115585827|gb|ABJ11842.1| translation initiation factor IF-1 [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126167536|gb|EAZ53047.1| initiation factor [Pseudomonas aeruginosa C3719]
 gi|126194430|gb|EAZ58493.1| initiation factor [Pseudomonas aeruginosa 2192]
 gi|145570850|gb|ABP79956.1| translation initiation factor IF-1 [Pseudomonas stutzeri A1501]
 gi|145575616|gb|ABP85148.1| bacterial translation initiation factor 1 (bIF-1) [Pseudomonas
           mendocina ymp]
 gi|148511119|gb|ABQ77979.1| bacterial translation initiation factor 1 (bIF-1) [Pseudomonas
           putida F1]
 gi|150959439|gb|ABR81464.1| translation initiation factor IF-1 [Pseudomonas aeruginosa PA7]
 gi|166861096|gb|ABY99503.1| translation initiation factor IF-1 [Pseudomonas putida GB-1]
 gi|169760579|gb|ACA73895.1| translation initiation factor IF-1 [Pseudomonas putida W619]
 gi|213925153|gb|EEB58716.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           T1]
 gi|218771445|emb|CAW27212.1| initiation factor [Pseudomonas aeruginosa LESB58]
 gi|226719827|gb|ACO78998.1| translation initiation factor IF-1 [Azotobacter vinelandii DJ]
 gi|229363105|emb|CAY50111.1| putative translation initiation factor IF-1 [Pseudomonas
           fluorescens SBW25]
 gi|298157919|gb|EFH98997.1| Translation initiation factor 1 [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|310880341|gb|EFQ38935.1| initiation factor [Pseudomonas aeruginosa 39016]
 gi|311283931|gb|EFQ62514.1| translation initiation factor IF-1 [Pseudomonas fluorescens WH6]
 gi|313498104|gb|ADR59470.1| Translation initiation factor IF-1 [Pseudomonas putida BIRD-1]
 gi|320323774|gb|EFW79858.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327914|gb|EFW83919.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|324101447|gb|EGB99040.1| translation initiation factor IF-1 [Pseudomonas sp. TJI-51]
 gi|327378556|gb|AEA69906.1| Translation initiation factor IF-1 [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|327480903|gb|AEA84213.1| translation initiation factor IF-1 [Pseudomonas stutzeri DSM 4166]
 gi|328917578|gb|AEB58409.1| translation initiation factor IF-1 [Pseudomonas mendocina NK-01]
 gi|330866852|gb|EGH01561.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330875791|gb|EGH09940.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330881205|gb|EGH15354.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330889673|gb|EGH22334.1| translation initiation factor IF-1 [Pseudomonas syringae pv. mori
           str. 301020]
 gi|330900610|gb|EGH32029.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330940299|gb|EGH43419.1| translation initiation factor IF-1 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330954578|gb|EGH54838.1| translation initiation factor IF-1 [Pseudomonas syringae Cit 7]
 gi|330965610|gb|EGH65870.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|330981387|gb|EGH79490.1| translation initiation factor IF-1 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
 gi|330987927|gb|EGH86030.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331010741|gb|EGH90797.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331023421|gb|EGI03478.1| translation initiation factor IF-1 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE++ E  G V + LPN  FRV+L                                  
Sbjct: 1   MSKEDSFEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRAR 72


>gi|254480659|ref|ZP_05093906.1| translation initiation factor IF-1 [marine gamma proteobacterium
           HTCC2148]
 gi|214039242|gb|EEB79902.1| translation initiation factor IF-1 [marine gamma proteobacterium
           HTCC2148]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDQIEMEGEVIDTLPNTTFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+T+ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLTKGRITYRER 72


>gi|145299395|ref|YP_001142236.1| translation initiation factor IF-1 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|330829985|ref|YP_004392937.1| protein translation initiation factor 1 [Aeromonas veronii B565]
 gi|190359560|sp|A4SNL6|IF1_AERS4 RecName: Full=Translation initiation factor IF-1
 gi|190359601|sp|A0KJD8|IF1_AERHH RecName: Full=Translation initiation factor IF-1
 gi|142852167|gb|ABO90488.1| translation initiation factor IF-1 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|328805121|gb|AEB50320.1| Bacterial protein translation initiation factor 1 [Aeromonas
           veronii B565]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + E LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTILETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV VA+ PYD+++ RI +R +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVTVALTPYDLSKGRIVFRSR 72


>gi|146317752|ref|YP_001197464.1| translation initiation factor IF-1 [Streptococcus suis 05ZYH33]
 gi|146319943|ref|YP_001199654.1| translation initiation factor IF-1 [Streptococcus suis 98HAH33]
 gi|223933084|ref|ZP_03625077.1| translation initiation factor IF-1 [Streptococcus suis 89/1591]
 gi|253751011|ref|YP_003024152.1| translation initiation factor IF-1 [Streptococcus suis SC84]
 gi|253752911|ref|YP_003026051.1| translation initiation factor IF-1 [Streptococcus suis P1/7]
 gi|253754736|ref|YP_003027876.1| translation initiation factor IF-1 [Streptococcus suis BM407]
 gi|302023184|ref|ZP_07248395.1| translation initiation factor IF-1 [Streptococcus suis 05HAS68]
 gi|330831943|ref|YP_004400768.1| translation initiation factor IF-1 [Streptococcus suis ST3]
 gi|190359714|sp|A4VYR5|IF1_STRS2 RecName: Full=Translation initiation factor IF-1
 gi|190359715|sp|A4VSH5|IF1_STRSY RecName: Full=Translation initiation factor IF-1
 gi|145688558|gb|ABP89064.1| Translation initiation factor 1 (IF-1) [Streptococcus suis 05ZYH33]
 gi|145690749|gb|ABP91254.1| Translation initiation factor 1 (IF-1) [Streptococcus suis 98HAH33]
 gi|223898271|gb|EEF64639.1| translation initiation factor IF-1 [Streptococcus suis 89/1591]
 gi|251815300|emb|CAZ50868.1| translation initiation factor IF-1 [Streptococcus suis SC84]
 gi|251817200|emb|CAZ54923.1| translation initiation factor IF-1 [Streptococcus suis BM407]
 gi|251819156|emb|CAR44283.1| translation initiation factor IF-1 [Streptococcus suis P1/7]
 gi|292557554|gb|ADE30555.1| Translation initiation factor IF-1 [Streptococcus suis GZ1]
 gi|319757263|gb|ADV69205.1| translation initiation factor IF-1 [Streptococcus suis JS14]
 gi|329306166|gb|AEB80582.1| translation initiation factor IF-1 [Streptococcus suis ST3]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + +PNA F V+L                                  
Sbjct: 1   MAKEDVIEIEGKVVDTMPNAMFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++RK+ IRI +GD+V V ++PYD+TR RITYRFK
Sbjct: 27  ----ENGHQVLATVSGKIRKNYIRILVGDRVTVELSPYDLTRGRITYRFK 72


>gi|317152645|ref|YP_004120693.1| translation initiation factor IF-1 [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942896|gb|ADU61947.1| translation initiation factor IF-1 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEGITVQGTVEEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MRK RIR+  GD V V ++PYD+TR RIT+R
Sbjct: 27  ----ENGHSVLAHISGKMRKFRIRVMPGDTVTVELSPYDLTRGRITFR 70


>gi|149910270|ref|ZP_01898914.1| bacterial protein translation initiation factor 1 (IF-1) [Moritella
           sp. PE36]
 gi|149806630|gb|EDM66597.1| bacterial protein translation initiation factor 1 (IF-1) [Moritella
           sp. PE36]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIELQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV VA+ PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVALTPYDLSKGRIVFRAR 72


>gi|21242746|ref|NP_642328.1| translation initiation factor IF-1 [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78047607|ref|YP_363782.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84624068|ref|YP_451440.1| translation initiation factor IF-1 [Xanthomonas oryzae pv. oryzae
           MAFF 311018]
 gi|166712085|ref|ZP_02243292.1| translation initiation factor IF-1 [Xanthomonas oryzae pv.
           oryzicola BLS256]
 gi|289670483|ref|ZP_06491558.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|325919556|ref|ZP_08181570.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           gardneri ATCC 19865]
 gi|23821727|sp|Q8PL04|IF1_XANAC RecName: Full=Translation initiation factor IF-1
 gi|73920053|sp|Q5GZR5|IF1_XANOR RecName: Full=Translation initiation factor IF-1
 gi|119371140|sp|Q3BTY1|IF1_XANC5 RecName: Full=Translation initiation factor IF-1
 gi|119371141|sp|Q2P2R1|IF1_XANOM RecName: Full=Translation initiation factor IF-1
 gi|21108224|gb|AAM36864.1| initiation factor IF-1 [Xanthomonas axonopodis pv. citri str. 306]
 gi|78036037|emb|CAJ23728.1| initiation factor IF-1 [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|84368008|dbj|BAE69166.1| initiation factor IF-1 [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|325549965|gb|EGD20805.1| bacterial translation initiation factor 1 (bIF-1) [Xanthomonas
           gardneri ATCC 19865]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRVKL                                  
Sbjct: 1   MSKDDSIEFEGSVSETLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGHEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|110639513|ref|YP_679722.1| translation initiation factor IF-1 [Cytophaga hutchinsonii ATCC
           33406]
 gi|119370857|sp|Q11QD4|IF1_CYTH3 RecName: Full=Translation initiation factor IF-1
 gi|110282194|gb|ABG60380.1| bacterial translation initiation factor 1 (bIF-1) [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G + E L NA FRV+L                                  
Sbjct: 1   MSKQSSIEQDGKILEALSNAMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR + I+I  GDKV++ M+PYD+T+ RI +R+K
Sbjct: 28  -----NGHQVIAHISGKMRMNYIKILPGDKVRMEMSPYDLTKGRIVFRYK 72


>gi|308275776|gb|ADO25675.1| Translation initiation factor IF-1 [Corynebacterium
           pseudotuberculosis I19]
          Length = 96

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 25  MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 51

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 52  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLNRGRIVYRYK 96


>gi|307822305|ref|ZP_07652537.1| translation initiation factor IF-1 [Methylobacter tundripaludum
           SV96]
 gi|307736871|gb|EFO07716.1| translation initiation factor IF-1 [Methylobacter tundripaludum
           SV96]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDQIEMEGKVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRKH IRI  GD VKV M PYD+T+ RIT+R +
Sbjct: 27  ----ENGHIVTAHISGKMRKHYIRILTGDSVKVEMTPYDLTKGRITFRMR 72


>gi|83945209|ref|ZP_00957558.1| translation initiation factor IF-1 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83851379|gb|EAP89235.1| translation initiation factor IF-1 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G V ELLPNA F+VKL                                  
Sbjct: 1   MAKEELLEFPGEVVELLPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|325261517|ref|ZP_08128255.1| translation initiation factor IF-1 [Clostridium sp. D5]
 gi|324032971|gb|EGB94248.1| translation initiation factor IF-1 [Clostridium sp. D5]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MSKTDVIEIEGVVVEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + I+I  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHVVLAHISGKLRMNFIKILPGDKVTLEMSPYDLSKGRIVWRDK 72


>gi|28870516|ref|NP_793135.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|37999388|sp|Q87ZS2|IF1_PSESM RecName: Full=Translation initiation factor IF-1
 gi|28853764|gb|AAO56830.1| translation initiation factor IF-1 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|330972893|gb|EGH72959.1| translation initiation factor IF-1 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|331017257|gb|EGH97313.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE++ E  G V++ LPN  FRV+L                                  
Sbjct: 1   MSKEDSFEMEGTVADTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRAR 72


>gi|229818218|ref|ZP_04448500.1| hypothetical protein BIFANG_03516 [Bifidobacterium angulatum DSM
           20098]
 gi|229784469|gb|EEP20583.1| hypothetical protein BIFANG_03516 [Bifidobacterium angulatum DSM
           20098]
          Length = 72

 Score =  110 bits (276), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGQVVEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+TR RITYR+K
Sbjct: 27  ----ENKHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLTRGRITYRYK 72


>gi|74317481|ref|YP_315221.1| translation initiation factor IF-1 [Thiobacillus denitrificans ATCC
           25259]
 gi|119370833|sp|Q3SIV9|IF12_THIDA RecName: Full=Translation initiation factor IF-1 2
 gi|74056976|gb|AAZ97416.1| translation initiation factor IF-1 [Thiobacillus denitrificans ATCC
           25259]
          Length = 87

 Score =  110 bits (275), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G+V+E+LP   FRV L                                  
Sbjct: 1   MAKEEVIEMEGVVNEVLPQTRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + AY +G+MRKHRIRI  GDKV V M+PYD+T+ RI +R K
Sbjct: 28  -----NGFEITAYASGKMRKHRIRILAGDKVTVEMSPYDLTKGRINFRHK 72


>gi|270159550|ref|ZP_06188206.1| translation initiation factor IF-1 [Legionella longbeachae D-4968]
 gi|289165653|ref|YP_003455791.1| Translation initiation factor IF-1 [Legionella longbeachae NSW150]
 gi|269987889|gb|EEZ94144.1| translation initiation factor IF-1 [Legionella longbeachae D-4968]
 gi|288858826|emb|CBJ12740.1| Translation initiation factor IF-1 [Legionella longbeachae NSW150]
          Length = 73

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E +G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDHIEMAGTVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  ++ A+ +GRMRK+ IRI  GDKVKV + PYD+T+ RI +R K
Sbjct: 27  ----ENGHIITAHISGRMRKNYIRILTGDKVKVELTPYDLTKGRIIFRDK 72


>gi|89055363|ref|YP_510814.1| translation initiation factor IF-1 [Jannaschia sp. CCS1]
 gi|119371070|sp|Q28NC3|IF1_JANSC RecName: Full=Translation initiation factor IF-1
 gi|88864912|gb|ABD55789.1| bacterial translation initiation factor 1 (bIF-1) [Jannaschia sp.
           CCS1]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEEMLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFK 72


>gi|261856349|ref|YP_003263632.1| translation initiation factor IF-1 [Halothiobacillus neapolitanus
           c2]
 gi|261836818|gb|ACX96585.1| translation initiation factor IF-1 [Halothiobacillus neapolitanus
           c2]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDYIEMQGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +GRMRK+ IRI  GDKV V + PYD+T+ RI++R +
Sbjct: 27  ----ENGHIVTAHISGRMRKNYIRILTGDKVTVQLTPYDLTKGRISFRAR 72


>gi|260061918|ref|YP_003194998.1| translation initiation factor IF-1 [Robiginitalea biformata
           HTCC2501]
 gi|88786051|gb|EAR17220.1| translation initiation factor IF-1 [Robiginitalea biformata
           HTCC2501]
          Length = 71

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAPIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|291460741|ref|ZP_06600131.1| translation initiation factor IF-1 [Oribacterium sp. oral taxon 078
           str. F0262]
 gi|291416700|gb|EFE90419.1| translation initiation factor IF-1 [Oribacterium sp. oral taxon 078
           str. F0262]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E +G V E LPNA F+V+L                                  
Sbjct: 1   MSKSDVIEITGKVIEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GD+V + ++PYD+++ RI +R K
Sbjct: 27  ----ENGHQVLAHISGKLRMNYIRILPGDRVTIELSPYDLSKGRIIWRDK 72


>gi|171060598|ref|YP_001792947.1| translation initiation factor IF-1 [Leptothrix cholodnii SP-6]
 gi|170778043|gb|ACB36182.1| translation initiation factor IF-1 [Leptothrix cholodnii SP-6]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|197303835|ref|ZP_03168871.1| hypothetical protein RUMLAC_02574 [Ruminococcus lactaris ATCC
           29176]
 gi|197297128|gb|EDY31692.1| hypothetical protein RUMLAC_02574 [Ruminococcus lactaris ATCC
           29176]
 gi|291549397|emb|CBL25659.1| translation initiation factor IF-1 [Ruminococcus torques L2-14]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MSKTDVIEIEGVVVEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G++R + I+I  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHIVLAHISGKLRMNFIKILPGDKVTLEMSPYDLSKGRIVWRDK 72


>gi|283953797|ref|ZP_06371328.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 414]
 gi|283794838|gb|EFC33576.1| translation initiation factor IF-1 [Campylobacter jejuni subsp.
           jejuni 414]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNANF+V+L                                  
Sbjct: 1   MAKDDVIEIDGTVLESLPNANFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H IRI  GDKVKV + PY + + RIT+R+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIRIMPGDKVKVELTPYSLDKGRITFRYK 72


>gi|300779800|ref|ZP_07089656.1| translation initiation factor IF-1 [Corynebacterium genitalium ATCC
           33030]
 gi|300533910|gb|EFK54969.1| translation initiation factor IF-1 [Corynebacterium genitalium ATCC
           33030]
          Length = 91

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E L NA FRV+L                                  
Sbjct: 20  MAKEGAIEVEGRIIEPLKNAMFRVELD--------------------------------- 46

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RITYR+K
Sbjct: 47  -----NGHEVLAHISGKMRQHYIRILPEDRVVVELSPYDLERGRITYRYK 91


>gi|254496571|ref|ZP_05109439.1| translation initiation factor IF-1 [Legionella drancourtii LLAP12]
 gi|254354195|gb|EET12862.1| translation initiation factor IF-1 [Legionella drancourtii LLAP12]
          Length = 73

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E +G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDHIEMAGTVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +GRMRK+ IRI  GDKVKV + PYD+++ RI +R K
Sbjct: 27  ----ENGHVVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDK 72


>gi|149926587|ref|ZP_01914847.1| translation initiation factor IF-1 [Limnobacter sp. MED105]
 gi|149824516|gb|EDM83732.1| translation initiation factor IF-1 [Limnobacter sp. MED105]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMQGEVVENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|57339974|gb|AAW49974.1| hypothetical protein FTT0966 [synthetic construct]
          Length = 107

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPN  FRV+L                                  
Sbjct: 27  MAKEDCIEMEGVVLEALPNTMFRVEL---------------------------------- 52

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 53  ----ENGRIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK 98


>gi|319778704|ref|YP_004129617.1| Translation initiation factor 1 [Taylorella equigenitalis MCE9]
 gi|317108728|gb|ADU91474.1| Translation initiation factor 1 [Taylorella equigenitalis MCE9]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVIENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ +V+ + +G+MR H IRI  GDKV V + PYD+ R RI +R K
Sbjct: 27  ----ENDHIVLGHISGKMRMHYIRILPGDKVTVELTPYDLNRGRIVFRSK 72


>gi|241763915|ref|ZP_04761958.1| translation initiation factor IF-1 [Acidovorax delafieldii 2AN]
 gi|241366810|gb|EER61242.1| translation initiation factor IF-1 [Acidovorax delafieldii 2AN]
          Length = 82

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 27  ----ENGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|160900093|ref|YP_001565675.1| translation initiation factor IF-1 [Delftia acidovorans SPH-1]
 gi|160365677|gb|ABX37290.1| translation initiation factor IF-1 [Delftia acidovorans SPH-1]
          Length = 82

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 39/109 (35%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+T+ RIT+R 
Sbjct: 27  ----ENGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLTKGRITFRH 71


>gi|78189785|ref|YP_380123.1| translation initiation factor IF-1 [Chlorobium chlorochromatii
           CaD3]
 gi|119370848|sp|Q3APJ5|IF1_CHLCH RecName: Full=Translation initiation factor IF-1
 gi|78171984|gb|ABB29080.1| bacterial translation initiation factor 1 (bIF-1) [Chlorobium
           chlorochromatii CaD3]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G++ + LPNA F+VKL                                  
Sbjct: 1   MAKEESIEIEGVIVDALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKVKV ++PYD+T+ RITYR+K
Sbjct: 27  ----ENGLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDITKGRITYRYK 72


>gi|332524575|ref|ZP_08400779.1| translation initiation factor IF-1 [Rubrivivax benzoatilyticus JA2]
 gi|332107888|gb|EGJ09112.1| translation initiation factor IF-1 [Rubrivivax benzoatilyticus JA2]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEILENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|269123120|ref|YP_003305697.1| translation initiation factor IF-1 [Streptobacillus moniliformis
           DSM 12112]
 gi|268314446|gb|ACZ00820.1| translation initiation factor IF-1 [Streptobacillus moniliformis
           DSM 12112]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ LE  G + E LPNA F+V+L                                  
Sbjct: 1   MAKQDVLELEGEILEALPNAMFQVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + +G+MR + I+I  GDKV V ++PYD++R RI YR K
Sbjct: 27  ----ENGHVLLGHISGKMRMNYIKILPGDKVTVEVSPYDLSRGRIVYRKK 72


>gi|153816228|ref|ZP_01968896.1| hypothetical protein RUMTOR_02477 [Ruminococcus torques ATCC 27756]
 gi|317501796|ref|ZP_07959982.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331088683|ref|ZP_08337593.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145846411|gb|EDK23329.1| hypothetical protein RUMTOR_02477 [Ruminococcus torques ATCC 27756]
 gi|316896829|gb|EFV18914.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330407206|gb|EGG86709.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGVVVEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ +G++R + I+I  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHIVLAHISGKLRMNFIKILPGDKVTLEMSPYDLSKGRIIWRDK 72


>gi|89902969|ref|YP_525440.1| translation initiation factor IF-1 [Rhodoferax ferrireducens T118]
 gi|91786406|ref|YP_547358.1| translation initiation factor IF-1 [Polaromonas sp. JS666]
 gi|119370817|sp|Q12G82|IF11_POLSJ RecName: Full=Translation initiation factor IF-1 1
 gi|119371099|sp|Q21QP4|IF1_RHOFD RecName: Full=Translation initiation factor IF-1
 gi|89347706|gb|ABD71909.1| bacterial translation initiation factor 1 (bIF-1) [Rhodoferax
           ferrireducens T118]
 gi|91695631|gb|ABE42460.1| bacterial translation initiation factor 1 (bIF-1) [Polaromonas sp.
           JS666]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMQGEVVENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|78186091|ref|YP_374134.1| translation initiation factor IF-1 [Chlorobium luteolum DSM 273]
 gi|110598109|ref|ZP_01386387.1| translation initiation factor IF-1 [Chlorobium ferrooxidans DSM
           13031]
 gi|119371088|sp|Q3B6E0|IF1_PELLD RecName: Full=Translation initiation factor IF-1
 gi|78165993|gb|ABB23091.1| bacterial translation initiation factor 1 (bIF-1) [Chlorobium
           luteolum DSM 273]
 gi|110340241|gb|EAT58738.1| translation initiation factor IF-1 [Chlorobium ferrooxidans DSM
           13031]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 55/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G++ E LPNA F+VKL                                  
Sbjct: 1   MAKEEAIEIEGVILEALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  V+A+ +G++R H IRI  GDKVKV ++PYD+++ RITYR+K
Sbjct: 27  ----ENSLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRYK 72


>gi|304393255|ref|ZP_07375183.1| translation initiation factor IF-1 [Ahrensia sp. R2A130]
 gi|303294262|gb|EFL88634.1| translation initiation factor IF-1 [Ahrensia sp. R2A130]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G VSELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGTVSELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GD+V V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDQVLVEMTPYDLTKGRITYRFK 72


>gi|300775035|ref|ZP_07084898.1| translation initiation factor IF-1 [Chryseobacterium gleum ATCC
           35910]
 gi|300506850|gb|EFK37985.1| translation initiation factor IF-1 [Chryseobacterium gleum ATCC
           35910]
          Length = 71

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 53/109 (48%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQKHIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  ++IA+ +G+MR H I++  GDKVK+ M+PYD+T+ RIT+R+
Sbjct: 27  ----ENGHILIAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKGRITFRY 71


>gi|292493705|ref|YP_003529144.1| translation initiation factor IF-1 [Nitrosococcus halophilus Nc4]
 gi|291582300|gb|ADE16757.1| translation initiation factor IF-1 [Nitrosococcus halophilus Nc4]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G V + LPN  FRV+L                                  
Sbjct: 1   MAKEESIEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  ++ A+ +G+MRKH IRI  GD+V V + PYD+++ RI YR +
Sbjct: 27  ----ENGHIITAHISGKMRKHYIRILTGDRVTVQLTPYDLSKGRIVYRSR 72


>gi|255536133|ref|YP_003096504.1| Translation initiation factor 1 [Flavobacteriaceae bacterium
           3519-10]
 gi|255342329|gb|ACU08442.1| Translation initiation factor 1 [Flavobacteriaceae bacterium
           3519-10]
          Length = 71

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G+++E L NA FRV+L                                  
Sbjct: 1   MAKQKHIEQDGVITEALSNAQFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  ++IA+ +G+MR H I++  GDKVK+ ++PYD+++ RIT+R+
Sbjct: 27  ----ENGHILIAHISGKMRMHYIKLLPGDKVKLELSPYDLSKGRITFRY 71


>gi|260589254|ref|ZP_05855167.1| translation initiation factor IF-1 [Blautia hansenii DSM 20583]
 gi|331082661|ref|ZP_08331784.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260540335|gb|EEX20904.1| translation initiation factor IF-1 [Blautia hansenii DSM 20583]
 gi|330400280|gb|EGG79922.1| translation initiation factor IF-1 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEVEGTVLEKLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G++R + IRI  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENKHVILAHISGKLRMNFIRILPGDKVTIEMSPYDLSKGRIIWRDK 72


>gi|253995739|ref|YP_003047803.1| translation initiation factor IF-1 [Methylotenera mobilis JLW8]
 gi|253982418|gb|ACT47276.1| translation initiation factor IF-1 [Methylotenera mobilis JLW8]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + E LPNA FRVKL                                  
Sbjct: 1   MAKEDRIEMQGEILENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ Y +G+MR H IRI  GDKV V M PYD++RARIT+R K
Sbjct: 27  ----ENGHVVLGYISGKMRMHYIRILPGDKVTVEMTPYDLSRARITFRAK 72


>gi|110834147|ref|YP_693006.1| translation initiation factor IF-1 [Alcanivorax borkumensis SK2]
 gi|254427493|ref|ZP_05041200.1| translation initiation factor IF-1 [Alcanivorax sp. DG881]
 gi|119370838|sp|Q0VQ14|IF1_ALCBS RecName: Full=Translation initiation factor IF-1
 gi|110647258|emb|CAL16734.1| translation initiation factor IF-1 [Alcanivorax borkumensis SK2]
 gi|196193662|gb|EDX88621.1| translation initiation factor IF-1 [Alcanivorax sp. DG881]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G++ + LPN  FRVKL                                  
Sbjct: 1   MAKEEQIELEGVIVDTLPNTMFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MRK  IRI  GD+VKV M+PYD+T+ RIT+R K
Sbjct: 28  -----NGHVITAHISGKMRKFYIRILTGDRVKVEMSPYDLTKGRITFRMK 72


>gi|21223104|ref|NP_628883.1| translation initiation factor IF-1 [Streptomyces coelicolor A3(2)]
 gi|29831492|ref|NP_826126.1| translation initiation factor IF-1 [Streptomyces avermitilis
           MA-4680]
 gi|239929491|ref|ZP_04686444.1| translation initiation factor IF-1 [Streptomyces ghanaensis ATCC
           14672]
 gi|239980033|ref|ZP_04702557.1| translation initiation factor IF-1 [Streptomyces albus J1074]
 gi|256785800|ref|ZP_05524231.1| translation initiation factor IF-1 [Streptomyces lividans TK24]
 gi|289769692|ref|ZP_06529070.1| translation initiation factor IF-1 [Streptomyces lividans TK24]
 gi|290958128|ref|YP_003489310.1| translational initiation factor IF1 [Streptomyces scabiei 87.22]
 gi|291437816|ref|ZP_06577206.1| translation initiation factor IF-1 [Streptomyces ghanaensis ATCC
           14672]
 gi|291451890|ref|ZP_06591280.1| translational initiation factor IF1 [Streptomyces albus J1074]
 gi|294630916|ref|ZP_06709476.1| translation initiation factor IF-1 [Streptomyces sp. e14]
 gi|295838427|ref|ZP_06825360.1| translation initiation factor IF-1 [Streptomyces sp. SPB74]
 gi|297201752|ref|ZP_06919149.1| translation initiation factor IF-1 [Streptomyces sviceus ATCC
           29083]
 gi|302519636|ref|ZP_07271978.1| translation initiation factor IF-1 [Streptomyces sp. SPB78]
 gi|302553565|ref|ZP_07305907.1| translation initiation factor IF-1 [Streptomyces viridochromogenes
           DSM 40736]
 gi|318058105|ref|ZP_07976828.1| translation initiation factor IF-1 [Streptomyces sp. SA3_actG]
 gi|318076042|ref|ZP_07983374.1| translation initiation factor IF-1 [Streptomyces sp. SA3_actF]
 gi|329938209|ref|ZP_08287660.1| translational initiation factor IF1 [Streptomyces griseoaurantiacus
           M045]
 gi|333026535|ref|ZP_08454599.1| putative translation initiation factor IF-1 [Streptomyces sp.
           Tu6071]
 gi|44888839|sp|P60516|IF11_STRAW RecName: Full=Translation initiation factor IF-1 1
 gi|48474229|sp|P60515|IF1_STRCO RecName: Full=Translation initiation factor IF-1
 gi|3449237|emb|CAA20381.1| translational initiation factor IF1 [Streptomyces coelicolor A3(2)]
 gi|29608608|dbj|BAC72661.1| putative translation initiation factor IF-1 [Streptomyces
           avermitilis MA-4680]
 gi|197695775|gb|EDY42708.1| translation initiation factor IF-1 [Streptomyces sp. SPB74]
 gi|197710873|gb|EDY54907.1| translation initiation factor IF-1 [Streptomyces sviceus ATCC
           29083]
 gi|260647654|emb|CBG70759.1| translational initiation factor IF1 [Streptomyces scabiei 87.22]
 gi|289699891|gb|EFD67320.1| translation initiation factor IF-1 [Streptomyces lividans TK24]
 gi|291340711|gb|EFE67667.1| translation initiation factor IF-1 [Streptomyces ghanaensis ATCC
           14672]
 gi|291354839|gb|EFE81741.1| translational initiation factor IF1 [Streptomyces albus J1074]
 gi|292834249|gb|EFF92598.1| translation initiation factor IF-1 [Streptomyces sp. e14]
 gi|302428531|gb|EFL00347.1| translation initiation factor IF-1 [Streptomyces sp. SPB78]
 gi|302471183|gb|EFL34276.1| translation initiation factor IF-1 [Streptomyces viridochromogenes
           DSM 40736]
 gi|329302698|gb|EGG46588.1| translational initiation factor IF1 [Streptomyces griseoaurantiacus
           M045]
 gi|332746387|gb|EGJ76828.1| putative translation initiation factor IF-1 [Streptomyces sp.
           Tu6071]
          Length = 73

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K +  +E  G V E LPNA F+V+L                                 
Sbjct: 1   MAKKQGAIEIEGTVVESLPNAMFKVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----QNGHQVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|83943980|ref|ZP_00956437.1| translation initiation factor IF-1 [Sulfitobacter sp. EE-36]
 gi|83954554|ref|ZP_00963265.1| translation initiation factor IF-1 [Sulfitobacter sp. NAS-14.1]
 gi|83840838|gb|EAP80009.1| translation initiation factor IF-1 [Sulfitobacter sp. NAS-14.1]
 gi|83845227|gb|EAP83107.1| translation initiation factor IF-1 [Sulfitobacter sp. EE-36]
          Length = 72

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLEF GIV ELLPNA FRV+L                                  
Sbjct: 1   MAKEDTLEFPGIVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+++ RI YRFK
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLSKGRINYRFK 72


>gi|225175651|ref|ZP_03729645.1| translation initiation factor IF-1 [Dethiobacter alkaliphilus AHT
           1]
 gi|225168980|gb|EEG77780.1| translation initiation factor IF-1 [Dethiobacter alkaliphilus AHT
           1]
          Length = 73

 Score =  110 bits (275), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 51/108 (47%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +E  G V E LPNA FRV+L                                    
Sbjct: 4   KKDVIEVEGTVIEPLPNAMFRVEL------------------------------------ 27

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G++R H IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 28  --KNGHKVLAHVSGKIRMHFIRILPGDRVLVELSPYDLTRGRITYRYK 73


>gi|313158307|gb|EFR57709.1| translation initiation factor IF-1 [Alistipes sp. HGB5]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIERDGTIIEALSNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H I+I  GDKVKV M PYD+T+ RI++R+K
Sbjct: 28  -----NGHVLTAHISGKMRMHYIKILPGDKVKVEMTPYDLTKGRISFRYK 72


>gi|169830459|ref|YP_001716441.1| translation initiation factor IF-1 [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169637303|gb|ACA58809.1| translation initiation factor IF-1 [Candidatus Desulforudis
           audaxviator MP104C]
          Length = 73

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 33/108 (30%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +E  G V E LPNA FRV+L                                    
Sbjct: 4   KQDVIEVEGKVVEPLPNAMFRVELP----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G++R + IRI  GD+V V ++PYD++R RI YR+K
Sbjct: 29  ---NGHKVLAHVSGKIRMNFIRILPGDRVMVELSPYDLSRGRIVYRYK 73


>gi|326794633|ref|YP_004312453.1| translation initiation factor IF-1 [Marinomonas mediterranea MMB-1]
 gi|326545397|gb|ADZ90617.1| Translation initiation factor IF-1 [Marinomonas mediterranea MMB-1]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMEGTIIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRGR 72


>gi|227497204|ref|ZP_03927452.1| initiation factor IF1 [Actinomyces urogenitalis DSM 15434]
 gi|320533217|ref|ZP_08033931.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|325068055|ref|ZP_08126728.1| translation initiation factor IF-1 [Actinomyces oris K20]
 gi|326773987|ref|ZP_08233269.1| translation initiation factor IF-1 [Actinomyces viscosus C505]
 gi|329945753|ref|ZP_08293440.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 170
           str. F0386]
 gi|226833335|gb|EEH65718.1| initiation factor IF1 [Actinomyces urogenitalis DSM 15434]
 gi|320134567|gb|EFW26801.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 171
           str. F0337]
 gi|326636126|gb|EGE37030.1| translation initiation factor IF-1 [Actinomyces viscosus C505]
 gi|328528201|gb|EGF55179.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 170
           str. F0386]
          Length = 73

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEVEGSVVEALPNAMFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|237742283|ref|ZP_04572764.1| translation initiation factor 1 [Fusobacterium sp. 4_1_13]
 gi|237744170|ref|ZP_04574651.1| translation initiation factor 1 [Fusobacterium sp. 7_1]
 gi|260494244|ref|ZP_05814375.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_33]
 gi|294785149|ref|ZP_06750437.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_27]
 gi|229429931|gb|EEO40143.1| translation initiation factor 1 [Fusobacterium sp. 4_1_13]
 gi|229431399|gb|EEO41611.1| translation initiation factor 1 [Fusobacterium sp. 7_1]
 gi|260198390|gb|EEW95906.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_33]
 gi|294486863|gb|EFG34225.1| translation initiation factor IF-1 [Fusobacterium sp. 3_1_27]
          Length = 82

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ E LPNA F+V+L                                  
Sbjct: 10  MSKKDVIELEGVIVEALPNAMFKVEL---------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 36  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 81


>gi|90415920|ref|ZP_01223853.1| translation initiation factor [marine gamma proteobacterium
           HTCC2207]
 gi|90332294|gb|EAS47491.1| translation initiation factor [marine gamma proteobacterium
           HTCC2207]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +EF G V + LPN  FRVKL                                  
Sbjct: 1   MAKEDHIEFEGEVIDTLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ V+IA+ +G+MRKH IRI  GDKVKV M PYD+T+ RIT+R +
Sbjct: 27  ----ENDHVIIAHISGKMRKHYIRILTGDKVKVEMTPYDLTKGRITFRER 72


>gi|126726692|ref|ZP_01742532.1| translation initiation factor IF-1 [Rhodobacterales bacterium
           HTCC2150]
 gi|254451608|ref|ZP_05065045.1| translation initiation factor IF-1 [Octadecabacter antarcticus 238]
 gi|126704021|gb|EBA03114.1| translation initiation factor IF-1 [Rhodobacterales bacterium
           HTCC2150]
 gi|198266014|gb|EDY90284.1| translation initiation factor IF-1 [Octadecabacter antarcticus 238]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA F V+L                                  
Sbjct: 1   MAKEELLEFPGVVKELLPNATFLVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHTIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFK 72


>gi|86132565|ref|ZP_01051158.1| translation initiation factor IF-1 [Dokdonia donghaensis MED134]
 gi|332292494|ref|YP_004431103.1| translation initiation factor IF-1 [Krokinobacter diaphorus
           4H-3-7-5]
 gi|85816807|gb|EAQ37992.1| translation initiation factor IF-1 [Dokdonia donghaensis MED134]
 gi|332170580|gb|AEE19835.1| translation initiation factor IF-1 [Krokinobacter diaphorus
           4H-3-7-5]
          Length = 71

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|297171148|gb|ADI22158.1| hypothetical protein [uncultured gamma proteobacterium
           HF0200_24F15]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEEHIEMEGTVLENLPNTQFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GD+V V + PYD+T+ RITYR +
Sbjct: 28  -----NGHVVTAHISGKMRKNYIRILRGDRVIVQLTPYDLTKGRITYRAR 72


>gi|254490524|ref|ZP_05103710.1| translation initiation factor IF-1 [Methylophaga thiooxidans
           DMS010]
 gi|224464268|gb|EEF80531.1| translation initiation factor IF-1 [Methylophaga thiooxydans
           DMS010]
          Length = 72

 Score =  110 bits (275), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +EF G V + +PN  FRV+L                                  
Sbjct: 1   MAKEEHIEFEGTVIDTMPNTTFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV V + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVYRAR 72


>gi|294101652|ref|YP_003553510.1| translation initiation factor IF-1 [Aminobacterium colombiense DSM
           12261]
 gi|293616632|gb|ADE56786.1| translation initiation factor IF-1 [Aminobacterium colombiense DSM
           12261]
          Length = 73

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  K++ +E  G V E LPNA FRV+L                                 
Sbjct: 1   MANKDDVIEVRGTVIEPLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   ++A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 28  -----ENGHKILAHVSGKMRMHFIRILPGDKVLVEISPYDLTRGRIVYRYK 73


>gi|87199080|ref|YP_496337.1| translation initiation factor 1 [Novosphingobium aromaticivorans
           DSM 12444]
 gi|87134761|gb|ABD25503.1| bacterial translation initiation factor 1 (bIF-1) [Novosphingobium
           aromaticivorans DSM 12444]
          Length = 98

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 55/109 (50%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G V ELLPNA FRV+L                                  
Sbjct: 18  MAKEELLEMRGTVVELLPNAMFRVRL---------------------------------- 43

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                ++  ++ +TAG+MRK+RIR+ +GD+V V + PYD+T+ RITYRF
Sbjct: 44  ----ENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRF 88


>gi|52841997|ref|YP_095796.1| translation initiation factor IF-1 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54294657|ref|YP_127072.1| translation initiation factor IF-1 [Legionella pneumophila str.
           Lens]
 gi|54297683|ref|YP_124052.1| translation initiation factor IF-1 [Legionella pneumophila str.
           Paris]
 gi|148359314|ref|YP_001250521.1| translation initiation factor IF-1 [Legionella pneumophila str.
           Corby]
 gi|296107361|ref|YP_003619061.1| Translation initiation factor IF-1 [Legionella pneumophila 2300/99
           Alcoy]
 gi|59797493|sp|Q5WVS7|IF1_LEGPL RecName: Full=Translation initiation factor IF-1
 gi|59797494|sp|Q5X4E2|IF1_LEGPA RecName: Full=Translation initiation factor IF-1
 gi|59797499|sp|Q5ZUM3|IF1_LEGPH RecName: Full=Translation initiation factor IF-1
 gi|190359647|sp|A5ICS5|IF1_LEGPC RecName: Full=Translation initiation factor IF-1
 gi|52629108|gb|AAU27849.1| translation initiation factor IF-1 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53751468|emb|CAH12886.1| Translation initiation factor IF-1 [Legionella pneumophila str.
           Paris]
 gi|53754489|emb|CAH15973.1| Translation initiation factor IF-1 [Legionella pneumophila str.
           Lens]
 gi|148281087|gb|ABQ55175.1| translation initiation factor IF-1 [Legionella pneumophila str.
           Corby]
 gi|295649262|gb|ADG25109.1| Translation initiation factor IF-1 [Legionella pneumophila 2300/99
           Alcoy]
 gi|307610470|emb|CBX00041.1| translation initiation factor IF-1 [Legionella pneumophila 130b]
          Length = 73

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E +G V + LPN  FRV+L                                  
Sbjct: 1   MAKEDHIEMAGTVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +GRMRK+ IRI  GDKVKV + PYD+++ RI +R K
Sbjct: 27  ----ENGHIVTAHISGRMRKNYIRILTGDKVKVELTPYDLSKGRIIFRDK 72


>gi|91774656|ref|YP_544412.1| translation initiation factor IF-1 [Methylobacillus flagellatus KT]
 gi|253998036|ref|YP_003050099.1| translation initiation factor IF-1 [Methylovorus sp. SIP3-4]
 gi|313200102|ref|YP_004038760.1| translation initiation factor if-1 [Methylovorus sp. MP688]
 gi|119370815|sp|Q1H4L6|IF11_METFK RecName: Full=Translation initiation factor IF-1 1
 gi|91708643|gb|ABE48571.1| bacterial translation initiation factor 1 (bIF-1) [Methylobacillus
           flagellatus KT]
 gi|253984715|gb|ACT49572.1| translation initiation factor IF-1 [Methylovorus sp. SIP3-4]
 gi|312439418|gb|ADQ83524.1| translation initiation factor IF-1 [Methylovorus sp. MP688]
          Length = 72

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEDRIEMQGEVLENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ Y +G+MR H IRI  GDKV V M PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGYISGKMRMHYIRILPGDKVTVEMTPYDLSRARIIFRAK 72


>gi|258648137|ref|ZP_05735606.1| translation initiation factor IF-1 [Prevotella tannerae ATCC 51259]
 gi|260852018|gb|EEX71887.1| translation initiation factor IF-1 [Prevotella tannerae ATCC 51259]
          Length = 72

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GI+ E L NA FRV+L                                  
Sbjct: 1   MSKQLAIEQDGIIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVKV M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVKVEMSPYDLSKGRIVFRYK 72


>gi|237736193|ref|ZP_04566674.1| translation initiation factor 1 [Fusobacterium mortiferum ATCC
           9817]
 gi|253581365|ref|ZP_04858591.1| translation initiation factor 1 [Fusobacterium varium ATCC 27725]
 gi|317065058|ref|ZP_07929543.1| translation initiation factor 1 [Fusobacterium ulcerans ATCC 49185]
 gi|229421746|gb|EEO36793.1| translation initiation factor 1 [Fusobacterium mortiferum ATCC
           9817]
 gi|251836729|gb|EES65263.1| translation initiation factor 1 [Fusobacterium varium ATCC 27725]
 gi|313690734|gb|EFS27569.1| translation initiation factor 1 [Fusobacterium ulcerans ATCC 49185]
          Length = 82

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 10  MSKKDVIELEGTILEALPNAMFKVEL---------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 36  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 81


>gi|189347681|ref|YP_001944210.1| translation initiation factor IF-1 [Chlorobium limicola DSM 245]
 gi|189341828|gb|ACD91231.1| translation initiation factor IF-1 [Chlorobium limicola DSM 245]
          Length = 72

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G++ + LPNA F+VKL                                  
Sbjct: 1   MAKEEAIEIEGVIIDALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKVKV ++PYD+++ RITYR+K
Sbjct: 27  ----ENGLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRYK 72


>gi|269122558|ref|YP_003310735.1| translation initiation factor IF-1 [Sebaldella termitidis ATCC
           33386]
 gi|268616436|gb|ACZ10804.1| translation initiation factor IF-1 [Sebaldella termitidis ATCC
           33386]
          Length = 72

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F++KL                                  
Sbjct: 1   MAKQDVIELEGEILEALPNAMFKIKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR H I+I  GDKV V ++PYD++R RI YR K
Sbjct: 27  ----ENGHEILGHISGKMRMHYIKILPGDKVTVEISPYDLSRGRIIYRKK 72


>gi|303233226|ref|ZP_07319899.1| translation initiation factor IF-1 [Atopobium vaginae PB189-T1-4]
 gi|302480811|gb|EFL43898.1| translation initiation factor IF-1 [Atopobium vaginae PB189-T1-4]
          Length = 84

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 48/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V E LPNA F V+L                                   
Sbjct: 14  SKQDGIELEGTVLEPLPNAMFNVEL----------------------------------- 38

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++   +G++R + IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 39  ---ENGKTILCTISGKIRMNYIRILPGDRVTVEISPYDLTRGRITYRYK 84


>gi|121611726|ref|YP_999533.1| translation initiation factor IF-1 [Verminephrobacter eiseniae
           EF01-2]
 gi|190359721|sp|A1WSA8|IF1_VEREI RecName: Full=Translation initiation factor IF-1
 gi|121556366|gb|ABM60515.1| bacterial translation initiation factor 1 (bIF-1)
           [Verminephrobacter eiseniae EF01-2]
          Length = 83

 Score =  110 bits (274), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 38/109 (34%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMQGSVTEVLPDSRFRVTLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   +IAYT G+MRKH IRI  GDKV + M+PYD+++ RIT+R 
Sbjct: 28  -----NGHQLIAYTGGKMRKHHIRILAGDKVSLEMSPYDLSKGRITFRH 71


>gi|319952175|ref|YP_004163442.1| bacterial translation initiation factor 1 (bif-1) [Cellulophaga
           algicola DSM 14237]
 gi|319420835|gb|ADV47944.1| bacterial translation initiation factor 1 (bIF-1) [Cellulophaga
           algicola DSM 14237]
          Length = 71

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|87122216|ref|ZP_01078099.1| Translation initiation factor [Marinomonas sp. MED121]
 gi|86162536|gb|EAQ63818.1| Translation initiation factor [Marinomonas sp. MED121]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEESIEMEGTIIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRSR 72


>gi|302336358|ref|YP_003801565.1| bacterial translation initiation factor 1 (bIF-1) [Olsenella uli
           DSM 7084]
 gi|301320198|gb|ADK68685.1| bacterial translation initiation factor 1 (bIF-1) [Olsenella uli
           DSM 7084]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKQDGIELEGKVVEPLPNAMFNVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G++R + IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 27  ----ENGKTILCTISGKIRMNYIRILPGDRVVVEISPYDLTRGRITYRYK 72


>gi|221105232|ref|XP_002170882.1| PREDICTED: similar to translational initiation factor 1 [Hydra
           magnipapillata]
          Length = 71

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGSIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VVIA+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHVVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|169142822|ref|YP_001687246.1| translation initiation factor 1 [Aneura mirabilis]
 gi|190359545|sp|B0YPR0|IF1C_ANEMR RecName: Full=Translation initiation factor IF-1, plastid
 gi|153973848|gb|ABS54508.1| translational initiation factor 1 [Aneura mirabilis]
          Length = 78

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G+V+E LPNA FRV L                                  
Sbjct: 1   MKKQDLIDMEGVVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +GR+R++ IRI  GD+V+V  +PYD+T+ RITYR +
Sbjct: 28  -----NGCQVLTHISGRIRRNYIRILPGDRVRVESSPYDLTKGRITYRLR 72


>gi|29654498|ref|NP_820190.1| translation initiation factor IF-1 [Coxiella burnetii RSA 493]
 gi|153208633|ref|ZP_01946890.1| translation initiation factor IF-1 [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154705866|ref|YP_001424639.1| translation initiation factor IF-1 [Coxiella burnetii Dugway
           5J108-111]
 gi|161830848|ref|YP_001597057.1| translation initiation factor IF-1 [Coxiella burnetii RSA 331]
 gi|212212415|ref|YP_002303351.1| translation initiation factor IF-1 [Coxiella burnetii CbuG_Q212]
 gi|212218620|ref|YP_002305407.1| translation initiation factor IF-1 [Coxiella burnetii CbuK_Q154]
 gi|44888014|sp|Q83CD1|IF1_COXBU RecName: Full=Translation initiation factor IF-1
 gi|190359632|sp|A9KFQ0|IF1_COXBN RecName: Full=Translation initiation factor IF-1
 gi|190359633|sp|A9NDR7|IF1_COXBR RecName: Full=Translation initiation factor IF-1
 gi|29541765|gb|AAO90704.1| bacterial protein translation initiation factor 1 (IF-1) [Coxiella
           burnetii RSA 493]
 gi|120575894|gb|EAX32518.1| translation initiation factor IF-1 [Coxiella burnetii 'MSU Goat
           Q177']
 gi|154355152|gb|ABS76614.1| bacterial protein translation initiation factor 1 (IF-1) [Coxiella
           burnetii Dugway 5J108-111]
 gi|161762715|gb|ABX78357.1| translation initiation factor IF-1 [Coxiella burnetii RSA 331]
 gi|212010825|gb|ACJ18206.1| bacterial protein translation initiation factor 1 [Coxiella
           burnetii CbuG_Q212]
 gi|212012882|gb|ACJ20262.1| bacterial protein translation initiation factor 1 [Coxiella
           burnetii CbuK_Q154]
          Length = 83

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 48/108 (44%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G V + LPN  FRVKL                                  
Sbjct: 1   MAKEESIEMQGTVVDSLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +  VV A+ +GRMRKH IRI  GD V V + PYD+TR RI YR
Sbjct: 27  ----ENGHVVTAHISGRMRKHYIRILTGDAVTVELTPYDLTRGRIVYR 70


>gi|89070656|ref|ZP_01157929.1| translation initiation factor IF-1 [Oceanicola granulosus HTCC2516]
 gi|89043736|gb|EAR49939.1| translation initiation factor IF-1 [Oceanicola granulosus HTCC2516]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GD+V+V M PYD+T+ RI YRF+
Sbjct: 27  ----ENGHEIIAHTAGKMRKNRIRVLAGDRVQVEMTPYDLTKGRINYRFR 72


>gi|256371238|ref|YP_003109062.1| translation initiation factor IF-1 [Acidimicrobium ferrooxidans DSM
           10331]
 gi|256007822|gb|ACU53389.1| translation initiation factor IF-1 [Acidimicrobium ferrooxidans DSM
           10331]
          Length = 74

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 40/112 (35%), Positives = 53/112 (47%), Gaps = 40/112 (35%)

Query: 1   MPK--EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDG 58
           M K  E+T+   G V E LPNA FRV+L                                
Sbjct: 1   MAKGKEDTIVLEGTVVEPLPNAMFRVEL-------------------------------- 28

Query: 59  VDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                  +   V+A+++G+MR HRIRI  GD+V+V   PYD+TR RITYR+K
Sbjct: 29  ------ENGHKVLAHSSGKMRMHRIRILPGDRVQVEFTPYDLTRGRITYRYK 74


>gi|313206374|ref|YP_004045551.1| bacterial translation initiation factor 1 (bif-1) [Riemerella
           anatipestifer DSM 15868]
 gi|312445690|gb|ADQ82045.1| bacterial translation initiation factor 1 (bIF-1) [Riemerella
           anatipestifer DSM 15868]
 gi|315023685|gb|EFT36689.1| Translation initiation factor 1 [Riemerella anatipestifer RA-YM]
 gi|325336181|gb|ADZ12455.1| Translation initiation factor 1 (IF-1) [Riemerella anatipestifer
           RA-GD]
          Length = 71

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQKHIEQDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  V+IA+ +G+MR H I++  GDKVK+ ++PYD+++ RIT+R+
Sbjct: 27  ----ENGHVLIAHISGKMRMHYIKLLPGDKVKLELSPYDLSKGRITFRY 71


>gi|150008962|ref|YP_001303705.1| translation initiation factor IF-1 [Parabacteroides distasonis ATCC
           8503]
 gi|255014793|ref|ZP_05286919.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_7]
 gi|256841037|ref|ZP_05546544.1| translation initiation factor IF-1 [Parabacteroides sp. D13]
 gi|262383852|ref|ZP_06076988.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_33B]
 gi|298375805|ref|ZP_06985761.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_19]
 gi|301312011|ref|ZP_07217933.1| translation initiation factor IF-1 [Bacteroides sp. 20_3]
 gi|190359752|sp|A6LEG9|IF1_PARD8 RecName: Full=Translation initiation factor IF-1
 gi|149937386|gb|ABR44083.1| translation initiation factor IF-1 [Parabacteroides distasonis ATCC
           8503]
 gi|256736880|gb|EEU50207.1| translation initiation factor IF-1 [Parabacteroides sp. D13]
 gi|262294750|gb|EEY82682.1| translation initiation factor IF-1 [Bacteroides sp. 2_1_33B]
 gi|298266842|gb|EFI08499.1| translation initiation factor IF-1 [Bacteroides sp. 3_1_19]
 gi|300830113|gb|EFK60761.1| translation initiation factor IF-1 [Bacteroides sp. 20_3]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEKDGVIVEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKV+V M+PYD+++ RI +R+K
Sbjct: 27  ----ENGHEITAHISGKMRMHYIKILPGDKVRVEMSPYDLSKGRIAFRYK 72


>gi|134096300|ref|YP_001101375.1| translation initiation factor IF-1 [Herminiimonas arsenicoxydans]
 gi|152982888|ref|YP_001355080.1| translation initiation factor IF-1 [Janthinobacterium sp.
           Marseille]
 gi|300309477|ref|YP_003773569.1| translation initiation factor IF-1 [Herbaspirillum seropedicae
           SmR1]
 gi|329905508|ref|ZP_08274147.1| Translation initiation factor 1 [Oxalobacteraceae bacterium
           IMCC9480]
 gi|190359704|sp|A6T3I3|IF1_JANMA RecName: Full=Translation initiation factor IF-1
 gi|190359740|sp|A4G9R7|IF1_HERAR RecName: Full=Translation initiation factor IF-1
 gi|133740203|emb|CAL63254.1| Translation initiation factor IF-1 [Herminiimonas arsenicoxydans]
 gi|151282965|gb|ABR91375.1| translation initiation factor IF-1 [Janthinobacterium sp.
           Marseille]
 gi|300072262|gb|ADJ61661.1| translation initiation factor (IF-1) protein [Herbaspirillum
           seropedicae SmR1]
 gi|327547576|gb|EGF32377.1| Translation initiation factor 1 [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEILENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRTK 72


>gi|294814490|ref|ZP_06773133.1| Translation initiation factor IF-1 1 [Streptomyces clavuligerus
           ATCC 27064]
 gi|294327089|gb|EFG08732.1| Translation initiation factor IF-1 1 [Streptomyces clavuligerus
           ATCC 27064]
          Length = 88

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 48/108 (44%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K+  +E  G V E LPNA F+V+L                                    
Sbjct: 19  KQGAIEIEGTVIESLPNAMFKVEL------------------------------------ 42

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 43  --QNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 88


>gi|83814359|ref|YP_445188.1| translation initiation factor IF-1 [Salinibacter ruber DSM 13855]
 gi|294507072|ref|YP_003571130.1| translation initiation factor IF-1 [Salinibacter ruber M8]
 gi|119371110|sp|Q2S3P3|IF1_SALRD RecName: Full=Translation initiation factor IF-1
 gi|83755753|gb|ABC43866.1| translation initiation factor IF-1 [Salinibacter ruber DSM 13855]
 gi|294343400|emb|CBH24178.1| Translation initiation factor IF-1 [Salinibacter ruber M8]
          Length = 73

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKEEAIEKDGEVIEALPNAQFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G+MR + I+I  GD+VKV M+PYD+++ RI YR+K
Sbjct: 27  ----ENGHEILGLLSGKMRMNYIKILPGDRVKVEMSPYDLSKGRIVYRYK 72


>gi|88798705|ref|ZP_01114288.1| translation initiation factor IF-1 [Reinekea sp. MED297]
 gi|88778468|gb|EAR09660.1| translation initiation factor IF-1 [Reinekea sp. MED297]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + + LPN  FRVKL                                  
Sbjct: 1   MAKEDVIEMEGEILDTLPNTMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MRK+ IRI  GDKVKV + PYD+T+ RI YR +
Sbjct: 27  ----ENGHVITAHISGKMRKNYIRILTGDKVKVELTPYDLTKGRIVYRAR 72


>gi|296775720|gb|ADH42996.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_38M03]
          Length = 71

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 57/109 (52%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ETLEF G V+ELLPNA FRVKL                                  
Sbjct: 1   MAKQETLEFKGKVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +N  ++A+TAG++RK+RIR+  GD V V M PYD+T+ RIT+RF
Sbjct: 27  ----ENNHEILAHTAGKLRKNRIRVLAGDNVMVEMTPYDLTKGRITFRF 71


>gi|53723833|ref|YP_104145.1| translation initiation factor IF-1 [Burkholderia mallei ATCC 23344]
 gi|121598931|ref|YP_994435.1| translation initiation factor IF-1 [Burkholderia mallei SAVP1]
 gi|124383562|ref|YP_001027916.1| translation initiation factor IF-1 [Burkholderia mallei NCTC 10229]
 gi|126449519|ref|YP_001083011.1| translation initiation factor IF-1 [Burkholderia mallei NCTC 10247]
 gi|167001678|ref|ZP_02267470.1| translation initiation factor IF-1 [Burkholderia mallei PRL-20]
 gi|238562963|ref|ZP_04610321.1| translation initiation factor IF-1 [Burkholderia mallei GB8 horse
           4]
 gi|254174691|ref|ZP_04881352.1| translation initiation factor IF-1 [Burkholderia mallei ATCC 10399]
 gi|254201218|ref|ZP_04907582.1| translation initiation factor IF-1 [Burkholderia mallei FMH]
 gi|254206559|ref|ZP_04912910.1| translation initiation factor IF-1 [Burkholderia mallei JHU]
 gi|254357097|ref|ZP_04973371.1| translation initiation factor IF-1 [Burkholderia mallei 2002721280]
 gi|59797678|sp|Q62GM6|IF12_BURMA RecName: Full=Translation initiation factor IF-1 2
 gi|190359577|sp|A3MRX5|IF1_BURM7 RecName: Full=Translation initiation factor IF-1
 gi|190359578|sp|A2S7J7|IF1_BURM9 RecName: Full=Translation initiation factor IF-1
 gi|190359579|sp|A1V882|IF1_BURMS RecName: Full=Translation initiation factor IF-1
 gi|52427256|gb|AAU47849.1| translation initiation factor IF-1 [Burkholderia mallei ATCC 23344]
 gi|121227741|gb|ABM50259.1| translation initiation factor IF-1 [Burkholderia mallei SAVP1]
 gi|124291582|gb|ABN00851.1| translation initiation factor IF-1 [Burkholderia mallei NCTC 10229]
 gi|126242389|gb|ABO05482.1| translation initiation factor IF-1 [Burkholderia mallei NCTC 10247]
 gi|147747112|gb|EDK54188.1| translation initiation factor IF-1 [Burkholderia mallei FMH]
 gi|147752101|gb|EDK59167.1| translation initiation factor IF-1 [Burkholderia mallei JHU]
 gi|148026161|gb|EDK84246.1| translation initiation factor IF-1 [Burkholderia mallei 2002721280]
 gi|160695736|gb|EDP85706.1| translation initiation factor IF-1 [Burkholderia mallei ATCC 10399]
 gi|238521647|gb|EEP85097.1| translation initiation factor IF-1 [Burkholderia mallei GB8 horse
           4]
 gi|243062575|gb|EES44761.1| translation initiation factor IF-1 [Burkholderia mallei PRL-20]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEVIENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRIFPGDKVTVELTPYDLSRARIVFRAK 72


>gi|254462928|ref|ZP_05076344.1| translation initiation factor IF-1 [Rhodobacterales bacterium
           HTCC2083]
 gi|206679517|gb|EDZ44004.1| translation initiation factor IF-1 [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 72

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLEF G+V ELLPNA F V+L                                  
Sbjct: 1   MAKEDTLEFPGVVKELLPNATFLVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+++ RI YRFK
Sbjct: 27  ----ENGHTIIAHTAGKMRKNRIRVLAGDKVQVEMTPYDLSKGRINYRFK 72


>gi|72163021|ref|YP_290678.1| translation initiation factor IF-1 [Thermobifida fusca YX]
 gi|119371136|sp|Q47LL7|IF1_THEFY RecName: Full=Translation initiation factor IF-1
 gi|71916753|gb|AAZ56655.1| bacterial translation initiation factor 1 (bIF-1) [Thermobifida
           fusca YX]
          Length = 73

 Score =  110 bits (274), Expect = 8e-23,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEIEGTVIESLPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|319938484|ref|ZP_08012878.1| translation initiation factor IF-I [Coprobacillus sp. 29_1]
 gi|319806400|gb|EFW03067.1| translation initiation factor IF-I [Coprobacillus sp. 29_1]
          Length = 73

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K ++ +E    V E LPNA F+V+L                                 
Sbjct: 1   MAKKDDVIEVEATVLETLPNAMFQVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 + AV++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 29  ------NGAVILAHVSGKIRMNYIRILPGDKVTVEISPYDLTRGRITFRHK 73


>gi|182678650|ref|YP_001832796.1| translation initiation factor IF-1 [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182634533|gb|ACB95307.1| translation initiation factor IF-1 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRVKL                                  
Sbjct: 1   MSKEELLEFPGVVVELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGKMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|126640494|ref|YP_001083478.1| translation initiation factor IF-1 [Acinetobacter baumannii ATCC
           17978]
 gi|169797327|ref|YP_001715120.1| translation initiation factor IF-1 [Acinetobacter baumannii AYE]
 gi|184156751|ref|YP_001845090.1| translation initiation factor IF-1 [Acinetobacter baumannii ACICU]
 gi|213155859|ref|YP_002317904.1| translation initiation factor IF-1 [Acinetobacter baumannii AB0057]
 gi|215484764|ref|YP_002326999.1| translation initiation factor IF-1 [Acinetobacter baumannii
           AB307-0294]
 gi|226951927|ref|ZP_03822391.1| protein chain initiation factor IF-1 [Acinetobacter sp. ATCC 27244]
 gi|239500847|ref|ZP_04660157.1| translation initiation factor IF-1 [Acinetobacter baumannii AB900]
 gi|255321217|ref|ZP_05362383.1| translation initiation factor IF-1 [Acinetobacter radioresistens
           SK82]
 gi|260549156|ref|ZP_05823377.1| translation initiation factor IF-1 [Acinetobacter sp. RUH2624]
 gi|260556215|ref|ZP_05828434.1| translation initiation factor IF-1 [Acinetobacter baumannii ATCC
           19606]
 gi|262280846|ref|ZP_06058629.1| translation initiation factor IF-1 [Acinetobacter calcoaceticus
           RUH2202]
 gi|262374118|ref|ZP_06067395.1| translation initiation factor IF-1 [Acinetobacter junii SH205]
 gi|262375038|ref|ZP_06068272.1| translation initiation factor IF-1 [Acinetobacter lwoffii SH145]
 gi|262380097|ref|ZP_06073252.1| translation initiation factor IF-1 [Acinetobacter radioresistens
           SH164]
 gi|293610218|ref|ZP_06692519.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|294649188|ref|ZP_06726627.1| translation initiation factor IF-1 [Acinetobacter haemolyticus ATCC
           19194]
 gi|299771696|ref|YP_003733722.1| translation initiation factor IF-1 [Acinetobacter sp. DR1]
 gi|301346430|ref|ZP_07227171.1| translation initiation factor IF-1 [Acinetobacter baumannii AB056]
 gi|301511756|ref|ZP_07236993.1| translation initiation factor IF-1 [Acinetobacter baumannii AB058]
 gi|301594285|ref|ZP_07239293.1| translation initiation factor IF-1 [Acinetobacter baumannii AB059]
 gi|332852974|ref|ZP_08434484.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6013150]
 gi|332866408|ref|ZP_08436992.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6013113]
 gi|332873163|ref|ZP_08441120.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6014059]
 gi|190359554|sp|A3M1T2|IF1_ACIBT RecName: Full=Translation initiation factor IF-1
 gi|126386378|gb|ABO10876.1| protein chain initiation factor IF-1 [Acinetobacter baumannii ATCC
           17978]
 gi|169150254|emb|CAM88150.1| protein chain initiation factor IF-1 [Acinetobacter baumannii AYE]
 gi|183208345|gb|ACC55743.1| translation initiation factor IF-1 [Acinetobacter baumannii ACICU]
 gi|213055019|gb|ACJ39921.1| translation initiation factor IF-1 [Acinetobacter baumannii AB0057]
 gi|213986675|gb|ACJ56974.1| translation initiation factor IF-1 [Acinetobacter baumannii
           AB307-0294]
 gi|226837467|gb|EEH69850.1| protein chain initiation factor IF-1 [Acinetobacter sp. ATCC 27244]
 gi|255301771|gb|EET81022.1| translation initiation factor IF-1 [Acinetobacter radioresistens
           SK82]
 gi|260407884|gb|EEX01356.1| translation initiation factor IF-1 [Acinetobacter sp. RUH2624]
 gi|260410270|gb|EEX03569.1| translation initiation factor IF-1 [Acinetobacter baumannii ATCC
           19606]
 gi|262257746|gb|EEY76481.1| translation initiation factor IF-1 [Acinetobacter calcoaceticus
           RUH2202]
 gi|262298291|gb|EEY86205.1| translation initiation factor IF-1 [Acinetobacter radioresistens
           SH164]
 gi|262310051|gb|EEY91180.1| translation initiation factor IF-1 [Acinetobacter lwoffii SH145]
 gi|262311129|gb|EEY92216.1| translation initiation factor IF-1 [Acinetobacter junii SH205]
 gi|292824906|gb|EFF83670.1| translation initiation factor IF-1 [Acinetobacter haemolyticus ATCC
           19194]
 gi|292827450|gb|EFF85814.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|298701784|gb|ADI92349.1| translation initiation factor IF-1 [Acinetobacter sp. DR1]
 gi|322506643|gb|ADX02097.1| infA [Acinetobacter baumannii 1656-2]
 gi|323516518|gb|ADX90899.1| translation initiation factor IF-1 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|325124396|gb|ADY83919.1| protein chain initiation factor IF-1 [Acinetobacter calcoaceticus
           PHEA-2]
 gi|332728910|gb|EGJ60265.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6013150]
 gi|332734634|gb|EGJ65740.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6013113]
 gi|332738675|gb|EGJ69545.1| translation initiation factor IF-1 [Acinetobacter baumannii
           6014059]
          Length = 73

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 53/111 (47%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  KEE +EF G+V+E LPN  FRV+L                                 
Sbjct: 1   MANKEELIEFEGVVTETLPNTMFRVRL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   VIA+ +G+MRKH IRI  GD VKV M PYD+T+ RITYR +
Sbjct: 28  -----ENGHEVIAHISGKMRKHYIRILTGDSVKVEMTPYDLTKGRITYRAR 73


>gi|82701921|ref|YP_411487.1| translation initiation factor IF-1 [Nitrosospira multiformis ATCC
           25196]
 gi|119371084|sp|Q2YAX6|IF1_NITMU RecName: Full=Translation initiation factor IF-1
 gi|82409986|gb|ABB74095.1| bacterial translation initiation factor 1 (bIF-1) [Nitrosospira
           multiformis ATCC 25196]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEET++  G + E LPNA FRVKL                                  
Sbjct: 1   MAKEETIQMQGEILETLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR H IRI  GDKV V + PYD++RARIT+R K
Sbjct: 27  ----ENGHIVLGHISGKMRMHYIRILPGDKVTVDLTPYDLSRARITFRAK 72


>gi|269837118|ref|YP_003319346.1| translation initiation factor IF-1 [Sphaerobacter thermophilus DSM
           20745]
 gi|269786381|gb|ACZ38524.1| translation initiation factor IF-1 [Sphaerobacter thermophilus DSM
           20745]
          Length = 91

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/106 (33%), Positives = 50/106 (47%), Gaps = 38/106 (35%)

Query: 5   ETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPISY 64
           + +   G V+E LPNA FRV+L                                      
Sbjct: 24  DAITVEGRVAEALPNAMFRVELD------------------------------------- 46

Query: 65  LDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
            +   V+A+ AG+MRKH IR+  GD+V V ++PYD+TR RITYR++
Sbjct: 47  -NGHTVLAHLAGKMRKHFIRVLPGDRVVVELSPYDLTRGRITYRYR 91


>gi|237739950|ref|ZP_04570431.1| translation initiation factor 1 [Fusobacterium sp. 2_1_31]
 gi|294782958|ref|ZP_06748284.1| translation initiation factor IF-1 [Fusobacterium sp. 1_1_41FAA]
 gi|229421967|gb|EEO37014.1| translation initiation factor 1 [Fusobacterium sp. 2_1_31]
 gi|294481599|gb|EFG29374.1| translation initiation factor IF-1 [Fusobacterium sp. 1_1_41FAA]
          Length = 82

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 10  MSKKDVIELEGTIVEALPNAMFKVEL---------------------------------- 35

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 36  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 81


>gi|90021333|ref|YP_527160.1| translation initiation factor 1 [Saccharophagus degradans 2-40]
 gi|254786021|ref|YP_003073450.1| translation initiation factor IF-1 [Teredinibacter turnerae T7901]
 gi|119371109|sp|Q21K31|IF1_SACD2 RecName: Full=Translation initiation factor IF-1
 gi|89950933|gb|ABD80948.1| bacterial translation initiation factor 1 (bIF-1) [Saccharophagus
           degradans 2-40]
 gi|237684442|gb|ACR11706.1| translation initiation factor IF-1 [Teredinibacter turnerae T7901]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+  E  G V + LPN  FRVKL                                  
Sbjct: 1   MAKEDNFELEGEVIDTLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV M PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVEMTPYDLSKGRITYRAR 72


>gi|302330095|gb|ADL20289.1| Translation initiation factor IF-1 [Corynebacterium
           pseudotuberculosis 1002]
          Length = 98

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E LPNA FRV+L                                  
Sbjct: 27  MAKEGAIEVEGRIIEPLPNAMFRVELD--------------------------------- 53

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 54  -----NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLNRGRIVYRYK 98


>gi|294786435|ref|ZP_06751689.1| translation initiation factor IF-1 [Parascardovia denticolens
           F0305]
 gi|294790435|ref|ZP_06755593.1| translation initiation factor IF-1 [Scardovia inopinata F0304]
 gi|315225998|ref|ZP_07867786.1| translation initiation factor IF-1 [Parascardovia denticolens DSM
           10105]
 gi|294458332|gb|EFG26685.1| translation initiation factor IF-1 [Scardovia inopinata F0304]
 gi|294485268|gb|EFG32902.1| translation initiation factor IF-1 [Parascardovia denticolens
           F0305]
 gi|315120130|gb|EFT83262.1| translation initiation factor IF-1 [Parascardovia denticolens DSM
           10105]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKNDVIEVEGRVVEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+TR RITYR+K
Sbjct: 27  ----ENKHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLTRGRITYRYK 72


>gi|269925854|ref|YP_003322477.1| translation initiation factor IF-1 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789514|gb|ACZ41655.1| translation initiation factor IF-1 [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 73

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +E  G V E LPNA F+V+L                                    
Sbjct: 4   KKDVIEVEGKVVEALPNAMFKVQLD----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   ++A+ +G++R + IRI  GD+V V ++PYD+TR RITYR++
Sbjct: 29  ---NGHEILAHVSGKIRLNFIRILPGDRVLVELSPYDLTRGRITYRYR 73


>gi|150025386|ref|YP_001296212.1| translation initiation factor IF-1 [Flavobacterium psychrophilum
           JIP02/86]
 gi|190359644|sp|A6GZ78|IF1_FLAPJ RecName: Full=Translation initiation factor IF-1
 gi|149771927|emb|CAL43401.1| Translation initiation factor IF-1 [Flavobacterium psychrophilum
           JIP02/86]
          Length = 71

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGAIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +VIA+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHIVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|194335467|ref|YP_002017261.1| translation initiation factor IF-1 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|194307944|gb|ACF42644.1| translation initiation factor IF-1 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G++ E LPNA F+VKL                                  
Sbjct: 1   MAKEESIEIEGVILEALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  V+A+ +G++R H IRI  GDKVKV ++PYD+++ RITYR+K
Sbjct: 27  ----ENSLEVLAHVSGKIRMHYIRILPGDKVKVQISPYDISKGRITYRYK 72


>gi|284040599|ref|YP_003390529.1| translation initiation factor IF-1 [Spirosoma linguale DSM 74]
 gi|283819892|gb|ADB41730.1| translation initiation factor IF-1 [Spirosoma linguale DSM 74]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G++ E L NA FRV+L                                  
Sbjct: 1   MAKQNSIEQDGVILEALSNAMFRVELA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR + I+I  GD+VK+ M+PYD+++ARI YR+K
Sbjct: 28  -----NKHEVIAHISGKMRMNYIKILPGDRVKLEMSPYDLSKARIVYRYK 72


>gi|160894732|ref|ZP_02075507.1| hypothetical protein CLOL250_02283 [Clostridium sp. L2-50]
 gi|156863666|gb|EDO57097.1| hypothetical protein CLOL250_02283 [Clostridium sp. L2-50]
          Length = 72

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V++                                  
Sbjct: 1   MSKADVIEVEGTVIEKLPNAMFQVEI---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNYIKILPGDKVTIELSPYDLTKGRIVWRDK 72


>gi|146298140|ref|YP_001192731.1| translation initiation factor IF-1 [Flavobacterium johnsoniae
           UW101]
 gi|190359643|sp|A5FN00|IF1_FLAJO RecName: Full=Translation initiation factor IF-1
 gi|146152558|gb|ABQ03412.1| translation initiation factor IF-1 [Flavobacterium johnsoniae
           UW101]
          Length = 71

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQSAIEQDGSIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +VIA+ +G+MR H I++  GDKVK+ M+PYD+++ARITYR+
Sbjct: 27  ----ENGHIVIAHISGKMRMHYIKLLPGDKVKLEMSPYDLSKARITYRY 71


>gi|298207748|ref|YP_003715927.1| translation initiation factor IF-1 [Croceibacter atlanticus
           HTCC2559]
 gi|83850386|gb|EAP88254.1| translation initiation factor IF-1 [Croceibacter atlanticus
           HTCC2559]
          Length = 71

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQPPIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENEHVVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|228472094|ref|ZP_04056860.1| translation initiation factor IF-1 [Capnocytophaga gingivalis ATCC
           33624]
 gi|326334524|ref|ZP_08200735.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           338 str. F0234]
 gi|228276297|gb|EEK15021.1| translation initiation factor IF-1 [Capnocytophaga gingivalis ATCC
           33624]
 gi|325693293|gb|EGD35221.1| translation initiation factor IF-1 [Capnocytophaga sp. oral taxon
           338 str. F0234]
          Length = 71

 Score =  110 bits (274), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQAAIEQDGTIIESLSNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV A+ +G+MR H I++  GD+VK+ M PYD+T+ARITYR+
Sbjct: 28  -----NGHVVTAHISGKMRMHYIKLLPGDRVKLEMTPYDLTKARITYRY 71


>gi|240145854|ref|ZP_04744455.1| translation initiation factor IF-1 [Roseburia intestinalis L1-82]
 gi|257202002|gb|EEV00287.1| translation initiation factor IF-1 [Roseburia intestinalis L1-82]
 gi|291535452|emb|CBL08564.1| translation initiation factor IF-1 [Roseburia intestinalis M50/1]
 gi|291537907|emb|CBL11018.1| translation initiation factor IF-1 [Roseburia intestinalis XB6B4]
          Length = 72

 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEVEGTVVEKLPNAFFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++R + IRI  GDKV + M+PYD+T+ RI +R K
Sbjct: 27  ----ENGHQILATISGKLRMNFIRILPGDKVTIEMSPYDLTKGRIIWRDK 72


>gi|108796685|ref|YP_636495.1| translational initiation factor 1 [Zygnema circumcarinatum]
 gi|90110662|sp|Q32RN1|IF1C_ZYGCR RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|61393669|gb|AAX45811.1| translational initiation factor 1 [Zygnema circumcarinatum]
          Length = 77

 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+V+E LPNA FRV L                                  
Sbjct: 1   MKKQNLIEMEGVVTESLPNAMFRVYLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ IRI L D+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCEVLAHISGKIRRNYIRILLADRVKVELSPYDLTKGRITYRLR 72


>gi|90408365|ref|ZP_01216528.1| translation initiation factor IF-1 [Psychromonas sp. CNPT3]
 gi|90310528|gb|EAS38650.1| translation initiation factor IF-1 [Psychromonas sp. CNPT3]
          Length = 72

 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIEMQGTIMDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+++ RI +R +
Sbjct: 27  ----ENGHMVTAHISGKMRKNYIRILTGDKVTVQLTPYDLSKGRIVFRAR 72


>gi|23501156|ref|NP_697283.1| translation initiation factor IF-1 [Brucella suis 1330]
 gi|161618230|ref|YP_001592117.1| translation initiation factor IF-1 [Brucella canis ATCC 23365]
 gi|254705423|ref|ZP_05167251.1| translation initiation factor IF-1 [Brucella suis bv. 3 str. 686]
 gi|260567122|ref|ZP_05837592.1| translation initiation factor IF-1 [Brucella suis bv. 4 str. 40]
 gi|261756140|ref|ZP_05999849.1| translation initiation factor IF-1 [Brucella suis bv. 3 str. 686]
 gi|29427502|sp|Q8G2R5|IF1_BRUSU RecName: Full=Translation initiation factor IF-1
 gi|190359575|sp|A9M7T6|IF1_BRUC2 RecName: Full=Translation initiation factor IF-1
 gi|23347032|gb|AAN29198.1| translation initiation factor IF-1 [Brucella suis 1330]
 gi|161335041|gb|ABX61346.1| translation initiation factor IF-1 [Brucella canis ATCC 23365]
 gi|260156640|gb|EEW91720.1| translation initiation factor IF-1 [Brucella suis bv. 4 str. 40]
 gi|261745893|gb|EEY33819.1| translation initiation factor IF-1 [Brucella suis bv. 3 str. 686]
          Length = 72

 Score =  109 bits (273), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYR K
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRLK 72


>gi|315186717|gb|EFU20475.1| bacterial translation initiation factor 1 (bIF-1) [Spirochaeta
           thermophila DSM 6578]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  GIV E LPN  FRV+L                                  
Sbjct: 1   MAKEDAIEVEGIVKEALPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G+MRK+ IRI  GD+VKVA++PYD+TR RI YR +
Sbjct: 27  ----ENGHLILAHLSGKMRKYFIRIVPGDRVKVALSPYDLTRGRIIYRER 72


>gi|311744783|ref|ZP_07718579.1| translation initiation factor IF-1 [Aeromicrobium marinum DSM
           15272]
 gi|311311900|gb|EFQ81821.1| translation initiation factor IF-1 [Aeromicrobium marinum DSM
           15272]
          Length = 73

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKEGVIEMEGAVVEALPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|297564061|ref|YP_003683034.1| translation initiation factor IF-1 [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
 gi|296848510|gb|ADH70528.1| translation initiation factor IF-1 [Nocardiopsis dassonvillei
           subsp. dassonvillei DSM 43111]
          Length = 73

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA F+V+L                                 
Sbjct: 1   MAKKDGAIEIEGSVVESLPNAMFKVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR + IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHQVLAHISGKMRMNYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|255994830|ref|ZP_05427965.1| translation initiation factor IF-1 [Eubacterium saphenum ATCC
           49989]
 gi|255993543|gb|EEU03632.1| translation initiation factor IF-1 [Eubacterium saphenum ATCC
           49989]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F V+L                                  
Sbjct: 1   MAKKDVIEAEGKVKEALPNAMFLVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    V+A+ +G++R + IRI  GDKVKV ++PYD+T+ RIT+R K
Sbjct: 27  ----ETGHEVLAHVSGKIRVNFIRILPGDKVKVEISPYDLTKGRITWREK 72


>gi|261338257|ref|ZP_05966141.1| translation initiation factor IF-1 [Bifidobacterium gallicum DSM
           20093]
 gi|270276911|gb|EFA22765.1| translation initiation factor IF-1 [Bifidobacterium gallicum DSM
           20093]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGQVVEALPNAMFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+ R RITYR+K
Sbjct: 27  ----ENKHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLNRGRITYRYK 72


>gi|320526890|ref|ZP_08028080.1| translation initiation factor IF-1 [Solobacterium moorei F0204]
 gi|320132858|gb|EFW25398.1| translation initiation factor IF-1 [Solobacterium moorei F0204]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNANF VKL                                  
Sbjct: 1   MSKQDVIEIDGIVEETLPNANFLVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ AG++R + IRI  GD+V V ++PYD+TR RITYR K
Sbjct: 27  ----QNGHEIRAHVAGKIRMNYIRILPGDRVTVEISPYDLTRGRITYRHK 72


>gi|295099837|emb|CBK88926.1| bacterial translation initiation factor 1 (bIF-1) [Eubacterium
           cylindroides T2-87]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV + LPNA F+VKL                                  
Sbjct: 1   MAKQDMIELDGIVQDTLPNAAFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 27  ----ENGHEILAHVSGKIRMHHIRILPGDRVTVEISPYDLTRGRITFRRK 72


>gi|291514963|emb|CBK64173.1| bacterial translation initiation factor 1 (bIF-1) [Alistipes shahii
           WAL 8301]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQTAIERDGTIIEALSNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  ++ A+ +G+MR H I+I  GDKVKV M PYD+T+ RI++R+K
Sbjct: 28  -----NGHILTAHISGKMRMHYIKILPGDKVKVEMTPYDLTKGRISFRYK 72


>gi|189023506|ref|YP_001934274.1| translation initiation factor IF-1 [Brucella abortus S19]
 gi|260546540|ref|ZP_05822280.1| translation initiation factor [Brucella abortus NCTC 8038]
 gi|189019078|gb|ACD71800.1| Translation initiation factor, IF1 type [Brucella abortus S19]
 gi|260096647|gb|EEW80523.1| translation initiation factor [Brucella abortus NCTC 8038]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMPPYDLTKGRITYRFK 72


>gi|119476167|ref|ZP_01616519.1| Translation initiation factor IF-1 [marine gamma proteobacterium
           HTCC2143]
 gi|119450794|gb|EAW32028.1| Translation initiation factor IF-1 [marine gamma proteobacterium
           HTCC2143]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V + LPN  F+V+L                                  
Sbjct: 1   MAKEEQIEMEGEVIDTLPNTTFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKV+V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVRVELTPYDLSKGRITYRAR 72


>gi|167752408|ref|ZP_02424535.1| hypothetical protein ALIPUT_00652 [Alistipes putredinis DSM 17216]
 gi|167660649|gb|EDS04779.1| hypothetical protein ALIPUT_00652 [Alistipes putredinis DSM 17216]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQTAIERDGTIIEALSNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V+ A+ +G+MR H I+I  GDKVKV M PYD+++ RI++R+K
Sbjct: 28  -----NGHVITAHISGKMRMHYIKILPGDKVKVEMTPYDLSKGRISFRYK 72


>gi|254471709|ref|ZP_05085110.1| translation initiation factor IF-1 [Pseudovibrio sp. JE062]
 gi|211958911|gb|EEA94110.1| translation initiation factor IF-1 [Pseudovibrio sp. JE062]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRVKL                                  
Sbjct: 1   MAKEEMLEFPGVVVELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYR+K
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRYK 72


>gi|310816487|ref|YP_003964451.1| translation initiation factor IF-1 [Ketogulonicigenium vulgare Y25]
 gi|308755222|gb|ADO43151.1| translation initiation factor IF-1 [Ketogulonicigenium vulgare Y25]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/110 (40%), Positives = 57/110 (51%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEFPGVVKELLPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG++RK+RIR+  GDKV+V M PYD+T+ RI YRF+
Sbjct: 27  ----ENGHEIIAHTAGKLRKNRIRVLAGDKVQVEMTPYDLTKGRINYRFR 72


>gi|289208440|ref|YP_003460506.1| translation initiation factor IF-1 [Thioalkalivibrio sp. K90mix]
 gi|288944071|gb|ADC71770.1| translation initiation factor IF-1 [Thioalkalivibrio sp. K90mix]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V E LPN  FRV+L                                  
Sbjct: 1   MAKEDEIELEGTVVETLPNTTFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MRKH IRI  GDKV V M PYD+T+ RI YR K
Sbjct: 27  ----ENGHTITAHISGKMRKHYIRILRGDKVIVQMTPYDLTKGRIVYRNK 72


>gi|149173515|ref|ZP_01852145.1| probable translation initiation factor IF-1 [Planctomyces maris DSM
           8797]
 gi|148847697|gb|EDL62030.1| probable translation initiation factor IF-1 [Planctomyces maris DSM
           8797]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E L N  FRV+L                                  
Sbjct: 1   MAKEEAIEVEGTVTEALANTQFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ AG+MRKH IRI  GDKV V ++PYD+ R RI YR +
Sbjct: 27  ----ENGHQVLAHVAGKMRKHFIRIVPGDKVVVEVSPYDLNRGRIVYRER 72


>gi|282860833|ref|ZP_06269899.1| translation initiation factor IF-1 [Streptomyces sp. ACTE]
 gi|282564569|gb|EFB70105.1| translation initiation factor IF-1 [Streptomyces sp. ACTE]
          Length = 73

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K +  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKQGAIEIEGTVIESLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----QNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|315498215|ref|YP_004087019.1| translation initiation factor if-1 [Asticcacaulis excentricus CB
           48]
 gi|315416227|gb|ADU12868.1| translation initiation factor IF-1 [Asticcacaulis excentricus CB
           48]
          Length = 77

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 37/110 (33%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF+G V ELLPNA FRV L  +                               
Sbjct: 5   MAKEELLEFAGTVVELLPNATFRVTLEDS------------------------------- 33

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    +IA+TAG+MRK+RIR+  GD++ V M PYD+T+ RITYRFK
Sbjct: 34  ------GHEIIAHTAGKMRKNRIRVLAGDRIMVEMTPYDLTKGRITYRFK 77


>gi|169634478|ref|YP_001708214.1| translation initiation factor IF-1 [Acinetobacter baumannii SDF]
 gi|169153270|emb|CAP02375.1| protein chain initiation factor IF-1 [Acinetobacter baumannii]
          Length = 73

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 53/111 (47%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  KEE +EF G+V+E LPN  FRV+L                                 
Sbjct: 1   MANKEELIEFEGVVTETLPNTMFRVRL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MRKH IRI  GD VKV M PYD+T+ RITYR +
Sbjct: 28  -----ENGHEVVAHISGKMRKHYIRILTGDSVKVEMTPYDLTKGRITYRAR 73


>gi|83645153|ref|YP_433588.1| translation initiation factor IF-1 [Hahella chejuensis KCTC 2396]
 gi|119370872|sp|Q2SJL1|IF1_HAHCH RecName: Full=Translation initiation factor IF-1
 gi|83633196|gb|ABC29163.1| translation initiation factor IF-1 [Hahella chejuensis KCTC 2396]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEGNIEMEGTIIDTLPNTMFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV M PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVEMTPYDLSKGRIVYRAR 72


>gi|152997265|ref|YP_001342100.1| translation initiation factor IF-1 [Marinomonas sp. MWYL1]
 gi|150838189|gb|ABR72165.1| translation initiation factor IF-1 [Marinomonas sp. MWYL1]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEEGLEMEGTIIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VVIA+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVIAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|91216889|ref|ZP_01253853.1| translation initiation factor IF-1 [Psychroflexus torquis ATCC
           700755]
 gi|91185050|gb|EAS71429.1| translation initiation factor IF-1 [Psychroflexus torquis ATCC
           700755]
          Length = 71

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G + E L NA FRV+L                                  
Sbjct: 1   MAKQPSIEQDGTIIEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  +V A+ +G+MR H I++  GDKVK+ M+PYD+T+ARITYR+
Sbjct: 27  ----ENEHIVTAHISGKMRMHYIKLLPGDKVKLEMSPYDLTKARITYRY 71


>gi|325971921|ref|YP_004248112.1| translation initiation factor IF-1 [Spirochaeta sp. Buddy]
 gi|324027159|gb|ADY13918.1| Translation initiation factor IF-1 [Spirochaeta sp. Buddy]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G+V E LPN  FRV+L                                  
Sbjct: 1   MAKEEAIEVEGVVREALPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G+MRKH IRI  GD V+VA++PYD+T+ RI YR +
Sbjct: 27  ----QNQHVILAHLSGKMRKHYIRIVPGDTVRVALSPYDLTKGRIIYRER 72


>gi|262276778|ref|ZP_06054571.1| translation initiation factor IF-1 [alpha proteobacterium HIMB114]
 gi|262223881|gb|EEY74340.1| translation initiation factor IF-1 [alpha proteobacterium HIMB114]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +EF G V+ELLPNA FRVKL                                  
Sbjct: 1   MAKEEMIEFKGKVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++A+T+G++RK+RIR+  GD V V + PYD+T+ RIT+R K
Sbjct: 27  ----ENDHEILAHTSGKLRKNRIRVLAGDTVLVEVTPYDLTKGRITFRLK 72


>gi|222087235|ref|YP_002545770.1| translation initiation factor IF-1 [Agrobacterium radiobacter K84]
 gi|221724683|gb|ACM27839.1| translation initiation factor IF-1 [Agrobacterium radiobacter K84]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MPKEEVLEFPGVVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|302877822|ref|YP_003846386.1| translation initiation factor IF-1 [Gallionella capsiferriformans
           ES-2]
 gi|302580611|gb|ADL54622.1| translation initiation factor IF-1 [Gallionella capsiferriformans
           ES-2]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G + E LPNA FR+KL                                  
Sbjct: 1   MAKEDVIQMQGEIEESLPNATFRIKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|110632549|ref|YP_672757.1| translation initiation factor IF-1 [Mesorhizobium sp. BNC1]
 gi|119371076|sp|Q11LY3|IF1_MESSB RecName: Full=Translation initiation factor IF-1
 gi|110283533|gb|ABG61592.1| bacterial translation initiation factor 1 (bIF-1) [Chelativorans
           sp. BNC1]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 60/110 (54%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MPKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|308235473|ref|ZP_07666210.1| translation initiation factor IF-1 [Gardnerella vaginalis ATCC
           14018]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGTVVEALPNAMFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+ R RITYR+K
Sbjct: 27  ----ENEHIVLATISGKMRKNYIRILPKDRVVLEMSPYDLNRGRITYRYK 72


>gi|295396443|ref|ZP_06806605.1| translation initiation factor IF-1 [Brevibacterium mcbrellneri ATCC
           49030]
 gi|294970745|gb|EFG46658.1| translation initiation factor IF-1 [Brevibacterium mcbrellneri ATCC
           49030]
          Length = 79

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G V E LPNA+FRV+L                                 
Sbjct: 7   MAKKEGVIEIEGTVVEALPNASFRVELT-------------------------------- 34

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 35  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 79


>gi|119962208|ref|YP_948631.1| translation initiation factor IF-1 [Arthrobacter aurescens TC1]
 gi|190359565|sp|A1R8R9|IF1_ARTAT RecName: Full=Translation initiation factor IF-1
 gi|119949067|gb|ABM07978.1| translation initiation factor IF-1 [Arthrobacter aurescens TC1]
          Length = 73

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G+V+E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGVVTEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NKHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|145588263|ref|YP_001154860.1| translation initiation factor IF-1 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
 gi|190359534|sp|A4SUY2|IF11_POLSQ RecName: Full=Translation initiation factor IF-1 1
 gi|145046669|gb|ABP33296.1| bacterial translation initiation factor 1 (bIF-1) [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++ +G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMAGEVVENLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V + + +G+MR H IRI  GDKV V M PYD+TRARI +R K
Sbjct: 27  ----ENGHVFLGHISGKMRMHYIRILPGDKVTVEMTPYDLTRARIIFRAK 72


>gi|119358169|ref|YP_912813.1| translation initiation factor IF-1 [Chlorobium phaeobacteroides DSM
           266]
 gi|190359589|sp|A1BJ12|IF1_CHLPD RecName: Full=Translation initiation factor IF-1
 gi|119355518|gb|ABL66389.1| bacterial translation initiation factor 1 (bIF-1) [Chlorobium
           phaeobacteroides DSM 266]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G++ + LPNA F+VKL                                  
Sbjct: 1   MAKEEAIEIEGVILDALPNAQFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R H IRI  GDKVKV ++PYD+T+ RITYR+K
Sbjct: 27  ----ENGLEVLAHVSGKIRMHYIRILAGDKVKVQISPYDITKGRITYRYK 72


>gi|124268606|ref|YP_001022610.1| translation initiation factor IF-1 [Methylibium petroleiphilum PM1]
 gi|190359650|sp|A2SLD6|IF1_METPP RecName: Full=Translation initiation factor IF-1
 gi|124261381|gb|ABM96375.1| bacterial translation initiation factor 1 (bIF-1) [Methylibium
           petroleiphilum PM1]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQMQGEILENLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|30248439|ref|NP_840509.1| translation initiation factor IF-1 [Nitrosomonas europaea ATCC
           19718]
 gi|114330594|ref|YP_746816.1| translation initiation factor IF-1 [Nitrosomonas eutropha C91]
 gi|44888012|sp|Q820Q7|IF1_NITEU RecName: Full=Translation initiation factor IF-1
 gi|122314412|sp|Q0AIH5|IF1_NITEC RecName: Full=Translation initiation factor IF-1
 gi|30138325|emb|CAD84333.1| S1 RNA binding domain:Translation initiation factor IF-1
           [Nitrosomonas europaea ATCC 19718]
 gi|114307608|gb|ABI58851.1| bacterial translation initiation factor 1 (bIF-1) [Nitrosomonas
           eutropha C91]
          Length = 72

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEET++  G V E LPNA FR+KL                                  
Sbjct: 1   MAKEETIQMQGEVIETLPNATFRIKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR + IRI  GDKV V + PYD+TRARIT+R K
Sbjct: 27  ----ENGHIVLGHISGKMRMNYIRILPGDKVTVDLTPYDLTRARITFRTK 72


>gi|50083716|ref|YP_045226.1| translation initiation factor IF-1 [Acinetobacter sp. ADP1]
 gi|59797550|sp|Q6FEV4|IF1_ACIAD RecName: Full=Translation initiation factor IF-1
 gi|49529692|emb|CAG67404.1| protein chain initiation factor IF-1 [Acinetobacter sp. ADP1]
          Length = 73

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 53/111 (47%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  KEE +EF G+V+E LPN  FRV+L                                 
Sbjct: 1   MANKEELIEFEGVVTETLPNTMFRVRL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   VIA+ +G+MRKH IRI  GD VKV M PYD+++ RITYR +
Sbjct: 28  -----ENGHEVIAHISGKMRKHYIRILTGDNVKVEMTPYDLSKGRITYRAR 73


>gi|34558008|ref|NP_907823.1| translation initiation factor IF-1 [Wolinella succinogenes DSM
           1740]
 gi|44888004|sp|Q7M8F3|IF1_WOLSU RecName: Full=Translation initiation factor IF-1
 gi|34483726|emb|CAE10723.1| TRANSLATION INITIATION FACTOR IF-1 [Wolinella succinogenes]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGKVIEALPNATFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AGRMR H I+I  GD+VK+ + PY + + RIT+R+K
Sbjct: 28  -----NKHVILCHIAGRMRMHYIKILPGDRVKIELTPYSLDKGRITFRYK 72


>gi|254437539|ref|ZP_05051033.1| translation initiation factor IF-1 [Octadecabacter antarcticus 307]
 gi|198252985|gb|EDY77299.1| translation initiation factor IF-1 [Octadecabacter antarcticus 307]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLPNA F V+L                                  
Sbjct: 1   MAKEELLEFPGVVKELLPNATFLVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAG+MRK+RIR+  GDKV+V M PYD+T+ RI YRFK
Sbjct: 27  ----ENGHTIIAHTAGKMRKNRIRVLSGDKVQVEMTPYDLTKGRINYRFK 72


>gi|17546958|ref|NP_520360.1| translation initiation factor IF-1 [Ralstonia solanacearum GMI1000]
 gi|83746530|ref|ZP_00943581.1| Bacterial Protein Translation Initiation Factor 1 (IF-1) [Ralstonia
           solanacearum UW551]
 gi|207723730|ref|YP_002254128.1| translation initiation factor if-1 2 protein [Ralstonia
           solanacearum MolK2]
 gi|207743844|ref|YP_002260236.1| translation initiation factor if-1 2 protein [Ralstonia
           solanacearum IPO1609]
 gi|300690843|ref|YP_003751838.1| translation initiation factor IF-1 [Ralstonia solanacearum PSI07]
 gi|300703476|ref|YP_003745078.1| translation initiation factor if-1 [Ralstonia solanacearum
           CFBP2957]
 gi|20138610|sp|Q8XX77|IF12_RALSO RecName: Full=Translation initiation factor IF-1 2
 gi|17429259|emb|CAD15946.1| probable translation initiation factor if-1 2 protein [Ralstonia
           solanacearum GMI1000]
 gi|83726861|gb|EAP73988.1| Bacterial Protein Translation Initiation Factor 1 (IF-1) [Ralstonia
           solanacearum UW551]
 gi|206588934|emb|CAQ35896.1| translation initiation factor if-1 2 protein [Ralstonia
           solanacearum MolK2]
 gi|206595244|emb|CAQ62171.1| translation initiation factor if-1 2 protein [Ralstonia
           solanacearum IPO1609]
 gi|299071139|emb|CBJ42452.1| translation initiation factor IF-1 [Ralstonia solanacearum
           CFBP2957]
 gi|299077903|emb|CBJ50542.1| translation initiation factor IF-1 [Ralstonia solanacearum PSI07]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +EF G+VSE LP+  FRV+L                                  
Sbjct: 1   MAKEELIEFEGVVSEALPDNRFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V AY +G+M+KHRIRI  GD+VK+ M+PYD+T+ RI YR K
Sbjct: 27  ----ENGVEVWAYASGKMQKHRIRILAGDRVKLEMSPYDLTKGRINYRHK 72


>gi|330718951|ref|ZP_08313551.1| translation initiation factor IF-1 [Leuconostoc fallax KCTC 3537]
          Length = 71

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 39/110 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M   + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MA-NDVIEIEGKVKETLPNAMFQVQL---------------------------------- 25

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + AV++A+ +G++RK+ IRI  GD+V V M+PYD+T+ RITYRFK
Sbjct: 26  ----ENGAVILAHVSGKIRKNFIRILPGDRVTVEMSPYDLTKGRITYRFK 71


>gi|171462900|ref|YP_001797013.1| translation initiation factor IF-1 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
 gi|171192438|gb|ACB43399.1| translation initiation factor IF-1 [Polynucleobacter necessarius
           subsp. necessarius STIR1]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++ +G V E LPNA FRVKL                                  
Sbjct: 1   MSKDDVIQLAGEVVESLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G++R H IRI  GDKV V M PYD+TRARI +R K
Sbjct: 27  ----ENGHVVLGHISGKIRMHYIRILPGDKVTVEMTPYDLTRARIIFRAK 72


>gi|255020787|ref|ZP_05292845.1| Translation initiation factor 1 [Acidithiobacillus caldus ATCC
           51756]
 gi|254969783|gb|EET27287.1| Translation initiation factor 1 [Acidithiobacillus caldus ATCC
           51756]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLE  G V E LP+A F+V+L                                  
Sbjct: 1   MAKEDTLEMQGEVIENLPSATFKVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MR H IRI  GDKV V M PYD+++ RI YR K
Sbjct: 27  ----ENGFIVNAHISGKMRMHYIRILPGDKVTVEMTPYDLSKGRIIYRAK 72


>gi|119718100|ref|YP_925065.1| translation initiation factor IF-1 [Nocardioides sp. JS614]
 gi|190359660|sp|A1SNJ3|IF1_NOCSJ RecName: Full=Translation initiation factor IF-1
 gi|119538761|gb|ABL83378.1| bacterial translation initiation factor 1 (bIF-1) [Nocardioides sp.
           JS614]
          Length = 73

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE  +E  G V E LPNA FRV+L                                    
Sbjct: 4   KEGVIEIEGTVVEALPNAMFRVELS----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ---NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|296284358|ref|ZP_06862356.1| translation initiation factor IF-1 [Citromicrobium bathyomarinum
           JL354]
          Length = 85

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 53/109 (48%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEMRGRVVELLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   ++ +TAG+MRK+RIR+  GD+V V + PYD+T+ RITYRF
Sbjct: 27  ----ENGHEILGHTAGKMRKNRIRVLTGDEVLVELTPYDLTKGRITYRF 71


>gi|160947677|ref|ZP_02094844.1| hypothetical protein PEPMIC_01612 [Parvimonas micra ATCC 33270]
 gi|158446811|gb|EDP23806.1| hypothetical protein PEPMIC_01612 [Parvimonas micra ATCC 33270]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V + +PN  F+VKL                                  
Sbjct: 1   MSKKDVIEVEGTVIDAMPNTIFKVKLA--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GDKV V ++PYD+T+ RIT+R K
Sbjct: 28  -----NGHEITAHISGKLRMNYIRILPGDKVLVELSPYDLTKGRITWRNK 72


>gi|262369981|ref|ZP_06063308.1| translation initiation factor IF-1 [Acinetobacter johnsonii SH046]
 gi|262315020|gb|EEY96060.1| translation initiation factor IF-1 [Acinetobacter johnsonii SH046]
          Length = 73

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 53/111 (47%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  KEE +EF G+V+E LPN  FRV+L                                 
Sbjct: 1   MANKEELIEFEGVVTETLPNTMFRVRL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   VIA+ +G+MRKH IRI  GD VKV M PYD+++ RITYR +
Sbjct: 28  -----ENGHEVIAHISGKMRKHYIRILTGDSVKVEMTPYDLSKGRITYRAR 73


>gi|116671490|ref|YP_832423.1| translation initiation factor IF-1 [Arthrobacter sp. FB24]
 gi|220913404|ref|YP_002488713.1| translation initiation factor IF-1 [Arthrobacter chlorophenolicus
           A6]
 gi|325964136|ref|YP_004242042.1| bacterial translation initiation factor 1 (bIF-1) [Arthrobacter
           phenanthrenivorans Sphe3]
 gi|190359566|sp|A0JZ53|IF1_ARTS2 RecName: Full=Translation initiation factor IF-1
 gi|116611599|gb|ABK04323.1| bacterial translation initiation factor 1 (bIF-1) [Arthrobacter sp.
           FB24]
 gi|219860282|gb|ACL40624.1| translation initiation factor IF-1 [Arthrobacter chlorophenolicus
           A6]
 gi|323470223|gb|ADX73908.1| bacterial translation initiation factor 1 (bIF-1) [Arthrobacter
           phenanthrenivorans Sphe3]
          Length = 73

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G+V+E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGVVTEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  +V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NKHIVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|149376386|ref|ZP_01894149.1| translation initiation factor IF-1 [Marinobacter algicola DG893]
 gi|149359400|gb|EDM47861.1| translation initiation factor IF-1 [Marinobacter algicola DG893]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G++ + LPN  FRV+L                                  
Sbjct: 1   MAKSDAIEMEGVIVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|57505562|ref|ZP_00371489.1| translation initiation factor IF-1 [Campylobacter upsaliensis
           RM3195]
 gi|315637924|ref|ZP_07893110.1| translation initiation factor IF-1 [Campylobacter upsaliensis JV21]
 gi|57016109|gb|EAL52896.1| translation initiation factor IF-1 [Campylobacter upsaliensis
           RM3195]
 gi|315481959|gb|EFU72577.1| translation initiation factor IF-1 [Campylobacter upsaliensis JV21]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNANF+V+L                                  
Sbjct: 1   MAKDDVIEIDGNVIEALPNANFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AG+MR H IRI  GD+VKV + PY + + RIT+R+K
Sbjct: 28  -----NKHIILCHIAGKMRMHYIRIMPGDRVKVELTPYSLDKGRITFRYK 72


>gi|23336308|ref|ZP_00121531.1| COG0361: Translation initiation factor 1 (IF-1) [Bifidobacterium
           longum DJO10A]
 gi|23466152|ref|NP_696755.1| translation initiation factor IF-1 [Bifidobacterium longum NCC2705]
 gi|119025361|ref|YP_909206.1| translation initiation factor IF-1 [Bifidobacterium adolescentis
           ATCC 15703]
 gi|154486769|ref|ZP_02028176.1| hypothetical protein BIFADO_00594 [Bifidobacterium adolescentis
           L2-32]
 gi|171741251|ref|ZP_02917058.1| hypothetical protein BIFDEN_00326 [Bifidobacterium dentium ATCC
           27678]
 gi|189440591|ref|YP_001955672.1| translation initiation factor IF-1 [Bifidobacterium longum DJO10A]
 gi|212716589|ref|ZP_03324717.1| hypothetical protein BIFCAT_01518 [Bifidobacterium catenulatum DSM
           16992]
 gi|213693066|ref|YP_002323652.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|224283731|ref|ZP_03647053.1| translation initiation factor IF-1 [Bifidobacterium bifidum NCIMB
           41171]
 gi|225351023|ref|ZP_03742046.1| hypothetical protein BIFPSEUDO_02605 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|227546498|ref|ZP_03976547.1| initiation factor IF1 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239621032|ref|ZP_04664063.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|283455388|ref|YP_003359952.1| protein translation initiation factor InfA [Bifidobacterium dentium
           Bd1]
 gi|291457225|ref|ZP_06596615.1| translation initiation factor IF-1 [Bifidobacterium breve DSM
           20213]
 gi|296454848|ref|YP_003661992.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           longum JDM301]
 gi|306823546|ref|ZP_07456921.1| translation initiation factor IF-1 [Bifidobacterium dentium ATCC
           27679]
 gi|310288002|ref|YP_003939261.1| translation initiation factor IF-1 [Bifidobacterium bifidum S17]
 gi|311064875|ref|YP_003971601.1| protein translation initiation factor 1 InfA [Bifidobacterium
           bifidum PRL2010]
 gi|312133896|ref|YP_004001235.1| infa [Bifidobacterium longum subsp. longum BBMN68]
 gi|313140887|ref|ZP_07803080.1| translation initiation factor IF-1 [Bifidobacterium bifidum NCIMB
           41171]
 gi|317483428|ref|ZP_07942418.1| translation initiation factor IF-1 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|322689907|ref|YP_004209641.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691848|ref|YP_004221418.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|29427504|sp|Q8G3Z7|IF1_BIFLO RecName: Full=Translation initiation factor IF-1
 gi|190359574|sp|A1A091|IF1_BIFAA RecName: Full=Translation initiation factor IF-1
 gi|23326889|gb|AAN25391.1| translation initiation factor If-1 [Bifidobacterium longum NCC2705]
 gi|118764945|dbj|BAF39124.1| translation initiation factor IF-1 [Bifidobacterium adolescentis
           ATCC 15703]
 gi|154084632|gb|EDN83677.1| hypothetical protein BIFADO_00594 [Bifidobacterium adolescentis
           L2-32]
 gi|171276865|gb|EDT44526.1| hypothetical protein BIFDEN_00326 [Bifidobacterium dentium ATCC
           27678]
 gi|189429026|gb|ACD99174.1| Translation initiation factor 1 [Bifidobacterium longum DJO10A]
 gi|212660293|gb|EEB20868.1| hypothetical protein BIFCAT_01518 [Bifidobacterium catenulatum DSM
           16992]
 gi|213524527|gb|ACJ53274.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|225158479|gb|EEG71721.1| hypothetical protein BIFPSEUDO_02605 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|227213047|gb|EEI80926.1| initiation factor IF1 [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|239516133|gb|EEQ56000.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|283102022|gb|ADB09128.1| infA Bacterial Protein Translation Initiation Factor
           [Bifidobacterium dentium Bd1]
 gi|291381060|gb|EFE88578.1| translation initiation factor IF-1 [Bifidobacterium breve DSM
           20213]
 gi|291516449|emb|CBK70065.1| bacterial translation initiation factor 1 (bIF-1) [Bifidobacterium
           longum subsp. longum F8]
 gi|296184280|gb|ADH01162.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           longum JDM301]
 gi|304553253|gb|EFM41165.1| translation initiation factor IF-1 [Bifidobacterium dentium ATCC
           27679]
 gi|309251939|gb|ADO53687.1| translation initiation factor IF-1 [Bifidobacterium bifidum S17]
 gi|310867195|gb|ADP36564.1| InfA Bacterial Protein Translation Initiation Factor 1
           [Bifidobacterium bifidum PRL2010]
 gi|311773190|gb|ADQ02678.1| InfA [Bifidobacterium longum subsp. longum BBMN68]
 gi|313133397|gb|EFR51014.1| translation initiation factor IF-1 [Bifidobacterium bifidum NCIMB
           41171]
 gi|316915114|gb|EFV36546.1| translation initiation factor IF-1 [Bifidobacterium sp.
           12_1_47BFAA]
 gi|320456704|dbj|BAJ67326.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320459244|dbj|BAJ69865.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
 gi|320461243|dbj|BAJ71863.1| translation initiation factor IF-1 [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGQVVEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+ R RITYR+K
Sbjct: 27  ----ENKHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLNRGRITYRYK 72


>gi|313904928|ref|ZP_07838299.1| translation initiation factor IF-1 [Eubacterium cellulosolvens 6]
 gi|313470185|gb|EFR65516.1| translation initiation factor IF-1 [Eubacterium cellulosolvens 6]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  GIV E LPNA FRV+L                                  
Sbjct: 1   MSKSDVIEVEGIVLEKLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+A+ +G++R + IRI  GDKV + ++PYD+ + RI +R K
Sbjct: 27  ----ENKHVVLAHISGKLRMNFIRILPGDKVTLELSPYDLEKGRIIWRDK 72


>gi|198282659|ref|YP_002218980.1| translation initiation factor IF-1 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666290|ref|YP_002424852.1| translation initiation factor IF-1 [Acidithiobacillus ferrooxidans
           ATCC 23270]
 gi|198247180|gb|ACH82773.1| translation initiation factor IF-1 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518503|gb|ACK79089.1| translation initiation factor IF-1 [Acidithiobacillus ferrooxidans
           ATCC 23270]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+TLE  G V E LP+A F+V+L                                  
Sbjct: 1   MSKEDTLEMQGEVVENLPSATFKVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MR H IRI  GDKV V M PYD+T+ RI YR K
Sbjct: 27  ----ENGYVVNAHISGKMRMHYIRILPGDKVTVEMTPYDLTKGRIIYRAK 72


>gi|92114557|ref|YP_574485.1| translation initiation factor 1 [Chromohalobacter salexigens DSM
           3043]
 gi|119370851|sp|Q1QUS2|IF1_CHRSD RecName: Full=Translation initiation factor IF-1
 gi|91797647|gb|ABE59786.1| bacterial translation initiation factor 1 (bIF-1) [Chromohalobacter
           salexigens DSM 3043]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M +E+ +E  G+V + LPN  FRV+L                                  
Sbjct: 1   MAREDHIEMEGVVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|13475397|ref|NP_106961.1| translation initiation factor IF-1 [Mesorhizobium loti MAFF303099]
 gi|260467499|ref|ZP_05813667.1| translation initiation factor IF-1 [Mesorhizobium opportunistum
           WSM2075]
 gi|319782086|ref|YP_004141562.1| translation initiation factor IF-1 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|20138504|sp|Q989F0|IF1_RHILO RecName: Full=Translation initiation factor IF-1
 gi|14026149|dbj|BAB52747.1| translation initiation factor IF-1; InfA [Mesorhizobium loti
           MAFF303099]
 gi|259028726|gb|EEW30034.1| translation initiation factor IF-1 [Mesorhizobium opportunistum
           WSM2075]
 gi|317167974|gb|ADV11512.1| translation initiation factor IF-1 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 1   MPKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|331004985|ref|ZP_08328395.1| Translation initiation factor 1 [gamma proteobacterium IMCC1989]
 gi|330421227|gb|EGG95483.1| Translation initiation factor 1 [gamma proteobacterium IMCC1989]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V + LPN  FRVKL                                  
Sbjct: 1   MAKEENIELEGEVIDTLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV M PYD+++ RIT+R +
Sbjct: 27  ----ENGHVVNAHISGKMRKNYIRILTGDKVKVEMTPYDLSKGRITFRAR 72


>gi|325294419|ref|YP_004280933.1| translation initiation factor IF-1 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064867|gb|ADY72874.1| Translation initiation factor IF-1 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 72

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA F+V+L                                  
Sbjct: 1   MAKEKGIQVEGKVVEALPNAYFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MR H IRI  GD+V V ++PYD+TR RI YR
Sbjct: 28  -----NGHQVLAHASGKMRVHFIRILPGDRVVVELSPYDLTRGRIIYR 70


>gi|165919021|ref|ZP_02219107.1| translation initiation factor IF-1 [Coxiella burnetii RSA 334]
 gi|165917276|gb|EDR35880.1| translation initiation factor IF-1 [Coxiella burnetii RSA 334]
          Length = 83

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 48/108 (44%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE++E  G V + LPN  FRVKL                                  
Sbjct: 1   MAKEESIEMQGTVVDSLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +  VV A+ +GRMRKH IRI  GD V V + PYD+TR RI YR
Sbjct: 27  ----ENGHVVTAHISGRMRKHYIRILTGDAVAVELTPYDLTRGRIVYR 70


>gi|238021611|ref|ZP_04602037.1| hypothetical protein GCWU000324_01511 [Kingella oralis ATCC 51147]
 gi|237866225|gb|EEP67267.1| hypothetical protein GCWU000324_01511 [Kingella oralis ATCC 51147]
          Length = 72

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G V E LPNA FRVKL                                  
Sbjct: 1   MAKEDVIQMQGEVIETLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    VI + +G+MR H IRI  GDKV V M PYD+TRARI +R +
Sbjct: 27  ----ESGHEVIGHISGKMRMHYIRILPGDKVTVEMTPYDLTRARIVFRAR 72


>gi|88703371|ref|ZP_01101087.1| Translation initiation factor IF-1 [Congregibacter litoralis KT71]
 gi|254514305|ref|ZP_05126366.1| translation initiation factor IF-1 [gamma proteobacterium NOR5-3]
 gi|88702085|gb|EAQ99188.1| Translation initiation factor IF-1 [Congregibacter litoralis KT71]
 gi|219676548|gb|EED32913.1| translation initiation factor IF-1 [gamma proteobacterium NOR5-3]
          Length = 72

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + LPN  FRVKL                                  
Sbjct: 1   MAKEDQIEMEGEVVDTLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ VV A+ +G+MRK+ IRI  GDKV+V + PYD+T+ RITYR +
Sbjct: 27  ----ENDHVVTAHISGKMRKNYIRILTGDKVRVELTPYDLTKGRITYRER 72


>gi|328943588|ref|ZP_08241053.1| translation initiation factor IF-1 [Atopobium vaginae DSM 15829]
 gi|327491557|gb|EGF23331.1| translation initiation factor IF-1 [Atopobium vaginae DSM 15829]
          Length = 84

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 48/109 (44%), Gaps = 38/109 (34%)

Query: 2   PKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDP 61
            K++ +E  G V E LPNA F V+L                                   
Sbjct: 14  SKQDGIELEGTVLEPLPNAMFNVEL----------------------------------- 38

Query: 62  ISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
               +   ++   +G++R + IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 39  ---ENGKTILCTISGKIRMNYIRILPGDKVTVEISPYDLTRGRITYRYK 84


>gi|257453247|ref|ZP_05618546.1| protein translation initiation factor 1 [Fusobacterium sp. 3_1_5R]
 gi|257463986|ref|ZP_05628371.1| protein translation initiation factor 1 [Fusobacterium sp. D12]
 gi|257467158|ref|ZP_05631469.1| protein translation initiation factor 1 [Fusobacterium
           gonidiaformans ATCC 25563]
 gi|257470855|ref|ZP_05634945.1| protein translation initiation factor 1 [Fusobacterium ulcerans
           ATCC 49185]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MSKKDVIELEGTILEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 27  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 72


>gi|269796231|ref|YP_003315686.1| translation initiation factor 1 [Sanguibacter keddieii DSM 10542]
 gi|296130466|ref|YP_003637716.1| translation initiation factor IF-1 [Cellulomonas flavigena DSM
           20109]
 gi|269098416|gb|ACZ22852.1| bacterial translation initiation factor 1 (bIF-1) [Sanguibacter
           keddieii DSM 10542]
 gi|296022281|gb|ADG75517.1| translation initiation factor IF-1 [Cellulomonas flavigena DSM
           20109]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVVEALPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|288574685|ref|ZP_06393042.1| translation initiation factor IF-1 [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570426|gb|EFC91983.1| translation initiation factor IF-1 [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 54/111 (48%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  K++ ++  G+V E LPNA F+VKL                                 
Sbjct: 1   MANKDDVIQVRGVVVEPLPNAMFKVKL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 ++  ++A+ +G+MR H IRI  GDKV V ++PYD+TR RITYR+K
Sbjct: 28  -----ENDHKILAHVSGKMRMHFIRILPGDKVLVELSPYDLTRGRITYRYK 73


>gi|117927538|ref|YP_872089.1| translation initiation factor 1 [Acidothermus cellulolyticus 11B]
 gi|190359555|sp|A0LRP3|IF1_ACIC1 RecName: Full=Translation initiation factor IF-1
 gi|117648001|gb|ABK52103.1| bacterial translation initiation factor 1 (bIF-1) [Acidothermus
           cellulolyticus 11B]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGQVIEPLPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI  GD+V V ++PYD+ R RI YR++
Sbjct: 29  ------NGHKVLAHISGKMRMHYIRILPGDRVVVELSPYDLNRGRIVYRYR 73


>gi|269955458|ref|YP_003325247.1| translation initiation factor IF-1 [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304139|gb|ACZ29689.1| translation initiation factor IF-1 [Xylanimonas cellulosilytica DSM
           15894]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVIEALPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|310779573|ref|YP_003967906.1| bacterial translation initiation factor 1 (bIF-1) [Ilyobacter
           polytropus DSM 2926]
 gi|309748896|gb|ADO83558.1| bacterial translation initiation factor 1 (bIF-1) [Ilyobacter
           polytropus DSM 2926]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+++L                                  
Sbjct: 1   MSKKDVIELEGTVLESLPNAMFKIEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + +G+MR H I+I  GDKV V ++PYD++R RI YR K
Sbjct: 27  ----ENGHVILGHISGKMRMHYIKILPGDKVTVQISPYDLSRGRIVYRKK 72


>gi|307545650|ref|YP_003898129.1| translation initiation factor IF-1 [Halomonas elongata DSM 2581]
 gi|307217674|emb|CBV42944.1| translation initiation factor IF-1 [Halomonas elongata DSM 2581]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M +E+ +E  G+V + LPN  FRV+L                                  
Sbjct: 1   MAREDHIEMEGVVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRSR 72


>gi|260438193|ref|ZP_05792009.1| translation initiation factor IF-1 [Butyrivibrio crossotus DSM
           2876]
 gi|292809383|gb|EFF68588.1| translation initiation factor IF-1 [Butyrivibrio crossotus DSM
           2876]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K +++E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKVDSIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + IRI  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHKVLAHISGKLRMNYIRIIPGDKVTLELSPYDLTKGRIIWRDK 72


>gi|284033976|ref|YP_003383907.1| translation initiation factor IF-1 [Kribbella flavida DSM 17836]
 gi|283813269|gb|ADB35108.1| translation initiation factor IF-1 [Kribbella flavida DSM 17836]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE  +E  G + E LPNA FRV+L                                    
Sbjct: 4   KEGVIELEGTIVEALPNAMFRVELS----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ---NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|255326867|ref|ZP_05367943.1| translation initiation factor IF-1 [Rothia mucilaginosa ATCC 25296]
 gi|283457573|ref|YP_003362156.1| translation initiation factor 1 [Rothia mucilaginosa DY-18]
 gi|311111948|ref|YP_003983170.1| translation initiation factor IF-1 [Rothia dentocariosa ATCC 17931]
 gi|255296084|gb|EET75425.1| translation initiation factor IF-1 [Rothia mucilaginosa ATCC 25296]
 gi|283133571|dbj|BAI64336.1| translation initiation factor 1 [Rothia mucilaginosa DY-18]
 gi|310943442|gb|ADP39736.1| translation initiation factor IF-1 [Rothia dentocariosa ATCC 17931]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVVEALPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|262203545|ref|YP_003274753.1| translation initiation factor IF-1 [Gordonia bronchialis DSM 43247]
 gi|262086892|gb|ACY22860.1| translation initiation factor IF-1 [Gordonia bronchialis DSM 43247]
          Length = 111

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 39  MAKKDGAIEVEGRVIEPLPNAMFRIEL--------------------------------- 65

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 66  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLGRGRIVYRYK 111


>gi|296329030|ref|ZP_06871536.1| translation initiation factor IF-1 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
 gi|22095758|sp|Q8R5W2|IF1_FUSNN RecName: Full=Translation initiation factor IF-1
 gi|296153834|gb|EFG94646.1| translation initiation factor IF-1 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 23726]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 1   MSKKDVIELEGTIVEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 27  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 72


>gi|312113070|ref|YP_004010666.1| translation initiation factor IF-1 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218199|gb|ADP69567.1| translation initiation factor IF-1 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF GI+SELLPNA FRVKL                                  
Sbjct: 1   MSKEELLEFPGIISELLPNATFRVKLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 28  -----NGHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|148655315|ref|YP_001275520.1| translation initiation factor IF-1 [Roseiflexus sp. RS-1]
 gi|156743926|ref|YP_001434055.1| translation initiation factor IF-1 [Roseiflexus castenholzii DSM
           13941]
 gi|190359683|sp|A7NR41|IF1_ROSCS RecName: Full=Translation initiation factor IF-1
 gi|190359684|sp|A5USG7|IF1_ROSS1 RecName: Full=Translation initiation factor IF-1
 gi|148567425|gb|ABQ89570.1| bacterial translation initiation factor 1 (bIF-1) [Roseiflexus sp.
           RS-1]
 gi|156235254|gb|ABU60037.1| translation initiation factor IF-1 [Roseiflexus castenholzii DSM
           13941]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K++ +E  G ++E LPNA FRVKL                                    
Sbjct: 4   KKDVIEMEGTITEPLPNAMFRVKL------------------------------------ 27

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +GRMR + IRI  GD+V V ++PYD+TR RITYR+K
Sbjct: 28  --ENGHEVLAHISGRMRMNYIRILKGDRVLVELSPYDLTRGRITYRYK 73


>gi|50955544|ref|YP_062832.1| translation initiation factor IF-1 [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|59797533|sp|Q6AD17|IF1_LEIXX RecName: Full=Translation initiation factor IF-1
 gi|50952026|gb|AAT89727.1| translation initiation factor IF-1 [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVIEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRYK 73


>gi|21231416|ref|NP_637333.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66768530|ref|YP_243292.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|23821725|sp|Q8P997|IF1_XANCP RecName: Full=Translation initiation factor IF-1
 gi|81305498|sp|Q4UUK1|IF1_XANC8 RecName: Full=Translation initiation factor IF-1
 gi|21113084|gb|AAM41257.1| initiation factor IF-1 [Xanthomonas campestris pv. campestris str.
           ATCC 33913]
 gi|66573862|gb|AAY49272.1| initiation factor IF-1 [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++++EF G VSE LPN  FRVKL                                  
Sbjct: 1   MSKDDSIEFEGSVSETLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGYEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|325955018|ref|YP_004238678.1| translation initiation factor IF-1 [Weeksella virosa DSM 16922]
 gi|323437636|gb|ADX68100.1| Translation initiation factor IF-1 [Weeksella virosa DSM 16922]
          Length = 71

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G ++E L NA FRV+L                                  
Sbjct: 1   MAKQKHIEQDGTITEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +  VV    +G+MR H I++  GDKVK+ M+PYD+T+ RI+YR+
Sbjct: 27  ----ENGHVVTCNISGKMRMHYIKLLPGDKVKIEMSPYDLTKGRISYRY 71


>gi|300742034|ref|ZP_07072055.1| translation initiation factor IF-1 [Rothia dentocariosa M567]
 gi|300381219|gb|EFJ77781.1| translation initiation factor IF-1 [Rothia dentocariosa M567]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVIEALPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|182436604|ref|YP_001824323.1| translation initiation factor IF-1 [Streptomyces griseus subsp.
           griseus NBRC 13350]
 gi|239943600|ref|ZP_04695537.1| translation initiation factor IF-1 [Streptomyces roseosporus NRRL
           15998]
 gi|239990053|ref|ZP_04710717.1| translation initiation factor IF-1 [Streptomyces roseosporus NRRL
           11379]
 gi|254383149|ref|ZP_04998503.1| translation initiation factor IF-1 [Streptomyces sp. Mg1]
 gi|254391370|ref|ZP_05006573.1| translational initiation factor IF1 [Streptomyces clavuligerus ATCC
           27064]
 gi|291447067|ref|ZP_06586457.1| translation initiation factor IF-1 [Streptomyces roseosporus NRRL
           15998]
 gi|297192680|ref|ZP_06910078.1| translational initiation factor IF1 [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|302536274|ref|ZP_07288616.1| translation initiation factor IF-1 [Streptomyces sp. C]
 gi|302543338|ref|ZP_07295680.1| translation initiation factor IF-1 [Streptomyces hygroscopicus ATCC
           53653]
 gi|307328053|ref|ZP_07607234.1| translation initiation factor IF-1 [Streptomyces violaceusniger Tu
           4113]
 gi|326442879|ref|ZP_08217613.1| translation initiation factor IF-1 [Streptomyces clavuligerus ATCC
           27064]
 gi|326777226|ref|ZP_08236491.1| Translation initiation factor IF-1 [Streptomyces cf. griseus
           XylebKG-1]
 gi|178465120|dbj|BAG19640.1| putative translation initiation factor IF-1 [Streptomyces griseus
           subsp. griseus NBRC 13350]
 gi|194342048|gb|EDX23014.1| translation initiation factor IF-1 [Streptomyces sp. Mg1]
 gi|197705060|gb|EDY50872.1| translational initiation factor IF1 [Streptomyces clavuligerus ATCC
           27064]
 gi|197721665|gb|EDY65573.1| translational initiation factor IF1 [Streptomyces pristinaespiralis
           ATCC 25486]
 gi|291350014|gb|EFE76918.1| translation initiation factor IF-1 [Streptomyces roseosporus NRRL
           15998]
 gi|297159620|gb|ADI09332.1| translation initiation factor IF-1 [Streptomyces bingchenggensis
           BCW-1]
 gi|302445169|gb|EFL16985.1| translation initiation factor IF-1 [Streptomyces sp. C]
 gi|302460956|gb|EFL24049.1| translation initiation factor IF-1 [Streptomyces himastatinicus
           ATCC 53653]
 gi|306886358|gb|EFN17363.1| translation initiation factor IF-1 [Streptomyces violaceusniger Tu
           4113]
 gi|311896540|dbj|BAJ28948.1| putative translation initiation factor IF-1 [Kitasatospora setae
           KM-6054]
 gi|320009079|gb|ADW03929.1| translation initiation factor IF-1 [Streptomyces flavogriseus ATCC
           33331]
 gi|326657559|gb|EGE42405.1| Translation initiation factor IF-1 [Streptomyces cf. griseus
           XylebKG-1]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K +  +E  G V E LPNA F+V+L                                 
Sbjct: 1   MAKKQGAIEIEGTVIESLPNAMFKVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----QNGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|187929523|ref|YP_001900010.1| translation initiation factor IF-1 [Ralstonia pickettii 12J]
 gi|241663642|ref|YP_002982002.1| translation initiation factor IF-1 [Ralstonia pickettii 12D]
 gi|309781701|ref|ZP_07676434.1| translation initiation factor IF-1 [Ralstonia sp. 5_7_47FAA]
 gi|187726413|gb|ACD27578.1| translation initiation factor IF-1 [Ralstonia pickettii 12J]
 gi|240865669|gb|ACS63330.1| translation initiation factor IF-1 [Ralstonia pickettii 12D]
 gi|308919342|gb|EFP65006.1| translation initiation factor IF-1 [Ralstonia sp. 5_7_47FAA]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +EF G+VSE LP+  FRV+L                                  
Sbjct: 1   MAKEELIEFEGVVSEALPDNRFRVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + AY +G+M+KHRIRI  GD+VK+ M+PYD+T+ RI YR K
Sbjct: 27  ----ENGVEIWAYASGKMQKHRIRILAGDRVKLEMSPYDLTKGRINYRHK 72


>gi|255038111|ref|YP_003088732.1| translation initiation factor IF-1 [Dyadobacter fermentans DSM
           18053]
 gi|254950867|gb|ACT95567.1| translation initiation factor IF-1 [Dyadobacter fermentans DSM
           18053]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+ ++E  G++ E L NA FRV L                                  
Sbjct: 1   MAKQASIEQDGVILEALSNAMFRVVL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   VIA+ +G+MR H I+I  GD+VK+ M+PYD+++ARITYR+K
Sbjct: 27  ----ENKHEVIAHISGKMRMHYIKILPGDRVKLEMSPYDLSKARITYRYK 72


>gi|237749536|ref|ZP_04580016.1| translation initiation factor IF-1 [Oxalobacter formigenes OXCC13]
 gi|229380898|gb|EEO30989.1| translation initiation factor IF-1 [Oxalobacter formigenes OXCC13]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + + LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEILDNLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRTK 72


>gi|330958175|gb|EGH58435.1| translation initiation factor IF-1 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE++ E  G V + LPN  FRV+L                                  
Sbjct: 1   MSKEDSFEMEGTVVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVDLTPYDLSKGRITYRAR 72


>gi|163840862|ref|YP_001625267.1| translation initiation factor IF-1 [Renibacterium salmoninarum ATCC
           33209]
 gi|190359675|sp|A9WSR5|IF1_RENSM RecName: Full=Translation initiation factor IF-1
 gi|162954338|gb|ABY23853.1| translation initiation factor IF-1 [Renibacterium salmoninarum ATCC
           33209]
          Length = 76

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G+V+E LPNA FRV+L                                 
Sbjct: 4   MAKKDGVIEIEGVVTEALPNAMFRVELT-------------------------------- 31

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  +V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 32  ------NKHIVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 76


>gi|184200285|ref|YP_001854492.1| translation initiation factor IF-1 [Kocuria rhizophila DC2201]
 gi|183580515|dbj|BAG28986.1| translation initiation factor IF-1 [Kocuria rhizophila DC2201]
          Length = 73

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA+FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGTVVEALPNASFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|256544528|ref|ZP_05471901.1| translation initiation factor IF-1 [Anaerococcus vaginalis ATCC
           51170]
 gi|256399853|gb|EEU13457.1| translation initiation factor IF-1 [Anaerococcus vaginalis ATCC
           51170]
          Length = 93

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E +G+V E LPNA F+V+L                                  
Sbjct: 22  MSKKDAIEVTGVVKEALPNAIFKVEL---------------------------------- 47

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GD V V ++PYD+T+ RIT+R K
Sbjct: 48  ----ENGHEIQAHISGKLRMNYIRILPGDTVTVELSPYDLTQGRITWRRK 93


>gi|120554675|ref|YP_959026.1| translation initiation factor IF-1 [Marinobacter aquaeolei VT8]
 gi|190359649|sp|A1U1H0|IF1_MARAV RecName: Full=Translation initiation factor IF-1
 gi|120324524|gb|ABM18839.1| bacterial translation initiation factor 1 (bIF-1) [Marinobacter
           aquaeolei VT8]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G++ + LPN  FRV+L                                  
Sbjct: 1   MAKSDVIEMEGVIVDTLPNTMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 28  -----NGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|227549864|ref|ZP_03979913.1| initiation factor IF1 [Corynebacterium lipophiloflavum DSM 44291]
 gi|227078119|gb|EEI16082.1| initiation factor IF1 [Corynebacterium lipophiloflavum DSM 44291]
          Length = 72

 Score =  109 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE  +E  G + E L NA FRV+L                                  
Sbjct: 1   MAKEGAIEVEGRIVEPLKNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G+MR+H IRI   D+V V ++PYD+ R RITYR+K
Sbjct: 28  -----NGHQVLAHISGKMRQHYIRILPEDRVIVELSPYDLDRGRITYRYK 72


>gi|242279860|ref|YP_002991989.1| translation initiation factor IF-1 [Desulfovibrio salexigens DSM
           2638]
 gi|242122754|gb|ACS80450.1| translation initiation factor IF-1 [Desulfovibrio salexigens DSM
           2638]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +  +GIV E LPNA FRV+L                                  
Sbjct: 1   MAKEEGIAVNGIVEEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MRK RIR+  GDKV V ++PYD+TR RITYR
Sbjct: 27  ----ENGHEVLAHISGKMRKFRIRVMPGDKVTVELSPYDLTRGRITYR 70


>gi|332669541|ref|YP_004452549.1| translation initiation factor IF-1 [Cellulomonas fimi ATCC 484]
 gi|332338579|gb|AEE45162.1| translation initiation factor IF-1 [Cellulomonas fimi ATCC 484]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGSVVEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|12230141|sp|O98459|IF1C_SPIMX RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|4007875|gb|AAC95315.1| initiation factor A [Spirogyra maxima]
          Length = 84

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G ++E LPNA FRV L                                  
Sbjct: 1   MKKQNLVEMEGTITESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ IRI +GD+VKV ++PYD+++ RITYR +
Sbjct: 28  -----NGCYVLAHISGKIRRNYIRILIGDRVKVELSPYDLSKGRITYRLR 72


>gi|86356236|ref|YP_468128.1| translation initiation factor IF-1 [Rhizobium etli CFN 42]
 gi|116250388|ref|YP_766226.1| translation initiation factor IF-1 [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|190890285|ref|YP_001976827.1| translation initiation factor IF-1 protein [Rhizobium etli CIAT
           652]
 gi|209547851|ref|YP_002279768.1| translation initiation factor IF-1 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|218459709|ref|ZP_03499800.1| translation initiation factor IF-1 [Rhizobium etli Kim 5]
 gi|218506659|ref|ZP_03504537.1| translation initiation factor IF-1 [Rhizobium etli Brasil 5]
 gi|218671899|ref|ZP_03521568.1| translation initiation factor IF-1 [Rhizobium etli GR56]
 gi|241203024|ref|YP_002974120.1| translation initiation factor IF-1 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|119371097|sp|Q2KCN5|IF1_RHIEC RecName: Full=Translation initiation factor IF-1
 gi|119371098|sp|Q1MLP3|IF1_RHIL3 RecName: Full=Translation initiation factor IF-1
 gi|86280338|gb|ABC89401.1| translation initiation factor IF-1 protein [Rhizobium etli CFN 42]
 gi|115255036|emb|CAK06110.1| putative translation initiation factor [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|190695564|gb|ACE89649.1| translation initiation factor IF-1 protein [Rhizobium etli CIAT
           652]
 gi|209533607|gb|ACI53542.1| translation initiation factor IF-1 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|240856914|gb|ACS54581.1| translation initiation factor IF-1 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE LEF GIV+ELLPNA FRVKL                                  
Sbjct: 1   MPKEEVLEFPGIVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|118602823|ref|YP_904038.1| translation initiation factor IF-1 [Candidatus Ruthia magnifica
           str. Cm (Calyptogena magnifica)]
 gi|190359685|sp|A1AXB0|IF1_RUTMC RecName: Full=Translation initiation factor IF-1
 gi|118567762|gb|ABL02567.1| bacterial translation initiation factor 1 (bIF-1) [Candidatus
           Ruthia magnifica str. Cm (Calyptogena magnifica)]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPN  F V+L                                  
Sbjct: 1   MSKSDYIELEGVVKEKLPNTIFTVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A+ +G++RKH IRI  GDKV V M PYD+T+ RI +R K
Sbjct: 27  ----ENGHRILAHISGKIRKHYIRILPGDKVTVEMTPYDLTKGRIIFRHK 72


>gi|11466738|ref|NP_039334.1| translation initiation factor 1 [Marchantia polymorpha]
 gi|124196|sp|P12134|IF1C_MARPO RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|11709|emb|CAA28120.1| infA [Marchantia polymorpha]
          Length = 78

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G+V E LPNA FRV L                                  
Sbjct: 1   MEKQKLIDMEGVVIESLPNATFRVYLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G++R++ IRI  GD+VKV ++PYD+T+ RITYR +
Sbjct: 28  -----NGCIVLTHISGKIRRNYIRILPGDRVKVELSPYDLTKGRITYRLR 72


>gi|299138168|ref|ZP_07031348.1| translation initiation factor IF-1 [Acidobacterium sp. MP5ACTX8]
 gi|298600098|gb|EFI56256.1| translation initiation factor IF-1 [Acidobacterium sp. MP5ACTX8]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E   +V E LPNA F+V+L                                  
Sbjct: 1   MSKEDAIEVMAVVVETLPNALFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +GRMRK+ IRI  GD+V + ++PYD+ R RI YR+K
Sbjct: 27  ----ENKHQVLAHVSGRMRKNFIRILPGDRVAIELSPYDLNRGRIVYRYK 72


>gi|269218967|ref|ZP_06162821.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 848
           str. F0332]
 gi|269212078|gb|EEZ78418.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 848
           str. F0332]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEVEGAVVEALPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+A+ +G+MR+H I+I   D+V V + PYD++R RI YR+K
Sbjct: 28  -----ENGHVVLAHISGKMRQHYIKILPEDRVVVELTPYDLSRGRIVYRYK 73


>gi|152964680|ref|YP_001360464.1| translation initiation factor IF-1 [Kineococcus radiotolerans
           SRS30216]
 gi|190359705|sp|A6W5W1|IF1_KINRD RecName: Full=Translation initiation factor IF-1
 gi|151359197|gb|ABS02200.1| translation initiation factor IF-1 [Kineococcus radiotolerans
           SRS30216]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           MPK++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MPKKDGVIEIEGTVIEALPNAMFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|126667263|ref|ZP_01738236.1| translation initiation factor IF-1 [Marinobacter sp. ELB17]
 gi|126628208|gb|EAZ98832.1| translation initiation factor IF-1 [Marinobacter sp. ELB17]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G++ + LPN  FRV+L                                  
Sbjct: 1   MAKTDVIEMEGVIIDTLPNTMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 28  -----NGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|284992851|ref|YP_003411405.1| translation initiation factor IF-1 [Geodermatophilus obscurus DSM
           43160]
 gi|284066096|gb|ADB77034.1| translation initiation factor IF-1 [Geodermatophilus obscurus DSM
           43160]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEVEGRVVEPLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----QNGHRVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|332295373|ref|YP_004437296.1| Translation initiation factor IF-1 [Thermodesulfobium narugense DSM
           14796]
 gi|332178476|gb|AEE14165.1| Translation initiation factor IF-1 [Thermodesulfobium narugense DSM
           14796]
          Length = 74

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           + KEE +E  G++ E LPNA FRV+L                                  
Sbjct: 3   LAKEEAIEVEGVILEALPNAMFRVEL---------------------------------- 28

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   V++AY +G+MR + I+I  GD+VKV ++PYD+TR RI YR K
Sbjct: 29  ----ETGHVILAYVSGKMRMNFIKIVPGDRVKVELSPYDLTRGRIIYRMK 74


>gi|291461039|ref|ZP_06026587.2| translation initiation factor IF-1 [Fusobacterium periodonticum
           ATCC 33693]
 gi|291379323|gb|EFE86841.1| translation initiation factor IF-1 [Fusobacterium periodonticum
           ATCC 33693]
          Length = 77

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G + E LPNA F+V+L                                  
Sbjct: 5   MSKKDVIELEGTIVEALPNAMFKVEL---------------------------------- 30

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 31  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 76


>gi|256390168|ref|YP_003111732.1| translation initiation factor IF-1 [Catenulispora acidiphila DSM
           44928]
 gi|256356394|gb|ACU69891.1| translation initiation factor IF-1 [Catenulispora acidiphila DSM
           44928]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKEGAIEIEGTIIESLPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLTRGRIVYRYK 73


>gi|146329545|ref|YP_001210081.1| translation initiation factor IF-1 [Dichelobacter nodosus VCS1703A]
 gi|190359636|sp|A5EXE7|IF1_DICNV RecName: Full=Translation initiation factor IF-1
 gi|146233015|gb|ABQ13993.1| translation initiation factor IF-1 [Dichelobacter nodosus VCS1703A]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E +G V E LPN  FRV+L                                  
Sbjct: 1   MSKEENIELTGTVIETLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +GRMRKH IRI  GDKVKV M PYD+++ RI +R K
Sbjct: 27  ----ENGHQINAHISGRMRKHYIRILTGDKVKVEMTPYDLSKGRIVFREK 72


>gi|56708060|ref|YP_169956.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89256554|ref|YP_513916.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica LVS]
 gi|110670531|ref|YP_667088.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115314986|ref|YP_763709.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|167010980|ref|ZP_02275911.1| protein-synthesizing GTPase [Francisella tularensis subsp.
           holarctica FSC200]
 gi|169656642|ref|YP_001428739.2| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187931700|ref|YP_001891684.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|224457148|ref|ZP_03665621.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254367875|ref|ZP_04983895.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369459|ref|ZP_04985471.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254370547|ref|ZP_04986552.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874863|ref|ZP_05247573.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|290953091|ref|ZP_06557712.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313697|ref|ZP_06804279.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|73920039|sp|Q5NG86|IF1_FRATT RecName: Full=Translation initiation factor IF-1
 gi|119370865|sp|Q14HN8|IF1_FRAT1 RecName: Full=Translation initiation factor IF-1
 gi|119370866|sp|Q2A2Y6|IF1_FRATH RecName: Full=Translation initiation factor IF-1
 gi|119370867|sp|Q0BLG2|IF1_FRATO RecName: Full=Translation initiation factor IF-1
 gi|190359780|sp|A7NCT0|IF1_FRATF RecName: Full=Translation initiation factor IF-1
 gi|54114217|gb|AAV29742.1| NT02FT0565 [synthetic construct]
 gi|56604552|emb|CAG45599.1| translation initiation factor IF [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|89144385|emb|CAJ79675.1| translation initiation factor IF [Francisella tularensis subsp.
           holarctica LVS]
 gi|110320864|emb|CAL08982.1| translation initiation factor IF [Francisella tularensis subsp.
           tularensis FSC198]
 gi|115129885|gb|ABI83072.1| protein-synthesizing GTPase [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253685|gb|EBA52779.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica 257]
 gi|151568790|gb|EDN34444.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis FSC033]
 gi|157122409|gb|EDO66549.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|164551710|gb|ABU61783.2| translation initiation factor IF-1 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|187712609|gb|ACD30906.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|254840862|gb|EET19298.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282159256|gb|ADA78647.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGVVLEALPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGRIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK 72


>gi|15616924|ref|NP_240137.1| translation initiation factor IF-1 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681678|ref|YP_002468064.1| translation initiation factor IF-1 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219682233|ref|YP_002468617.1| translation initiation factor IF-1 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471369|ref|ZP_05635368.1| translation initiation factor IF-1 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11132703|sp|P57400|IF1_BUCAI RecName: Full=Translation initiation factor IF-1
 gi|25299554|pir||G84966 translation initiation factor IF-1 [imported] - Buchnera sp.
           (strain APS)
 gi|10038989|dbj|BAB13023.1| translation initiation factor IF-1 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621966|gb|ACL30122.1| translation initiation factor IF-1 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624521|gb|ACL30676.1| translation initiation factor IF-1 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311086053|gb|ADP66135.1| translation initiation factor IF-1 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086626|gb|ADP66707.1| translation initiation factor IF-1 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311087209|gb|ADP67289.1| translation initiation factor IF-1 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087730|gb|ADP67809.1| translation initiation factor IF-1 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G+V + LPN  FRV+L                                  
Sbjct: 1   MSKEENIEMQGVVIDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R +
Sbjct: 27  ----ENKHIVTAHISGKMRKNYIRILTGDKVTVELTPYDLTKGRIIFRSR 72


>gi|271962659|ref|YP_003336855.1| translation initiation factor IF-1 [Streptosporangium roseum DSM
           43021]
 gi|270505834|gb|ACZ84112.1| translation initiation factor IF-1 [Streptosporangium roseum DSM
           43021]
          Length = 73

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEIEGTVVESLPNAMFRVQLD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +GRMR H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGRMRMHYIRILPDDRVVVELSPYDLSRGRIVYRYK 73


>gi|222823134|ref|YP_002574707.1| translation initiation factor IF-1 [Campylobacter lari RM2100]
 gi|222538355|gb|ACM63456.1| translation initiation factor IF-1 [Campylobacter lari RM2100]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDIIEIDGNVIEALPNATFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H IRI  GD+VKV + PY + + RIT+R+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIRIMPGDRVKVELTPYSLDKGRITFRYK 72


>gi|237753002|ref|ZP_04583482.1| translation initiation factor IF-1 [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375269|gb|EEO25360.1| translation initiation factor IF-1 [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEVDGIVKEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AGRMR H I+I  GDKVK+ + PY + + RIT+R+K
Sbjct: 27  ----ENGHIILCHIAGRMRMHYIKILQGDKVKIELTPYSLDKGRITFRYK 72


>gi|114707694|ref|ZP_01440589.1| translation initiation factor IF-1 [Fulvimarina pelagi HTCC2506]
 gi|114536938|gb|EAU40067.1| translation initiation factor IF-1 [Fulvimarina pelagi HTCC2506]
          Length = 72

 Score =  108 bits (270), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G V ELLPNA FRVKL                                  
Sbjct: 1   MAKEEVLEFPGEVVELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLTGDKVLVEMTPYDLTKGRITYRFK 72


>gi|319442999|ref|ZP_07992155.1| translation initiation factor IF-1 [Corynebacterium variabile DSM
           44702]
          Length = 73

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKEGAIEVEGKIVEPLPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|320108373|ref|YP_004183963.1| translation initiation factor IF-1 [Terriglobus saanensis SP1PR4]
 gi|319926894|gb|ADV83969.1| translation initiation factor IF-1 [Terriglobus saanensis SP1PR4]
          Length = 72

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E   +V E LPNA F+V++                                  
Sbjct: 1   MSKEDAIEVMAVVVETLPNAMFKVEM---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +GRMRK+ IRI  GD+V + ++PYD+ R RITYR+K
Sbjct: 27  ----ENKHQVLAHVSGRMRKNFIRILPGDRVAIELSPYDLNRGRITYRYK 72


>gi|296268576|ref|YP_003651208.1| translation initiation factor IF-1 [Thermobispora bispora DSM
           43833]
 gi|296091363|gb|ADG87315.1| translation initiation factor IF-1 [Thermobispora bispora DSM
           43833]
          Length = 73

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEIEGTVVETLPNAMFRVQLD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  +V+A+ +GRMR H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHMVLAHISGRMRMHYIRILPDDRVVVELSPYDLSRGRIVYRYK 73


>gi|256027715|ref|ZP_05441549.1| protein translation initiation factor 1 [Fusobacterium sp. D11]
          Length = 73

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ E LPNA F+V+L                                  
Sbjct: 1   MSKKDVIELEGVIVEALPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 27  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 72


>gi|60117160|ref|YP_209494.1| translation initiation factor 1 [Huperzia lucidula]
 gi|68052072|sp|Q5SD15|IF1C_HUPLU RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|50659968|gb|AAT80690.1| translational initiation factor 1 [Huperzia lucidula]
          Length = 78

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G+V+E LPN  FRV L                                  
Sbjct: 1   MKKQKLIDMEGVVTESLPNTMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   V+ + +GRMR++ IRI  GD+VKV  +PYD+T+ RITYRF
Sbjct: 28  -----NGCQVLTHVSGRMRRNYIRILPGDRVKVESSPYDLTKGRITYRF 71


>gi|91200689|emb|CAJ73740.1| strongly similar to translation initiation factor IF-1 [Candidatus
           Kuenenia stuttgartiensis]
          Length = 72

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 47/108 (43%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +    +V E LPNA FRV+L                                  
Sbjct: 1   MAKEEPIRVEAVVKESLPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   ++A+ +G+MR H I+I  GDKV V M+PYD+ + RI YR
Sbjct: 27  ----QNGHKILAHVSGKMRMHFIKILPGDKVTVEMSPYDLDKGRIIYR 70


>gi|48428202|sp|P61694|IF1_SPIKU RecName: Full=Translation initiation factor IF-1
 gi|34849413|gb|AAP58912.1| translation initiation factor IF-1 [Spiroplasma kunkelii CR2-3x]
          Length = 72

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + LE  G + E+LPN  F+V+L                                  
Sbjct: 1   MAKTDLLEVQGTILEVLPNTMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R + IRI  GD V V M+PYD+ R RI +R K
Sbjct: 27  ----KNGATILAHVSGKIRMNYIRILPGDTVVVEMSPYDLERGRIVFRHK 72


>gi|322436523|ref|YP_004218735.1| translation initiation factor IF-1 [Acidobacterium sp. MP5ACTX9]
 gi|321164250|gb|ADW69955.1| translation initiation factor IF-1 [Acidobacterium sp. MP5ACTX9]
          Length = 72

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E   +V E LPNA F+V+L                                  
Sbjct: 1   MSKEDAIEVMAVVVETLPNAMFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +    +A+ +GRMRK+ IRI  GD+V + ++PYD+ R RI YR+K
Sbjct: 27  ----ENKHQALAHVSGRMRKNFIRILPGDRVAIELSPYDLNRGRIVYRYK 72


>gi|256825863|ref|YP_003149823.1| translation initiation factor 1 [Kytococcus sedentarius DSM 20547]
 gi|256689256|gb|ACV07058.1| bacterial translation initiation factor 1 (bIF-1) [Kytococcus
           sedentarius DSM 20547]
          Length = 73

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEVEGTIVEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+A+ +G+MR+H IRI   D+V V ++PYD++R RI +R +
Sbjct: 29  ------NGHVVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVFRHR 73


>gi|302336998|ref|YP_003802204.1| translation initiation factor IF-1 [Spirochaeta smaragdinae DSM
           11293]
 gi|301634183|gb|ADK79610.1| translation initiation factor IF-1 [Spirochaeta smaragdinae DSM
           11293]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 54/110 (49%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  GIV E LPN  FRV+L                                  
Sbjct: 1   MAKEEAIEVEGIVKESLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++A+ +G+MRKH IRI  GDKV+VA++PYD+TR RI YR +
Sbjct: 27  ----KNGHLILAHLSGKMRKHYIRIVPGDKVRVALSPYDLTRGRIIYRER 72


>gi|239831088|ref|ZP_04679417.1| translation initiation factor IF-1 [Ochrobactrum intermedium LMG
           3301]
 gi|239823355|gb|EEQ94923.1| translation initiation factor IF-1 [Ochrobactrum intermedium LMG
           3301]
          Length = 97

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V+ELLPNA FRVKL                                  
Sbjct: 26  MAKEEVLEFPGVVTELLPNAMFRVKL---------------------------------- 51

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 52  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 97


>gi|283796532|ref|ZP_06345685.1| translation initiation factor IF-1 [Clostridium sp. M62/1]
 gi|291075946|gb|EFE13310.1| translation initiation factor IF-1 [Clostridium sp. M62/1]
 gi|295092568|emb|CBK78675.1| translation initiation factor IF-1 [Clostridium cf. saccharolyticum
           K10]
 gi|295115256|emb|CBL36103.1| translation initiation factor IF-1 [butyrate-producing bacterium
           SM4/1]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGTVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R + IRI  GD+V + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHKVLATISGKLRMNYIRILPGDRVTLEMSPYDLSKGRIIWRDK 72


>gi|119371095|sp|Q4FRV1|IF1_PSYA2 RecName: Full=Translation initiation factor IF-1
 gi|119371096|sp|Q1QAF7|IF1_PSYCK RecName: Full=Translation initiation factor IF-1
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E +EF G V + LPN  F+V+L                                  
Sbjct: 1   MAKDEIIEFEGEVIDTLPNTLFKVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MRKH IRI  GDKVKV M PYD+++ RITYR K
Sbjct: 27  ----ENGHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLSKGRITYRGK 72


>gi|307719352|ref|YP_003874884.1| translation initiation factor IF-1 1 [Spirochaeta thermophila DSM
           6192]
 gi|306533077|gb|ADN02611.1| translation initiation factor IF-1 1 [Spirochaeta thermophila DSM
           6192]
          Length = 100

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/108 (34%), Positives = 53/108 (49%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE+ +E  GIV E LPN  FRV+L                                    
Sbjct: 31  KEDAIEVEGIVREALPNTMFRVEL------------------------------------ 54

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +  +++A+ +G+MRK+ IRI  GD+VKVA++PYD+TR RI YR +
Sbjct: 55  --ENGHLILAHLSGKMRKYFIRIVPGDRVKVALSPYDLTRGRIIYRER 100


>gi|154507841|ref|ZP_02043483.1| hypothetical protein ACTODO_00323 [Actinomyces odontolyticus ATCC
           17982]
 gi|293190236|ref|ZP_06608732.1| translation initiation factor IF-1 [Actinomyces odontolyticus
           F0309]
 gi|315605922|ref|ZP_07880953.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|320094557|ref|ZP_08026323.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 178
           str. F0338]
 gi|153797475|gb|EDN79895.1| hypothetical protein ACTODO_00323 [Actinomyces odontolyticus ATCC
           17982]
 gi|292821052|gb|EFF80005.1| translation initiation factor IF-1 [Actinomyces odontolyticus
           F0309]
 gi|315312204|gb|EFU60290.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 180
           str. F0310]
 gi|319978472|gb|EFW10049.1| translation initiation factor IF-1 [Actinomyces sp. oral taxon 178
           str. F0338]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEMEGTVVEALPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +  VV+ + AG+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 28  -----KNGHVVLGHIAGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|307565114|ref|ZP_07627622.1| translation initiation factor IF-1 [Prevotella amnii CRIS 21A-A]
 gi|307346145|gb|EFN91474.1| translation initiation factor IF-1 [Prevotella amnii CRIS 21A-A]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  GI+ E L NA FRV+L                                  
Sbjct: 1   MAKQTAIEQDGIILEALSNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MR H I+I  GDK+KV M+PYD+T+ RI +R+K
Sbjct: 27  ----ENGVEIIAHISGKMRMHYIKILPGDKIKVEMSPYDLTKGRIVFRYK 72


>gi|161594048|ref|NP_903835.2| translation initiation factor IF-1 [Chromobacterium violaceum ATCC
           12472]
 gi|44888027|sp|Q7NQH3|IF12_CHRVO RecName: Full=Translation initiation factor IF-1 2
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T++  G V E LP+A F++KL                                  
Sbjct: 1   MAKEDTIQMQGEVLENLPSATFKIKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHVVLGHISGKMRMHYIRILPGDKVTVELTPYDLSRARIVFRAK 72


>gi|283768441|ref|ZP_06341353.1| translation initiation factor IF-1 [Bulleidia extructa W1219]
 gi|283104833|gb|EFC06205.1| translation initiation factor IF-1 [Bulleidia extructa W1219]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ ++LPNANF VKL                                  
Sbjct: 1   MSKQDVIEIEGVIEDILPNANFLVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ AG++R + IRI  GD+V V ++PYD+TR RITYR K
Sbjct: 27  ----QNGHEIRAHVAGKIRMNYIRILPGDRVTVEISPYDLTRGRITYRHK 72


>gi|168334328|ref|ZP_02692515.1| translation initiation factor IF-1 [Epulopiscium sp. 'N.t.
           morphotype B']
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G + E LPNA F+V++                                  
Sbjct: 1   MAKNDVIEVEGTILEKLPNAMFKVEI---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   VV+ + +G++R + IR+  GDKV V ++PYD+T+ RI +R K
Sbjct: 27  ----EGGHVVLGHISGKLRMNFIRVLPGDKVTVELSPYDLTKGRIIWRSK 72


>gi|317125845|ref|YP_004099957.1| bacterial translation initiation factor 1 (bIF-1) [Intrasporangium
           calvum DSM 43043]
 gi|315589933|gb|ADU49230.1| bacterial translation initiation factor 1 (bIF-1) [Intrasporangium
           calvum DSM 43043]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGTIVEALPNAMFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI +R++
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVFRYR 73


>gi|295111402|emb|CBL28152.1| bacterial translation initiation factor 1 (bIF-1) [Synergistetes
           bacterium SGP1]
          Length = 76

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KEE +E  G++SE LPNA FRV+L                                    
Sbjct: 7   KEEVIEAKGVISEPLPNAMFRVEL------------------------------------ 30

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   ++A+ +G+MR H IRI  GD+V V ++PYD++R RI YR+K
Sbjct: 31  --ENGHKLLAHVSGKMRMHFIRILPGDRVLVEVSPYDLSRGRIIYRYK 76


>gi|154174484|ref|YP_001409135.1| translation initiation factor IF-1 [Campylobacter curvus 525.92]
 gi|190359582|sp|A7H0Z3|IF1_CAMC5 RecName: Full=Translation initiation factor IF-1
 gi|112802270|gb|EAT99614.1| translation initiation factor IF-1 [Campylobacter curvus 525.92]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIDGNVVEALPNATFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H I+I  GD+VKV + PY + + RITYR+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIKIMPGDRVKVELTPYSLDKGRITYRYK 72


>gi|258646029|ref|ZP_05733498.1| translation initiation factor IF-1 [Dialister invisus DSM 15470]
 gi|260403400|gb|EEW96947.1| translation initiation factor IF-1 [Dialister invisus DSM 15470]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 47/110 (42%), Gaps = 37/110 (33%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA FRVKL                                  
Sbjct: 1   MSKADVIEVEGKVVEKLPNAMFRVKLENG------------------------------- 29

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +V+A  +G+MR + IRI  GDKV + + PYD+   RITYR+K
Sbjct: 30  ------GHIVLATISGKMRMNFIRILPGDKVTIELTPYDLEHGRITYRYK 73


>gi|212550430|ref|YP_002308747.1| translation initiation factor IF-1 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|212548668|dbj|BAG83336.1| translation initiation factor IF-1 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+V E L NA FRV+L                                  
Sbjct: 1   MTKQSAIEHDGVVVEALSNAIFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G+MR H I+I  GDKVKV M+PYD+++ RI++R+K
Sbjct: 27  ----ENGHEIEAHISGKMRMHYIKILPGDKVKVEMSPYDLSKGRISFRYK 72


>gi|332968430|gb|EGK07497.1| translation initiation factor IF-1 [Kingella kingae ATCC 23330]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T++  G + E LPNA F+VKL                                  
Sbjct: 1   MAKEDTIQMQGEILETLPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G+MR H IRIS GDKV V M PYD+TRARI +R +
Sbjct: 27  ----ENGHEVLGHISGKMRMHYIRISPGDKVTVEMTPYDLTRARIVFRAR 72


>gi|311694970|gb|ADP97843.1| translation initiation factor IF-1 [marine bacterium HP15]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPK + +E  G++ + LPN  FRV+L                                  
Sbjct: 1   MPKSDAIEMEGVIIDTLPNTMFRVELS--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RI YR +
Sbjct: 28  -----NGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRIVYRAR 72


>gi|257459215|ref|ZP_05624334.1| translation initiation factor IF-1 [Campylobacter gracilis RM3268]
 gi|257443600|gb|EEV18724.1| translation initiation factor IF-1 [Campylobacter gracilis RM3268]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIDGNVIEALPNATFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H I+I  GD+VKV + PY + + RITYR+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIKIMPGDRVKVELTPYSLDKGRITYRYK 72


>gi|238916288|ref|YP_002929805.1| translation initiation factor IF-1 [Eubacterium eligens ATCC 27750]
 gi|238871648|gb|ACR71358.1| translation initiation factor IF-1 [Eubacterium eligens ATCC 27750]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGKVVEKLPNAFFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G++R + IRI  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHQILATISGKLRMNFIRILPGDKVTIELSPYDLTKGRIIWRDK 72


>gi|148273772|ref|YP_001223333.1| translation initiation factor IF-1 [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|170780762|ref|YP_001709094.1| translation initiation factor IF-1 [Clavibacter michiganensis
           subsp. sepedonicus]
 gi|190359591|sp|A5CU84|IF1_CLAM3 RecName: Full=Translation initiation factor IF-1
 gi|190359592|sp|B0RB68|IF1_CLAMS RecName: Full=Translation initiation factor IF-1
 gi|147831702|emb|CAN02671.1| translation initiation factor IF-1 [Clavibacter michiganensis
           subsp. michiganensis NCPPB 382]
 gi|169155330|emb|CAQ00433.1| translation initiation factor IF-1 [Clavibacter michiganensis
           subsp. sepedonicus]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGGVVEALPNAMFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVIVELSPYDLTRGRIVYRYK 73


>gi|296272661|ref|YP_003655292.1| translation initiation factor IF-1 [Arcobacter nitrofigilis DSM
           7299]
 gi|296096835|gb|ADG92785.1| translation initiation factor IF-1 [Arcobacter nitrofigilis DSM
           7299]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 37/110 (33%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIVIDGKVIEALPNAMFRVELDN-------------------------------- 28

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H I+I   DKVKV + PY + + RIT+R+K
Sbjct: 29  -----NGHVVLCHISGKMRMHYIKILPNDKVKVEITPYSLDKGRITHRYK 73


>gi|325675468|ref|ZP_08155152.1| translation initiation factor IF-1 [Rhodococcus equi ATCC 33707]
 gi|325553439|gb|EGD23117.1| translation initiation factor IF-1 [Rhodococcus equi ATCC 33707]
          Length = 85

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 13  MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 39

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 40  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 85


>gi|269128490|ref|YP_003301860.1| translation initiation factor IF-1 [Thermomonospora curvata DSM
           43183]
 gi|268313448|gb|ACY99822.1| translation initiation factor IF-1 [Thermomonospora curvata DSM
           43183]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 48/108 (44%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           KE  +E  G V E LPNA FRV+L                                    
Sbjct: 4   KEGAIEIEGTVVESLPNAMFRVELD----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +   V+A+ +G+MR H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ---NGHKVLAHISGKMRMHYIRILPDDRVVVELSPYDLSRGRIVYRYK 73


>gi|163868986|ref|YP_001610216.1| translation initiation factor IF-1 [Bartonella tribocorum CIP
           105476]
 gi|190359573|sp|A9IXQ8|IF1_BART1 RecName: Full=Translation initiation factor IF-1
 gi|161018663|emb|CAK02221.1| translation initiation factor IF-1 [Bartonella tribocorum CIP
           105476]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 60/110 (54%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEFSG+V+ELLPNA FRVKL                                  
Sbjct: 1   MSKEEVLEFSGVVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDK+ V M PYD+T+ RITYR+K
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDKIMVEMTPYDLTKGRITYRYK 72


>gi|237747386|ref|ZP_04577866.1| translation initiation factor IF-1 [Oxalobacter formigenes HOxBLS]
 gi|229378737|gb|EEO28828.1| translation initiation factor IF-1 [Oxalobacter formigenes HOxBLS]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G + + LPNA FRVKL                                  
Sbjct: 1   MAKDDVIQMQGEIVDNLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+ + +G+MR + IRI  GDKV V + PYD++RARI +R K
Sbjct: 27  ----ENGHMVLGHISGKMRMNYIRILPGDKVTVELTPYDLSRARIVFRTK 72


>gi|313183896|ref|YP_004021750.1| translational initiation factor 1 [Equisetum arvense]
 gi|281371616|gb|ADA63549.1| translational initiation factor 1 [Equisetum arvense]
          Length = 80

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  GIV+E LPNA FRV L                                  
Sbjct: 1   MNKQDLIDMEGIVTESLPNAMFRVCLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +G++R+  +RI  GD+VKV ++PYD+T+ RI YR +
Sbjct: 28  -----NGYEVLTHISGKIRRSYVRILPGDRVKVELSPYDLTKGRIIYRLR 72


>gi|291562748|emb|CBL41564.1| translation initiation factor IF-1 [butyrate-producing bacterium
           SS3/4]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G+V E LPNA F+V+L                                  
Sbjct: 1   MSKADVIEIEGVVVEKLPNAMFQVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A  +G++R + IRI  GDKV + M+PYD+++ RI +R K
Sbjct: 27  ----ENGHKVLATISGKLRMNYIRILPGDKVTLEMSPYDLSKGRIIWRDK 72


>gi|224417906|ref|ZP_03655912.1| translation initiation factor IF-1 [Helicobacter canadensis MIT
           98-5491]
 gi|253827245|ref|ZP_04870130.1| translation initiation factor IF-1 [Helicobacter canadensis MIT
           98-5491]
 gi|313141448|ref|ZP_07803641.1| translation initiation factor IF-1 [Helicobacter canadensis MIT
           98-5491]
 gi|253510651|gb|EES89310.1| translation initiation factor IF-1 [Helicobacter canadensis MIT
           98-5491]
 gi|313130479|gb|EFR48096.1| translation initiation factor IF-1 [Helicobacter canadensis MIT
           98-5491]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEIDGIVKEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AGRMR + I+I  GDKVK+ + PY + + RIT+R+K
Sbjct: 27  ----ENGHVILCHIAGRMRMNYIKILQGDKVKIELTPYSLDKGRITFRYK 72


>gi|118474616|ref|YP_891265.1| translation initiation factor IF-1 [Campylobacter fetus subsp.
           fetus 82-40]
 gi|157163853|ref|YP_001467699.1| translation initiation factor IF-1 [Campylobacter concisus 13826]
 gi|261886170|ref|ZP_06010209.1| translation initiation factor IF-1 [Campylobacter fetus subsp.
           venerealis str. Azul-94]
 gi|190359581|sp|A7ZFZ1|IF1_CAMC1 RecName: Full=Translation initiation factor IF-1
 gi|190359583|sp|A0RM32|IF1_CAMFF RecName: Full=Translation initiation factor IF-1
 gi|112800761|gb|EAT98105.1| translation initiation factor IF-1 [Campylobacter concisus 13826]
 gi|118413842|gb|ABK82262.1| translation initiation factor IF-1 [Campylobacter fetus subsp.
           fetus 82-40]
          Length = 72

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MAKDDVIEIDGNVVEALPNATFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AG+MR H I+I  GD+VKV + PY + + RITYR+K
Sbjct: 28  -----NKHIILCHIAGKMRMHYIKIMPGDRVKVELTPYSLDKGRITYRYK 72


>gi|84494749|ref|ZP_00993868.1| translation initiation factor [Janibacter sp. HTCC2649]
 gi|309812456|ref|ZP_07706211.1| translation initiation factor IF-1 [Dermacoccus sp. Ellin185]
 gi|84384242|gb|EAQ00122.1| translation initiation factor [Janibacter sp. HTCC2649]
 gi|308433761|gb|EFP57638.1| translation initiation factor IF-1 [Dermacoccus sp. Ellin185]
          Length = 73

 Score =  108 bits (269), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIEIEGTIVEALPNAMFRVELT-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI +R++
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVFRYR 73


>gi|300782633|ref|YP_003762924.1| translation initiation factor IF-1 [Amycolatopsis mediterranei U32]
 gi|302524016|ref|ZP_07276358.1| translation initiation factor IF-1 [Streptomyces sp. AA4]
 gi|331699150|ref|YP_004335389.1| translation initiation factor IF-1 [Pseudonocardia dioxanivorans
           CB1190]
 gi|299792147|gb|ADJ42522.1| translation initiation factor IF-1 [Amycolatopsis mediterranei U32]
 gi|302432911|gb|EFL04727.1| translation initiation factor IF-1 [Streptomyces sp. AA4]
 gi|326953839|gb|AEA27536.1| Translation initiation factor IF-1 [Pseudonocardia dioxanivorans
           CB1190]
          Length = 73

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEVEGRVVEPLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 28  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|289765674|ref|ZP_06525052.1| translation initiation factor 1 [Fusobacterium sp. D11]
 gi|289717229|gb|EFD81241.1| translation initiation factor 1 [Fusobacterium sp. D11]
          Length = 77

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G++ E LPNA F+V+L                                  
Sbjct: 5   MSKKDVIELEGVIVEALPNAMFKVEL---------------------------------- 30

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++ + +G+MR + I+I  GD V V ++PYD++R RI YR K
Sbjct: 31  ----ENGHTILGHISGKMRMNYIKILPGDGVTVQISPYDLSRGRIVYRKK 76


>gi|289526630|pdb|3I4O|A Chain A, Crystal Structure Of Translation Initiation Factor 1 From
           Mycobacterium Tuberculosis
 gi|289526631|pdb|3I4O|B Chain B, Crystal Structure Of Translation Initiation Factor 1 From
           Mycobacterium Tuberculosis
          Length = 79

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 7   MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 33

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 34  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 79


>gi|110004250|emb|CAK98588.1| translation initiation factor if-1 protein [Spiroplasma citri]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K   LE  G + E+LPN  F+V+L                                  
Sbjct: 1   MAKTNLLEVQGTILEVLPNTMFKVQL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++R + IRI  GD V V M+PYD+ R RI +R K
Sbjct: 27  ----ENGATILAHVSGKIRMNYIRILPGDTVVVEMSPYDLERGRIVFRHK 72


>gi|325108608|ref|YP_004269676.1| bacterial translation initiation factor 1 (bIF-1) [Planctomyces
           brasiliensis DSM 5305]
 gi|324968876|gb|ADY59654.1| bacterial translation initiation factor 1 (bIF-1) [Planctomyces
           brasiliensis DSM 5305]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V E L N  FRV+L                                  
Sbjct: 1   MAKEEAIEVEGTVVEALANTQFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A+ AG+MRKH IRI  GDKV V ++PYD+ R RI +R +
Sbjct: 27  ----ENGHLVLAHVAGKMRKHFIRIVPGDKVVVEVSPYDLNRGRIVFRER 72


>gi|313903128|ref|ZP_07836522.1| bacterial translation initiation factor 1 (bIF-1) [Thermaerobacter
           subterraneus DSM 13965]
 gi|317123074|ref|YP_004103077.1| bacterial translation initiation factor 1 (bIF-1) [Thermaerobacter
           marianensis DSM 12885]
 gi|313466630|gb|EFR62150.1| bacterial translation initiation factor 1 (bIF-1) [Thermaerobacter
           subterraneus DSM 13965]
 gi|315593054|gb|ADU52350.1| bacterial translation initiation factor 1 (bIF-1) [Thermaerobacter
           marianensis DSM 12885]
          Length = 74

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  KE  +E  G V E LPN  FRV+L                                 
Sbjct: 1   MARKENVVEVQGTVVEPLPNGMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G++R H IRI  GD+V + ++PYD+TR RITYR +
Sbjct: 29  ------NGHKVMAHVSGKIRMHFIRILPGDRVTLELSPYDLTRGRITYRHR 73


>gi|94499672|ref|ZP_01306209.1| Translation initiation factor IF-1 [Oceanobacter sp. RED65]
 gi|94428426|gb|EAT13399.1| Translation initiation factor IF-1 [Oceanobacter sp. RED65]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M +E+ +E  G V + LPN  FRVKL                                  
Sbjct: 1   MSREDHIEMDGEVIDTLPNTMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKVKV + PYD+++ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVKVELTPYDLSKGRITYRAR 72


>gi|167041964|gb|ABZ06701.1| putative S1 RNA binding domain protein [uncultured marine
           microorganism HF4000_141E02]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 47/108 (43%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE ++  G+V E LPN  FRV+L                                  
Sbjct: 1   MAKEEAIQMKGVVKETLPNTIFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   + A+ +G+MRK+ IRI  GD V V M PYD+T+ RI +R
Sbjct: 27  ----ENGHTITAHISGKMRKNYIRILTGDSVTVEMTPYDLTKGRIIFR 70


>gi|257054493|ref|YP_003132325.1| translation initiation factor IF-1 [Saccharomonospora viridis DSM
           43017]
 gi|256584365|gb|ACU95498.1| bacterial translation initiation factor 1 (bIF-1)
           [Saccharomonospora viridis DSM 43017]
          Length = 73

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEVEGRVIEPLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 28  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|323138210|ref|ZP_08073282.1| translation initiation factor IF-1 [Methylocystis sp. ATCC 49242]
 gi|322396462|gb|EFX98991.1| translation initiation factor IF-1 [Methylocystis sp. ATCC 49242]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF GIV+ELLP+A FRVKL                                  
Sbjct: 1   MAKEELLEFPGIVTELLPSAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV V M PYD+T+ RITYRF+
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLEGDKVLVEMTPYDLTKGRITYRFR 72


>gi|258627478|ref|ZP_05722259.1| translation initiation factor IF-1 [Vibrio mimicus VM603]
 gi|258580284|gb|EEW05252.1| translation initiation factor IF-1 [Vibrio mimicus VM603]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G V + L N  FRV+L                                  
Sbjct: 1   MAKEDVIEMQGTVLDTLLNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V M PYD+++ RI +R +
Sbjct: 27  ----ENGHIVTAHISGKMRKNYIRILTGDKVTVEMTPYDLSKGRIVFRAR 72


>gi|183601966|ref|ZP_02963335.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219682879|ref|YP_002469262.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|241190455|ref|YP_002967849.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241195861|ref|YP_002969416.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|183218851|gb|EDT89493.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219620529|gb|ACL28686.1| translation initiation factor IF-1 [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|240248847|gb|ACS45787.1| Translation initiation factor 1 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240250415|gb|ACS47354.1| Translation initiation factor 1 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|289178179|gb|ADC85425.1| Bacterial Protein Translation Initiation Factor 1 (IF-1)
           [Bifidobacterium animalis subsp. lactis BB-12]
 gi|295793442|gb|ADG32977.1| Translation initiation factor 1 [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G V E LPNA FRV+L                                  
Sbjct: 1   MAKDGVIEVEGRVVEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V+A  +G+MRK+ IRI   D+V + M+PYD+ R RITYR+K
Sbjct: 27  ----ENKHIVLATISGKMRKNYIRILPQDRVVLEMSPYDLNRGRITYRYK 72


>gi|302785518|ref|XP_002974530.1| hypothetical protein SELMODRAFT_102311 [Selaginella moellendorffii]
 gi|300157425|gb|EFJ24050.1| hypothetical protein SELMODRAFT_102311 [Selaginella moellendorffii]
          Length = 82

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 38/107 (35%)

Query: 4   EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPIS 63
           +  +E  G V+E LPNA FRV L                                     
Sbjct: 3   KNLIEMEGAVTESLPNAMFRVSLD------------------------------------ 26

Query: 64  YLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
             +   V+A+ +G++RK+ IR+  GD+VK+ ++PYD+++ RITYR +
Sbjct: 27  --NGCEVLAHVSGKIRKNFIRMLPGDRVKIELSPYDLSKGRITYRLR 71


>gi|325479150|gb|EGC82247.1| translation initiation factor IF-1 [Anaerococcus prevotii
           ACS-065-V-Col13]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E +G+V+E LPNA F+V+L                                  
Sbjct: 1   MSKKDAIEVTGVVTEALPNAIFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GDKV V ++PYD+++ RIT+R K
Sbjct: 28  -----NGHEIQAHISGKLRMNSIRILEGDKVTVELSPYDLSQGRITWRKK 72


>gi|242309340|ref|ZP_04808495.1| translation initiation factor IF-1 [Helicobacter pullorum MIT
           98-5489]
 gi|239523911|gb|EEQ63777.1| translation initiation factor IF-1 [Helicobacter pullorum MIT
           98-5489]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  GIV E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIEIDGIVKEALPNATFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +++ + AGRMR + I+I  GDKVK+ + PY + + RIT+R+K
Sbjct: 27  ----ENGHIILCHIAGRMRMNYIKILQGDKVKIELTPYSLDKGRITFRYK 72


>gi|332637079|ref|ZP_08415942.1| translation initiation factor IF-1 [Weissella cibaria KACC 11862]
          Length = 71

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 39/110 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M   + +E SG+V E LPNA F V+L                                  
Sbjct: 1   MA-NDVIEISGVVKETLPNAMFTVEL---------------------------------- 25

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++RK+ IRI  GD+V V M+PYD+T+ RITYRFK
Sbjct: 26  ----ENGAAILAHVSGKIRKNFIRILPGDRVTVEMSPYDLTKGRITYRFK 71


>gi|27904786|ref|NP_777912.1| translation initiation factor IF-1 [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
 gi|29427405|sp|P59430|IF1_BUCBP RecName: Full=Translation initiation factor IF-1
 gi|27904184|gb|AAO27017.1| translation initiation factor IF-1 [Buchnera aphidicola str. Bp
           (Baizongia pistaciae)]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V + LPN  FRV+L                                  
Sbjct: 1   MTKEDCIEMQGVVIDTLPNTMFRVQLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV + + PYD+++ RI +R +
Sbjct: 28  -----NKHIVTAHISGKMRKNYIRILTGDKVTLELTPYDLSKGRIIFRSR 72


>gi|171060576|ref|YP_001792925.1| translation initiation factor IF-1 [Leptothrix cholodnii SP-6]
 gi|170778021|gb|ACB36160.1| translation initiation factor IF-1 [Leptothrix cholodnii SP-6]
          Length = 89

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 52/109 (47%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  G V+E+LP++ FRV L                                  
Sbjct: 1   MAKEELIEMHGTVTEVLPDSRFRVTL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +   ++AYT+G+MRKH IRI  GD V + ++PYD+++ RIT+R 
Sbjct: 27  ----ENGHQLVAYTSGKMRKHHIRILAGDAVSLELSPYDLSKGRITFRH 71


>gi|224542261|ref|ZP_03682800.1| hypothetical protein CATMIT_01436 [Catenibacterium mitsuokai DSM
           15897]
 gi|224524803|gb|EEF93908.1| hypothetical protein CATMIT_01436 [Catenibacterium mitsuokai DSM
           15897]
          Length = 74

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 51/112 (45%), Gaps = 40/112 (35%)

Query: 1   MPK--EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDG 58
           M K  ++ +E    V E LPNA F+V+L                                
Sbjct: 1   MAKKKDDVIEVQATVVETLPNAMFKVQLD------------------------------- 29

Query: 59  VDPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                  +  V++A+ +G++R + IRI  GDKV V ++PYD+TR RIT+R K
Sbjct: 30  -------NGVVILAHVSGKIRMNYIRILPGDKVTVEISPYDLTRGRITFRHK 74


>gi|160881762|ref|YP_001560730.1| translation initiation factor IF-1 [Clostridium phytofermentans
           ISDg]
 gi|190359629|sp|A9KJH1|IF1_CLOPH RecName: Full=Translation initiation factor IF-1
 gi|160430428|gb|ABX43991.1| translation initiation factor IF-1 [Clostridium phytofermentans
           ISDg]
          Length = 72

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F V+L                                  
Sbjct: 1   MSKTDVVEIEGTVIEKLPNAMFSVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R + I+I  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----ENGHRVLAHISGKLRMNFIKIVPGDKVTLELSPYDLTKGRIIWRDK 72


>gi|119370816|sp|Q2G9H0|IF11_NOVAD RecName: Full=Translation initiation factor IF-1 1
          Length = 81

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 55/109 (50%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEMRGTVVELLPNAMFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                ++  ++ +TAG+MRK+RIR+ +GD+V V + PYD+T+ RITYRF
Sbjct: 27  ----ENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRF 71


>gi|49574616|ref|NP_848094.2| translation initiation factor 1 [Adiantum capillus-veneris]
 gi|68568739|sp|Q85FI8|IF1C_ADICA RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|48476027|gb|AAP29425.2| translation initiation factor 1 [Adiantum capillus-veneris]
          Length = 80

 Score =  107 bits (268), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G V+E LPNA FR  L                                  
Sbjct: 1   MKKQNLIDMEGTVTESLPNATFRACLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +GRMR+  IRI  GD+V+V ++PYD+T+ RI YR +
Sbjct: 28  -----NGCQVLTHISGRMRRSYIRILPGDRVRVELSPYDLTKGRIIYRLR 72


>gi|302759611|ref|XP_002963228.1| hypothetical protein SELMODRAFT_79973 [Selaginella moellendorffii]
 gi|300168496|gb|EFJ35099.1| hypothetical protein SELMODRAFT_79973 [Selaginella moellendorffii]
          Length = 82

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/107 (28%), Positives = 50/107 (46%), Gaps = 38/107 (35%)

Query: 4   EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPIS 63
           +  +E  G V+E LPNA FRV L                                     
Sbjct: 3   KNLIEMEGAVTESLPNAMFRVSLD------------------------------------ 26

Query: 64  YLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
             +   V+A+ +G++RK+ IR+  GD+VK+ ++PYD+++ RITYR +
Sbjct: 27  --NGCEVLAHVSGKIRKNFIRMLPGDRVKIELSPYDLSKGRITYRLR 71


>gi|71065964|ref|YP_264691.1| translation initiation factor IF-1 [Psychrobacter arcticus 273-4]
 gi|93006393|ref|YP_580830.1| translation initiation factor IF-1 [Psychrobacter cryohalolentis
           K5]
 gi|71038949|gb|AAZ19257.1| bacterial translation initiation factor 1 (bIF-1) [Psychrobacter
           arcticus 273-4]
 gi|92394071|gb|ABE75346.1| bacterial translation initiation factor 1 (bIF-1) [Psychrobacter
           cryohalolentis K5]
          Length = 77

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E +EF G V + LPN  F+V+L                                  
Sbjct: 5   MAKDEIIEFEGEVIDTLPNTLFKVRL---------------------------------- 30

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +G+MRKH IRI  GDKVKV M PYD+++ RITYR K
Sbjct: 31  ----ENGHEIIAHISGKMRKHYIRILTGDKVKVEMTPYDLSKGRITYRGK 76


>gi|326792583|ref|YP_004310404.1| translation initiation factor IF-1 [Clostridium lentocellum DSM
           5427]
 gi|326543347|gb|ADZ85206.1| Translation initiation factor IF-1 [Clostridium lentocellum DSM
           5427]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 48/110 (43%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E LPNA F+V++                                  
Sbjct: 1   MAKGDVIEVEGTVIEKLPNAMFKVEI---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                   +V+ + +G++R + IR+  GDKV + ++PYD+T+ RI +R K
Sbjct: 27  ----EGGHIVLGHISGKLRMNFIRVLPGDKVTIELSPYDLTKGRIIWRSK 72


>gi|296394895|ref|YP_003659779.1| translation initiation factor IF-1 [Segniliparus rotundus DSM
           44985]
 gi|296182042|gb|ADG98948.1| translation initiation factor IF-1 [Segniliparus rotundus DSM
           44985]
          Length = 73

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEVEGRVVEPLPNATFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|22095760|sp|Q8UHX4|IF1_AGRT5 RecName: Full=Translation initiation factor IF-1
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 58/110 (52%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF GIV+ELLPNA FRVKL                                  
Sbjct: 1   MTKEEVLEFPGIVTELLPNATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+TAGRMRK+RIR+  GDKV V M PYD+T+ RITYRFK
Sbjct: 27  ----ENEHEIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK 72


>gi|116617350|ref|YP_817721.1| translation initiation factor 1 [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|170017922|ref|YP_001728841.1| translation initiation factor IF-1 [Leuconostoc citreum KM20]
 gi|227431320|ref|ZP_03913373.1| initiation factor IF1 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|296111450|ref|YP_003621832.1| translational initiation [Leuconostoc kimchii IMSNU 11154]
 gi|300174010|ref|YP_003773176.1| translation initiation factor IF-1 [Leuconostoc gasicomitatum LMG
           18811]
 gi|326692216|ref|ZP_08229221.1| translation initiation factor IF-1 [Leuconostoc argentinum KCTC
           3773]
 gi|122272449|sp|Q03ZM4|IF1_LEUMM RecName: Full=Translation initiation factor IF-1
 gi|116096197|gb|ABJ61348.1| bacterial translation initiation factor 1 (bIF-1) [Leuconostoc
           mesenteroides subsp. mesenteroides ATCC 8293]
 gi|169804779|gb|ACA83397.1| Translation initiation factor IF-1 [Leuconostoc citreum KM20]
 gi|227352913|gb|EEJ43086.1| initiation factor IF1 [Leuconostoc mesenteroides subsp. cremoris
           ATCC 19254]
 gi|295832982|gb|ADG40863.1| translational initiation [Leuconostoc kimchii IMSNU 11154]
 gi|299888389|emb|CBL92357.1| Translation initiation factor IF-1 [Leuconostoc gasicomitatum LMG
           18811]
          Length = 71

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 39/110 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M   + +E  G V E LPNA F+V+L                                  
Sbjct: 1   MA-NDVIEIEGKVKETLPNAMFQVEL---------------------------------- 25

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + AV++A+ +G++RK+ IRI  GD+V V M+PYD+T+ RITYRF+
Sbjct: 26  ----ENGAVILAHVSGKIRKNFIRILPGDRVTVEMSPYDLTKGRITYRFR 71


>gi|324999247|ref|ZP_08120359.1| translation initiation factor IF-1 infA [Pseudonocardia sp. P1]
          Length = 73

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGAIEVEGRVVEPLPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 28  -----ENGHRVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 73


>gi|323700589|ref|ZP_08112501.1| translation initiation factor IF-1 [Desulfovibrio sp. ND132]
 gi|323460521|gb|EGB16386.1| translation initiation factor IF-1 [Desulfovibrio desulfuricans
           ND132]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 50/108 (46%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           MPKEE +   G V E LPNA FRV+L                                  
Sbjct: 1   MPKEEGIVVQGKVEEALPNAMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                +   V+A+ +G+MRK RIR+  GD V V ++PYD+TR RIT+R
Sbjct: 27  ----ENGHTVLAHISGKMRKFRIRVMPGDTVTVELSPYDLTRGRITFR 70


>gi|326388845|ref|ZP_08210427.1| translation initiation factor 1 [Novosphingobium nitrogenifigens
           DSM 19370]
 gi|326206445|gb|EGD57280.1| translation initiation factor 1 [Novosphingobium nitrogenifigens
           DSM 19370]
          Length = 81

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 41/109 (37%), Positives = 55/109 (50%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G V ELLPNA FRV+L                                  
Sbjct: 1   MAKEELLEMRGTVVELLPNAMFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                ++  ++ +TAG+MRK+RIR+ +GD+V V + PYD+T+ RITYRF
Sbjct: 27  ----ENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRF 71


>gi|256420681|ref|YP_003121334.1| translation initiation factor IF-1 [Chitinophaga pinensis DSM 2588]
 gi|256035589|gb|ACU59133.1| translation initiation factor IF-1 [Chitinophaga pinensis DSM 2588]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  GI+ E L NA FRVKL                                  
Sbjct: 1   MAKQALIKQDGIILEALSNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++A  +G+MR H IRI  GDKV V M+PYD++R RI +R+K
Sbjct: 27  ----ENGHEILATISGKMRMHYIRILPGDKVGVEMSPYDLSRGRIIFRYK 72


>gi|134301874|ref|YP_001121843.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|190359700|sp|A4IXS1|IF1_FRATW RecName: Full=Translation initiation factor IF-1
 gi|134049651|gb|ABO46722.1| translation initiation factor IF-1 [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G+V E+LPN  FRV+L                                  
Sbjct: 1   MAKEDCIEMEGVVLEVLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  +V A+ +G+MRK+ IRI  GDKV V + PYD+T+ RI +R K
Sbjct: 27  ----ENGRIVTAHISGKMRKNYIRILTGDKVVVEITPYDLTKGRIKFRSK 72


>gi|295792003|gb|ADG29012.1| translational initiation factor 1 [Lygodium japonicum]
          Length = 79

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ ++  G V+E LPNA FRV                                    
Sbjct: 1   MKKQDLIDMEGTVTESLPNAMFRV------------------------------------ 24

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+ + +GR+R++ IRI  GD+ +V ++PYD+T+ RITYR K
Sbjct: 25  --CSDNGCQVLTHISGRIRRNYIRIPPGDRARVELSPYDLTKGRITYRLK 72


>gi|268316430|ref|YP_003290149.1| translation initiation factor IF-1 [Rhodothermus marinus DSM 4252]
 gi|262333964|gb|ACY47761.1| translation initiation factor IF-1 [Rhodothermus marinus DSM 4252]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKQKPITQDGEVIEALPNAQFRVRLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   ++   +G+MR H I+I  GD+VKV ++PYD+T+ RI YR+K
Sbjct: 28  -----NGHEILGILSGKMRMHYIKILPGDRVKVELSPYDLTKGRIVYRYK 72


>gi|42527590|ref|NP_972688.1| translation initiation factor IF-1 [Treponema denticola ATCC 35405]
 gi|48428204|sp|P61696|IF1_TREDE RecName: Full=Translation initiation factor IF-1
 gi|41818418|gb|AAS12607.1| translation initiation factor IF-1 [Treponema denticola ATCC 35405]
 gi|325474451|gb|EGC77638.1| translation initiation factor IF-1 [Treponema denticola F0402]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE +E  GIV E LPN  FRV+L                                  
Sbjct: 1   MAKEEAIEVEGIVKESLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++A+ +G+MRKH I+I  GD VKVA++PYD+TR RI +R +
Sbjct: 27  ----KNGHVILAHLSGKMRKHYIKIVPGDTVKVALSPYDLTRGRIIFRER 72


>gi|260655360|ref|ZP_05860848.1| translation initiation factor IF-1 [Jonquetella anthropi E3_33 E1]
 gi|260629808|gb|EEX48002.1| translation initiation factor IF-1 [Jonquetella anthropi E3_33 E1]
          Length = 73

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K+  +E  G V+E LPNA FRVKL                                    
Sbjct: 4   KDGVIEVRGEVAEPLPNAMFRVKL------------------------------------ 27

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +N +++A+ +G+MR H IRI  GDKV V ++PYD+TR RI YR+K
Sbjct: 28  --ENNHLILAHVSGKMRMHFIRILPGDKVLVELSPYDLTRGRIIYRYK 73


>gi|257067038|ref|YP_003153294.1| translation initiation factor IF-1 [Anaerococcus prevotii DSM
           20548]
 gi|256798918|gb|ACV29573.1| translation initiation factor IF-1 [Anaerococcus prevotii DSM
           20548]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E +G+V+E LPNA F+V+L                                  
Sbjct: 1   MSKKDAIEVTGVVTEALPNAIFKVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GD+V V ++PYD+++ RIT+R K
Sbjct: 27  ----ENGHEIQAHISGKLRMNSIRILEGDRVTVELSPYDLSQGRITWRKK 72


>gi|103487400|ref|YP_616961.1| translation initiation factor IF-1 [Sphingopyxis alaskensis RB2256]
 gi|148557009|ref|YP_001264591.1| translation initiation factor IF-1 [Sphingomonas wittichii RW1]
 gi|119371120|sp|Q1GRU4|IF1_SPHAL RecName: Full=Translation initiation factor IF-1
 gi|190359707|sp|A5VDT7|IF1_SPHWW RecName: Full=Translation initiation factor IF-1
 gi|98977477|gb|ABF53628.1| bacterial translation initiation factor 1 (bIF-1) [Sphingopyxis
           alaskensis RB2256]
 gi|148502199|gb|ABQ70453.1| bacterial translation initiation factor 1 (bIF-1) [Sphingomonas
           wittichii RW1]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 56/110 (50%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LE  G V ELLPNA FRVKL                                  
Sbjct: 1   MAKEELLEMRGQVVELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  ++ +TAG+MRK+RIR+ +GD+V V + PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEILGHTAGKMRKNRIRVLVGDEVLVELTPYDLTKGRITYRFK 72


>gi|282857340|ref|ZP_06266577.1| translation initiation factor IF-1 [Pyramidobacter piscolens W5455]
 gi|282584840|gb|EFB90171.1| translation initiation factor IF-1 [Pyramidobacter piscolens W5455]
          Length = 73

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MP-KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M  K++ +E  G V E LPNA FRV+L                                 
Sbjct: 1   MANKDDVIEVHGEVEEPLPNAMFRVRL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                    V++A+ +G+MR H IRI  GDKV + ++PYD+TR RITYR+K
Sbjct: 28  -----ETGQVILAHVSGKMRMHFIRILPGDKVLLELSPYDLTRGRITYRYK 73


>gi|296445366|ref|ZP_06887324.1| translation initiation factor IF-1 [Methylosinus trichosporium
           OB3b]
 gi|296257127|gb|EFH04196.1| translation initiation factor IF-1 [Methylosinus trichosporium
           OB3b]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEF G+V ELLP+A FRVKL                                  
Sbjct: 1   MAKEELLEFPGVVVELLPSATFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAG+MRK+RIR+  GDKV VAM PYD+T+ RITYRFK
Sbjct: 27  ----ENDHEIIAHTAGKMRKNRIRVLTGDKVLVAMTPYDLTKGRITYRFK 72


>gi|119503237|ref|ZP_01625321.1| chromosome segregation and condensation protein ScpB [marine gamma
           proteobacterium HTCC2080]
 gi|119460883|gb|EAW41974.1| chromosome segregation and condensation protein ScpB [marine gamma
           proteobacterium HTCC2080]
          Length = 72

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 51/110 (46%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ +E  G + + LPN  FRV+L                                  
Sbjct: 1   MAKEDQIEMEGEIIDTLPNTTFRVRL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV+V + PYD+T+ RITYR +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVRVEVTPYDLTKGRITYRER 72


>gi|227501156|ref|ZP_03931205.1| initiation factor IF1 [Anaerococcus tetradius ATCC 35098]
 gi|227216741|gb|EEI82142.1| initiation factor IF1 [Anaerococcus tetradius ATCC 35098]
          Length = 89

 Score =  107 bits (267), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E +G+V E LPNA FRV+L                                  
Sbjct: 18  MSKKDAIEVTGVVVEALPNAIFRVEL---------------------------------- 43

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   + A+ +G++R + IRI  GDKV V ++PYD+++ RIT+R K
Sbjct: 44  ----ENGHQIQAHISGKLRMNSIRILEGDKVTVELSPYDLSQGRITWRKK 89


>gi|238757597|ref|ZP_04618781.1| Translation initiation factor IF-1 [Yersinia aldovae ATCC 35236]
 gi|238704102|gb|EEP96635.1| Translation initiation factor IF-1 [Yersinia aldovae ATCC 35236]
          Length = 72

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M +E+ +E  G V + LPN  FRV+L                                  
Sbjct: 1   MAREDDIEMQGTVLDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRK+ IRI  GDKV VA+ PYD+++ RI +R +
Sbjct: 27  ----ENGHVVTAHISGKMRKNYIRILTGDKVTVALTPYDLSKGRIIFRAR 72


>gi|150251508|ref|YP_001312241.1| translation initiation factor 1 [Cycas taitungensis]
 gi|190359594|sp|A6H5L6|IF1C_CYCTA RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|149941558|dbj|BAF64982.1| translation initiation factor 1 [Cycas taitungensis]
          Length = 82

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 30/110 (27%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  ++  G V+E LPN  FRV+L                                  
Sbjct: 1   MNKQNLIDVEGSVTESLPNGMFRVRLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V  + +G++R++ +RI  GD+VKV ++PYD+T+ RI YR +
Sbjct: 28  -----NGCQVPTHISGKIRRNHVRILPGDRVKVELSPYDLTKGRIIYRLR 72


>gi|50843288|ref|YP_056515.1| translation initiation factor IF-1 [Propionibacterium acnes
           KPA171202]
 gi|282855176|ref|ZP_06264508.1| translation initiation factor IF-1 [Propionibacterium acnes J139]
 gi|289424773|ref|ZP_06426555.1| translation initiation factor IF-1 [Propionibacterium acnes SK187]
 gi|289427611|ref|ZP_06429323.1| translation initiation factor IF-1 [Propionibacterium acnes J165]
 gi|295131358|ref|YP_003582021.1| translation initiation factor IF-1 [Propionibacterium acnes SK137]
 gi|59798020|sp|Q6A6Q6|IF1_PROAC RecName: Full=Translation initiation factor IF-1
 gi|50840890|gb|AAT83557.1| translation initiation factor IF-1 [Propionibacterium acnes
           KPA171202]
 gi|282581764|gb|EFB87149.1| translation initiation factor IF-1 [Propionibacterium acnes J139]
 gi|289154736|gb|EFD03419.1| translation initiation factor IF-1 [Propionibacterium acnes SK187]
 gi|289159102|gb|EFD07294.1| translation initiation factor IF-1 [Propionibacterium acnes J165]
 gi|291376280|gb|ADE00135.1| translation initiation factor IF-1 [Propionibacterium acnes SK137]
 gi|313763208|gb|EFS34572.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL013PA1]
 gi|313773123|gb|EFS39089.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL074PA1]
 gi|313793287|gb|EFS41345.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL110PA1]
 gi|313801069|gb|EFS42337.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL110PA2]
 gi|313808810|gb|EFS47264.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL087PA2]
 gi|313810396|gb|EFS48110.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL083PA1]
 gi|313812268|gb|EFS49982.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL025PA1]
 gi|313816545|gb|EFS54259.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL059PA1]
 gi|313817989|gb|EFS55703.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL046PA2]
 gi|313819903|gb|EFS57617.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL036PA1]
 gi|313823393|gb|EFS61107.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL036PA2]
 gi|313824865|gb|EFS62579.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL063PA1]
 gi|313828394|gb|EFS66108.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL063PA2]
 gi|313830106|gb|EFS67820.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL007PA1]
 gi|313832622|gb|EFS70336.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL056PA1]
 gi|313836054|gb|EFS73768.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL037PA2]
 gi|313837978|gb|EFS75692.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL086PA1]
 gi|314914361|gb|EFS78192.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL005PA4]
 gi|314917681|gb|EFS81512.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL050PA1]
 gi|314924152|gb|EFS87983.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL001PA1]
 gi|314925759|gb|EFS89590.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL036PA3]
 gi|314930178|gb|EFS94009.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL067PA1]
 gi|314957150|gb|EFT01254.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL027PA1]
 gi|314957791|gb|EFT01894.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL002PA1]
 gi|314960839|gb|EFT04940.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL002PA2]
 gi|314963513|gb|EFT07613.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL082PA1]
 gi|314964882|gb|EFT08981.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL082PA2]
 gi|314969904|gb|EFT14002.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL037PA1]
 gi|314970523|gb|EFT14621.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL037PA3]
 gi|314973045|gb|EFT17141.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL053PA1]
 gi|314975541|gb|EFT19636.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL045PA1]
 gi|314979770|gb|EFT23864.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL072PA2]
 gi|314982283|gb|EFT26376.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL110PA3]
 gi|314984825|gb|EFT28917.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL005PA1]
 gi|314986083|gb|EFT30175.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL005PA2]
 gi|314988698|gb|EFT32789.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL005PA3]
 gi|315077134|gb|EFT49201.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL053PA2]
 gi|315079821|gb|EFT51797.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL078PA1]
 gi|315083188|gb|EFT55164.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL027PA2]
 gi|315086858|gb|EFT58834.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL002PA3]
 gi|315089950|gb|EFT61926.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL072PA1]
 gi|315090470|gb|EFT62446.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL110PA4]
 gi|315096728|gb|EFT68704.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL038PA1]
 gi|315097956|gb|EFT69932.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL059PA2]
 gi|315100599|gb|EFT72575.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL046PA1]
 gi|315103997|gb|EFT75973.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL050PA2]
 gi|315106042|gb|EFT78018.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL030PA1]
 gi|315109202|gb|EFT81178.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL030PA2]
 gi|327325142|gb|EGE66948.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL096PA3]
 gi|327325229|gb|EGE67034.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL096PA2]
 gi|327325524|gb|EGE67323.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL103PA1]
 gi|327332738|gb|EGE74472.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL097PA1]
 gi|327444029|gb|EGE90683.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL043PA1]
 gi|327449343|gb|EGE95997.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL013PA2]
 gi|327449429|gb|EGE96083.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL043PA2]
 gi|327451450|gb|EGE98104.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL087PA3]
 gi|327451574|gb|EGE98228.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL092PA1]
 gi|327451861|gb|EGE98515.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL083PA2]
 gi|328752075|gb|EGF65691.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL087PA1]
 gi|328755528|gb|EGF69144.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL025PA2]
 gi|328756312|gb|EGF69928.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL020PA1]
 gi|328761354|gb|EGF74881.1| translation initiation factor IF-1 [Propionibacterium acnes
           HL099PA1]
 gi|332676228|gb|AEE73044.1| translation initiation factor IF-1 [Propionibacterium acnes 266]
          Length = 73

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 48/111 (43%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  LE  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKEGALELEGTVVEALPNAMFRVEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A  +G+MR+H IRI   D+V V ++PYD+TR RI YR K
Sbjct: 28  -----KNGHRVLATISGKMRQHYIRILPSDRVVVELSPYDLTRGRIVYRHK 73


>gi|154148215|ref|YP_001405816.1| translation initiation factor IF-1 [Campylobacter hominis ATCC
           BAA-381]
 gi|190359584|sp|A7HZX5|IF1_CAMHC RecName: Full=Translation initiation factor IF-1
 gi|153804224|gb|ABS51231.1| translation initiation factor IF-1 [Campylobacter hominis ATCC
           BAA-381]
          Length = 72

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V+L                                  
Sbjct: 1   MSKDDVIEIDGNVIEALPNATFKVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  V++ + AG+MR H I+I  GD+VKV + PY + + RITYR+K
Sbjct: 28  -----NKHVILCHIAGKMRMHYIKIMPGDRVKVELTPYSLDKGRITYRYK 72


>gi|296775683|gb|ADH42960.1| hypothetical protein [uncultured SAR11 cluster alpha
           proteobacterium H17925_23J24]
          Length = 71

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 57/109 (52%), Gaps = 38/109 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+E +EF G V+ELLPNA FRVKL                                  
Sbjct: 1   MVKQEKIEFKGKVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRF 109
                +N  V+A+TAG++RK+RIR+  GD+V V M PYD+TR RIT+RF
Sbjct: 27  ----ENNHEVLAHTAGKLRKNRIRVLAGDQVLVEMTPYDLTRGRITFRF 71


>gi|49474630|ref|YP_032672.1| translation initiation factor IF-1 [Bartonella quintana str.
           Toulouse]
 gi|240851128|ref|YP_002972530.1| translation initiation factor IF-1 [Bartonella grahamii as4aup]
 gi|59797552|sp|Q6FYU2|IF1_BARQU RecName: Full=Translation initiation factor IF-1
 gi|49240134|emb|CAF26581.1| Translation initiation factor if-1 [Bartonella quintana str.
           Toulouse]
 gi|240268251|gb|ACS51839.1| translation initiation factor IF-1 [Bartonella grahamii as4aup]
 gi|319409268|emb|CBI82912.1| translation initiation factor IF-1 [Bartonella schoenbuchensis R1]
          Length = 72

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 60/110 (54%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEFSGIV+ELLPNA FRVKL                                  
Sbjct: 1   MSKEEVLEFSGIVTELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDK+ V M PYD+T+ RITYR+K
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDKIMVEMTPYDLTKGRITYRYK 72


>gi|225020480|ref|ZP_03709672.1| hypothetical protein CORMATOL_00487 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305680139|ref|ZP_07402949.1| translation initiation factor IF-1 [Corynebacterium matruchotii
           ATCC 14266]
 gi|224946869|gb|EEG28078.1| hypothetical protein CORMATOL_00487 [Corynebacterium matruchotii
           ATCC 33806]
 gi|305660759|gb|EFM50256.1| translation initiation factor IF-1 [Corynebacterium matruchotii
           ATCC 14266]
          Length = 73

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKEGAIEVEGRIVEPLPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|167755935|ref|ZP_02428062.1| hypothetical protein CLORAM_01455 [Clostridium ramosum DSM 1402]
 gi|169350818|ref|ZP_02867756.1| hypothetical protein CLOSPI_01592 [Clostridium spiroforme DSM 1552]
 gi|237733251|ref|ZP_04563732.1| translation initiation factor IF-I [Mollicutes bacterium D7]
 gi|167703927|gb|EDS18506.1| hypothetical protein CLORAM_01455 [Clostridium ramosum DSM 1402]
 gi|169292404|gb|EDS74537.1| hypothetical protein CLOSPI_01592 [Clostridium spiroforme DSM 1552]
 gi|229383632|gb|EEO33723.1| translation initiation factor IF-I [Coprobacillus sp. D7]
          Length = 73

 Score =  107 bits (266), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 34/111 (30%), Positives = 49/111 (44%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K ++ LE    V E LPNA F+V L                                 
Sbjct: 1   MAKKDDVLEVEATVLETLPNAMFKVAL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   ++A+ +G++R H IRI  GD+V V ++PYD+TR RIT+R K
Sbjct: 28  -----ENGVEILAHVSGKIRMHYIRILPGDRVTVEISPYDLTRGRITFRHK 73


>gi|121602253|ref|YP_988547.1| translation initiation factor IF-1 [Bartonella bacilliformis KC583]
 gi|190359572|sp|A1URE4|IF1_BARBK RecName: Full=Translation initiation factor IF-1
 gi|120614430|gb|ABM45031.1| translation initiation factor IF-1 [Bartonella bacilliformis KC583]
          Length = 72

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 59/110 (53%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KEE LEFSG+V ELLPNA FRVKL                                  
Sbjct: 1   MSKEEVLEFSGVVIELLPNAMFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++  +IA+TAGRMRK+RIR+  GDK+ V M PYD+T+ RITYR+K
Sbjct: 27  ----ENDHEIIAHTAGRMRKNRIRVLAGDKIMVEMTPYDLTKGRITYRYK 72


>gi|124112055|ref|YP_001019084.1| translational initiation factor 1 [Chlorokybus atmophyticus]
 gi|190359603|sp|Q19VB4|IF1C_CHLAT RecName: Full=Translation initiation factor IF-1, chloroplastic
 gi|124012171|gb|ABD62187.2| translational initiation factor 1 [Chlorokybus atmophyticus]
          Length = 74

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 52/110 (47%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K+  +E  G+++E LPNA FRV L                                  
Sbjct: 1   MEKQNIIEMEGVITESLPNAMFRVHLD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   V+A+ +G++R++ IRI  GD+VK+ M PYD+T+ RITYR +
Sbjct: 28  -----NGFDVLAHISGKIRRNYIRILPGDRVKIEMTPYDLTKGRITYRLR 72


>gi|300932970|ref|ZP_07148226.1| translation initiation factor IF-1 [Corynebacterium resistens DSM
           45100]
          Length = 73

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  +E  G + E LPNA FRV+L                                 
Sbjct: 1   MAKKEGAIEVEGRIIEPLPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|241895166|ref|ZP_04782462.1| initiation factor IF1 [Weissella paramesenteroides ATCC 33313]
 gi|241871472|gb|EER75223.1| initiation factor IF1 [Weissella paramesenteroides ATCC 33313]
          Length = 71

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 39/110 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M   + +E SG+V E LPNA F V+L                                  
Sbjct: 1   MA-SDVIEISGVVKETLPNAMFTVEL---------------------------------- 25

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                + A ++A+ +G++RK+ IRI  GD+V V M+PYD+T+ RITYRFK
Sbjct: 26  ----ENGADILAHVSGKIRKNFIRILPGDRVTVEMSPYDLTKGRITYRFK 71


>gi|28493499|ref|NP_787660.1| translation initiation factor IF-1 [Tropheryma whipplei str. Twist]
 gi|28572388|ref|NP_789168.1| translation initiation factor IF-1 [Tropheryma whipplei TW08/27]
 gi|44888015|sp|Q83G07|IF1_TROWT RecName: Full=Translation initiation factor IF-1
 gi|44888016|sp|Q83I58|IF1_TROW8 RecName: Full=Translation initiation factor IF-1
 gi|28410519|emb|CAD66905.1| translation initiation factor IF-1 [Tropheryma whipplei TW08/27]
 gi|28476541|gb|AAO44629.1| translation initiation factor IF-1 [Tropheryma whipplei str. Twist]
          Length = 73

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/111 (32%), Positives = 50/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKDGVIELEGSVLEALPNATFRVELS-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +GRMR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 29  ------NGHKVLAHISGRMRQHYIRILPEDRVVVELSPYDLARGRIVYRYK 73


>gi|145225550|ref|YP_001136228.1| translation initiation factor IF-1 [Mycobacterium gilvum PYR-GCK]
 gi|296141068|ref|YP_003648311.1| translation initiation factor IF-1 [Tsukamurella paurometabola DSM
           20162]
 gi|315445903|ref|YP_004078782.1| bacterial translation initiation factor 1 (bIF-1) [Mycobacterium
           sp. Spyr1]
 gi|319948699|ref|ZP_08022820.1| translation initiation factor IF-1 infA [Dietzia cinnamea P4]
 gi|190359653|sp|A4TEI3|IF1_MYCGI RecName: Full=Translation initiation factor IF-1
 gi|145218036|gb|ABP47440.1| bacterial translation initiation factor 1 (bIF-1) [Mycobacterium
           gilvum PYR-GCK]
 gi|296029202|gb|ADG79972.1| translation initiation factor IF-1 [Tsukamurella paurometabola DSM
           20162]
 gi|315264206|gb|ADU00948.1| bacterial translation initiation factor 1 (bIF-1) [Mycobacterium
           sp. Spyr1]
 gi|319437601|gb|EFV92600.1| translation initiation factor IF-1 infA [Dietzia cinnamea P4]
          Length = 73

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 1   MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 27

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 28  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|225076416|ref|ZP_03719615.1| hypothetical protein NEIFLAOT_01461 [Neisseria flavescens
           NRL30031/H210]
 gi|241759609|ref|ZP_04757710.1| translation initiation factor IF-1 [Neisseria flavescens SK114]
 gi|261364876|ref|ZP_05977759.1| translation initiation factor IF-1 [Neisseria mucosa ATCC 25996]
 gi|261380580|ref|ZP_05985153.1| translation initiation factor IF-1 [Neisseria subflava NJ9703]
 gi|298370570|ref|ZP_06981885.1| translation initiation factor IF-1 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|319639570|ref|ZP_07994317.1| translation initiation factor IF-1 [Neisseria mucosa C102]
 gi|224952264|gb|EEG33473.1| hypothetical protein NEIFLAOT_01461 [Neisseria flavescens
           NRL30031/H210]
 gi|241319981|gb|EER56362.1| translation initiation factor IF-1 [Neisseria flavescens SK114]
 gi|284796548|gb|EFC51895.1| translation initiation factor IF-1 [Neisseria subflava NJ9703]
 gi|288566924|gb|EFC88484.1| translation initiation factor IF-1 [Neisseria mucosa ATCC 25996]
 gi|298281180|gb|EFI22670.1| translation initiation factor IF-1 [Neisseria sp. oral taxon 014
           str. F0314]
 gi|317399141|gb|EFV79815.1| translation initiation factor IF-1 [Neisseria mucosa C102]
          Length = 72

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+T++  G + E LPNA F+VKL                                  
Sbjct: 1   MAKEDTIQMQGEILETLPNATFKVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ VV+ + +G+MR H IRIS GDKV V + PYD+TRARI +R +
Sbjct: 27  ----ENDHVVLGHISGKMRMHYIRISPGDKVTVELTPYDLTRARIVFRAR 72


>gi|227876171|ref|ZP_03994287.1| initiation factor IF1 [Mobiluncus mulieris ATCC 35243]
 gi|269976922|ref|ZP_06183896.1| translation initiation factor IF-1 [Mobiluncus mulieris 28-1]
 gi|306819446|ref|ZP_07453153.1| translation initiation factor IF-1 [Mobiluncus mulieris ATCC 35239]
 gi|307701697|ref|ZP_07638713.1| translation initiation factor IF-1 [Mobiluncus mulieris FB024-16]
 gi|227843132|gb|EEJ53325.1| initiation factor IF1 [Mobiluncus mulieris ATCC 35243]
 gi|269934753|gb|EEZ91313.1| translation initiation factor IF-1 [Mobiluncus mulieris 28-1]
 gi|304647738|gb|EFM45056.1| translation initiation factor IF-1 [Mobiluncus mulieris ATCC 35239]
 gi|307613200|gb|EFN92453.1| translation initiation factor IF-1 [Mobiluncus mulieris FB024-16]
          Length = 73

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 49/108 (45%), Gaps = 38/108 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           K+  +E  G V E LPNA FRV+L                                    
Sbjct: 4   KDGVIEVEGTVVEALPNAMFRVQLA----------------------------------- 28

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
              +  +V+A+ +G+MR+H IRI   D+V V ++PYD+ R RI YR+K
Sbjct: 29  ---NEHLVLAHISGKMRQHYIRILPEDRVVVELSPYDLDRGRIVYRYK 73


>gi|196230219|ref|ZP_03129082.1| translation initiation factor IF-1 [Chthoniobacter flavus Ellin428]
 gi|196225816|gb|EDY20323.1| translation initiation factor IF-1 [Chthoniobacter flavus Ellin428]
          Length = 72

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 38/108 (35%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+ ++  G+V+++LP   FRV+L                                  
Sbjct: 1   MAKEDAIKTEGVVTDVLPGTMFRVQLP--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                + A+V+A+ +G+MRKH IRI  GDKV+V ++PYD+ +ARI +R
Sbjct: 28  -----NGALVLAHISGKMRKHFIRIVPGDKVEVELSPYDLGKARIIFR 70


>gi|157737024|ref|YP_001489707.1| translation initiation factor IF-1 [Arcobacter butzleri RM4018]
 gi|315636216|ref|ZP_07891470.1| translation initiation factor IF-1 [Arcobacter butzleri JV22]
 gi|190359564|sp|A8ESW4|IF1_ARCB4 RecName: Full=Translation initiation factor IF-1
 gi|157698878|gb|ABV67038.1| translation initiation factor IF-1 [Arcobacter butzleri RM4018]
 gi|315479577|gb|EFU70256.1| translation initiation factor IF-1 [Arcobacter butzleri JV22]
          Length = 72

 Score =  107 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 47/110 (42%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +   G V E LPNA FRV+L                                  
Sbjct: 1   MAKDDVIVVDGKVIEALPNAMFRVELD--------------------------------- 27

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV+ + +G+MR H I+I   D VKV + PY + + RIT+R+K
Sbjct: 28  -----NGHVVLCHISGKMRMHYIKILPNDTVKVEITPYSLDKGRITHRYK 72


>gi|268680566|ref|YP_003304997.1| translation initiation factor IF-1 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268618597|gb|ACZ12962.1| translation initiation factor IF-1 [Sulfurospirillum deleyianum DSM
           6946]
          Length = 72

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K++ +E  G V E LPNA F+V++                                  
Sbjct: 1   MAKDDVIEIDGKVIEALPNATFKVEV---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                ++ V++ + AG+MR H I+I  GD VKV + PY + + RITYR+K
Sbjct: 27  ----QNSHVILCHIAGKMRMHYIKIMPGDTVKVELTPYSLDKGRITYRYK 72


>gi|188991661|ref|YP_001903671.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           campestris str. B100]
 gi|190359724|sp|B0RT36|IF1_XANCB RecName: Full=Translation initiation factor IF-1
 gi|167733421|emb|CAP51622.1| translation initiation factor IF-1 [Xanthomonas campestris pv.
           campestris]
          Length = 72

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 53/110 (48%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M  ++++EF G VSE LPN  FRVKL                                  
Sbjct: 1   MSNDDSIEFEGSVSETLPNTTFRVKL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +   +IA+ +GRMRK+ IRI  GD+VKV M PYD+T+ RITYR K
Sbjct: 27  ----ENGYEIIAHISGRMRKNYIRILTGDRVKVEMTPYDLTKGRITYRMK 72


>gi|121998181|ref|YP_001002968.1| translation initiation factor IF-1 [Halorhodospira halophila SL1]
 gi|190359703|sp|A1WWV4|IF1_HALHL RecName: Full=Translation initiation factor IF-1
 gi|121589586|gb|ABM62166.1| bacterial translation initiation factor 1 (bIF-1) [Halorhodospira
           halophila SL1]
          Length = 72

 Score =  107 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 49/110 (44%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M KE+++   G++ + LPN  FRV+L                                  
Sbjct: 1   MAKEDSIRMQGVIVDTLPNTMFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +  VV A+ +G+MRKH IRI  GDKV V + PYD+ + RI YR +
Sbjct: 27  ----ENGHVVTAHISGKMRKHYIRILTGDKVTVELTPYDLNKGRIVYRER 72


>gi|159039810|ref|YP_001539063.1| translation initiation factor IF-1 [Salinispora arenicola CNS-205]
 gi|238061098|ref|ZP_04605807.1| translation initiation factor IF-1 [Micromonospora sp. ATCC 39149]
 gi|302869947|ref|YP_003838584.1| translation initiation factor IF-1 [Micromonospora aurantiaca ATCC
           27029]
 gi|315501408|ref|YP_004080295.1| translation initiation factor if-1 [Micromonospora sp. L5]
 gi|330470149|ref|YP_004407892.1| translation initiation factor IF-1 [Verrucosispora maris AB-18-032]
 gi|190359686|sp|A8M505|IF1_SALAI RecName: Full=Translation initiation factor IF-1
 gi|157918645|gb|ABW00073.1| translation initiation factor IF-1 [Salinispora arenicola CNS-205]
 gi|237882909|gb|EEP71737.1| translation initiation factor IF-1 [Micromonospora sp. ATCC 39149]
 gi|302572806|gb|ADL49008.1| translation initiation factor IF-1 [Micromonospora aurantiaca ATCC
           27029]
 gi|315408027|gb|ADU06144.1| translation initiation factor IF-1 [Micromonospora sp. L5]
 gi|328813120|gb|AEB47292.1| translation initiation factor IF-1 [Verrucosispora maris AB-18-032]
          Length = 73

 Score =  106 bits (265), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 52/111 (46%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           MPK++  +E  G V E LPNA FRV+L                                 
Sbjct: 1   MPKKDGAIEIEGRVIEPLPNAMFRVELA-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD+TR RI YR+K
Sbjct: 29  ------NGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLTRGRIVYRYK 73


>gi|297625813|ref|YP_003687576.1| Translation initiation factor IF-1 [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
 gi|296921578|emb|CBL56132.1| Translation initiation factor IF-1 [Propionibacterium
           freudenreichii subsp. shermanii CIRM-BIA1]
          Length = 73

 Score =  106 bits (265), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 37/111 (33%), Positives = 48/111 (43%), Gaps = 39/111 (35%)

Query: 1   MPK-EETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K E  LE  G V E LPNA FRV+L                                 
Sbjct: 1   MAKKEGALELEGTVVEALPNAMFRVELD-------------------------------- 28

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V++  +G+MR+H IRI   D+V V ++PYD+TR RI YR K
Sbjct: 29  ------NGHKVLSTISGKMRQHYIRILPQDRVVVELSPYDLTRGRIVYRHK 73


>gi|15676090|ref|NP_273221.1| translation initiation factor IF-1 [Neisseria meningitidis MC58]
 gi|59802139|ref|YP_208851.1| translation initiation factor IF-1 [Neisseria gonorrhoeae FA 1090]
 gi|121634037|ref|YP_974282.1| translation initiation factor IF-1 [Neisseria meningitidis FAM18]
 gi|161871026|ref|YP_001600074.1| translation initiation factor IF-1 [Neisseria meningitidis 053442]
 gi|218767147|ref|YP_002341659.1| translation initiation factor IF-1 [Neisseria meningitidis Z2491]
 gi|239997947|ref|ZP_04717871.1| translation initiation factor IF-1 [Neisseria gonorrhoeae 35/02]
 gi|240015075|ref|ZP_04721988.1| translation initiation factor IF-1 [Neisseria gonorrhoeae DGI18]
 gi|240017524|ref|ZP_04724064.1| translation initiation factor IF-1 [Neisseria gonorrhoeae FA6140]
 gi|240081667|ref|ZP_04726210.1| translation initiation factor IF-1 [Neisseria gonorrhoeae FA19]
 gi|240113945|ref|ZP_04728435.1| translation initiation factor IF-1 [Neisseria gonorrhoeae MS11]
 gi|240116679|ref|ZP_04730741.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID18]
 gi|240118901|ref|ZP_04732963.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID1]
 gi|240122147|ref|ZP_04735109.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID24-1]
 gi|240124439|ref|ZP_04737395.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID332]
 gi|240124692|ref|ZP_04737578.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-92-679]
 gi|240129115|ref|ZP_04741776.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-93-1035]
 gi|254494700|ref|ZP_05107871.1| translation initiation factor IF-1 [Neisseria gonorrhoeae 1291]
 gi|254805793|ref|YP_003084014.1| translation initiation factor IF-1 [Neisseria meningitidis alpha14]
 gi|255067437|ref|ZP_05319292.1| translation initiation factor IF-1 [Neisseria sicca ATCC 29256]
 gi|260439562|ref|ZP_05793378.1| translation initiation factor IF-1 [Neisseria gonorrhoeae DGI2]
 gi|261378062|ref|ZP_05982635.1| translation initiation factor IF-1 [Neisseria cinerea ATCC 14685]
 gi|268593797|ref|ZP_06127964.1| translation initiation factor IF-1 [Neisseria gonorrhoeae 35/02]
 gi|268597764|ref|ZP_06131931.1| translation initiation factor IF-1 [Neisseria gonorrhoeae FA19]
 gi|268600009|ref|ZP_06134176.1| translation initiation factor IF-1 [Neisseria gonorrhoeae MS11]
 gi|268602347|ref|ZP_06136514.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID18]
 gi|268604610|ref|ZP_06138777.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID1]
 gi|268683068|ref|ZP_06149930.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID332]
 gi|268683266|ref|ZP_06150128.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-92-679]
 gi|268687498|ref|ZP_06154360.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-93-1035]
 gi|291042798|ref|ZP_06568539.1| translation initiation factor IF-1 [Neisseria gonorrhoeae DGI2]
 gi|293398181|ref|ZP_06642386.1| translation initiation factor IF-1 [Neisseria gonorrhoeae F62]
 gi|296313386|ref|ZP_06863327.1| translation initiation factor IF-1 [Neisseria polysaccharea ATCC
           43768]
 gi|304388964|ref|ZP_07371011.1| translation initiation factor IF-1 [Neisseria meningitidis ATCC
           13091]
 gi|54037366|sp|P65113|IF1_NEIMB RecName: Full=Translation initiation factor IF-1
 gi|54041099|sp|P65112|IF1_NEIMA RecName: Full=Translation initiation factor IF-1
 gi|73920044|sp|Q5F5U8|IF1_NEIG1 RecName: Full=Translation initiation factor IF-1
 gi|190359658|sp|A9M3U5|IF1_NEIM0 RecName: Full=Translation initiation factor IF-1
 gi|190359659|sp|A1KRJ4|IF1_NEIMF RecName: Full=Translation initiation factor IF-1
 gi|7225381|gb|AAF40621.1| translation initiation factor IF-1 [Neisseria meningitidis MC58]
 gi|59719034|gb|AAW90439.1| putative translation initiation factor IF-1 [Neisseria gonorrhoeae
           FA 1090]
 gi|120865743|emb|CAM09472.1| translation initiation factor IF-1 [Neisseria meningitidis FAM18]
 gi|121051155|emb|CAM07426.1| translation initiation factor IF-1 [Neisseria meningitidis Z2491]
 gi|161596579|gb|ABX74239.1| translation initiation factor IF-1 [Neisseria meningitidis 053442]
 gi|226513740|gb|EEH63085.1| translation initiation factor IF-1 [Neisseria gonorrhoeae 1291]
 gi|254669335|emb|CBA08384.1| translation initiation factor IF-1 [Neisseria meningitidis alpha14]
 gi|255048232|gb|EET43696.1| translation initiation factor IF-1 [Neisseria sicca ATCC 29256]
 gi|261391699|emb|CAX49148.1| translation initiation factor IF-1 [Neisseria meningitidis 8013]
 gi|268547186|gb|EEZ42604.1| translation initiation factor IF-1 [Neisseria gonorrhoeae 35/02]
 gi|268551552|gb|EEZ46571.1| translation initiation factor IF-1 [Neisseria gonorrhoeae FA19]
 gi|268584140|gb|EEZ48816.1| translation initiation factor IF-1 [Neisseria gonorrhoeae MS11]
 gi|268586478|gb|EEZ51154.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID18]
 gi|268588741|gb|EEZ53417.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID1]
 gi|268623352|gb|EEZ55752.1| translation initiation factor IF-1 [Neisseria gonorrhoeae PID332]
 gi|268623550|gb|EEZ55950.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-92-679]
 gi|268627782|gb|EEZ60182.1| translation initiation factor IF-1 [Neisseria gonorrhoeae
           SK-93-1035]
 gi|269145512|gb|EEZ71930.1| translation initiation factor IF-1 [Neisseria cinerea ATCC 14685]
 gi|291013232|gb|EFE05198.1| translation initiation factor IF-1 [Neisseria gonorrhoeae DGI2]
 gi|291611444|gb|EFF40514.1| translation initiation factor IF-1 [Neisseria gonorrhoeae F62]
 gi|296840096|gb|EFH24034.1| translation initiation factor IF-1 [Neisseria polysaccharea ATCC
           43768]
 gi|304337098|gb|EFM03285.1| translation initiation factor IF-1 [Neisseria meningitidis ATCC
           13091]
 gi|308388379|gb|ADO30699.1| translation initiation factor IF-1 [Neisseria meningitidis
           alpha710]
 gi|319411353|emb|CBY91764.1| translation initiation factor IF-1 [Neisseria meningitidis WUE
           2594]
 gi|325131053|gb|EGC53777.1| translation initiation factor IF-1 [Neisseria meningitidis
           OX99.30304]
 gi|325133075|gb|EGC55747.1| translation initiation factor IF-1 [Neisseria meningitidis M6190]
 gi|325135169|gb|EGC57795.1| translation initiation factor IF-1 [Neisseria meningitidis M13399]
 gi|325137221|gb|EGC59816.1| translation initiation factor IF-1 [Neisseria meningitidis M0579]
 gi|325139053|gb|EGC61599.1| translation initiation factor IF-1 [Neisseria meningitidis ES14902]
 gi|325141176|gb|EGC63676.1| translation initiation factor IF