RPSBLAST alignment of GI: 254780470 and protein with PDBid: 3i4o

>3i4o_A Translation initiation factor IF-1; cytoplasm, protein biosynthesis; 1.47A {Mycobacterium tuberculosis} Length = 79
 Score = 85.1 bits (211), Expect = 3e-18
 Identities = 34/111 (30%), Positives = 51/111 (45%), Gaps = 39/111 (35%)

Query: 1   MPKEE-TLEFSGIVSELLPNANFRVKLITNDDDSSADCKLDSKVKSNFSESGSESGNDGV 59
           M K++  +E  G V E LPNA FR++L                                 
Sbjct: 7   MAKKDGAIEVEGRVVEPLPNAMFRIEL--------------------------------- 33

Query: 60  DPISYLDNAVVIAYTAGRMRKHRIRISLGDKVKVAMNPYDMTRARITYRFK 110
                 +   V+A+ +G+MR+H IRI   D+V V ++PYD++R RI YR+K
Sbjct: 34  -----ENGHKVLAHISGKMRQHYIRILPEDRVVVELSPYDLSRGRIVYRYK 79