RPSBLAST alignment of GI: 254780470 and protein with PDBid: 1hr0

>1hr0_W Translation initiation factor; ribosomal subunit, ribosome, IF1; 3.20A {Escherichia coli} SCOP: b.40.4.5 PDB: 1zo1_W Length = 71
 Score = 79.7 bits (197), Expect = 2e-16
 Identities = 35/106 (33%), Positives = 47/106 (44%), Gaps = 38/106 (35%)

Query: 3   KEETLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGVDPI 62
           +++T+   G+V+E LPNA FRVKL                                    
Sbjct: 3   EKDTIRTEGVVTEALPNATFRVKL------------------------------------ 26

Query: 63  SYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYR 108
                  ++AY +G+MR H IRI  GD+V V + PYD TR RI YR
Sbjct: 27  --DSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR 70