RPSBLAST alignment for GI: 254780470 and conserved domain: COG0361

>gnl|CDD|30710 COG0361, InfA, Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]. Length = 75
 Score = 72.5 bits (178), Expect = 2e-14
 Identities = 35/110 (31%), Positives = 50/110 (45%), Gaps = 38/110 (34%)

Query: 1   MPKEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVD 60
           M K + +E  G V E+LPN  FRV+L                                  
Sbjct: 1   MAKPDEIEMEGTVIEMLPNGRFRVEL---------------------------------- 26

Query: 61  PISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                +    +A+ +G+MRK+RIRI  GD V V ++PYD+T+ RI YR+K
Sbjct: 27  ----ENGHERLAHISGKMRKNRIRILPGDVVLVELSPYDLTKGRIVYRYK 72