BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase
subunit IV [Candidatus Liberibacter asiaticus str. psy62]
         (119 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040148|gb|ACT56944.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 119

 Score =  239 bits (610), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ
Sbjct: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
Sbjct: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119


>gi|315122073|ref|YP_004062562.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495475|gb|ADR52074.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 119

 Score =  171 bits (432), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/118 (72%), Positives = 101/118 (85%), Gaps = 2/118 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQII 62
           D  HN   HS+GT+++ L+GFILSLILT IPFG+VM+G  FLDKN+  L IVLCAIAQII
Sbjct: 2   DYNHNKRTHSHGTRRESLIGFILSLILTSIPFGMVMQGSSFLDKNMTYLVIVLCAIAQII 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM-EGMRSIH 119
           VHLV+FLHM+ KVEDGW++MAM+FTII++AICFVGSMWVMYHLN NMM M E MRSIH
Sbjct: 62  VHLVYFLHMNVKVEDGWNVMAMVFTIIIIAICFVGSMWVMYHLNYNMMPMDESMRSIH 119


>gi|158423725|ref|YP_001525017.1| cytochrome o ubiquinol oxidase subunit IV [Azorhizobium caulinodans
           ORS 571]
 gi|158330614|dbj|BAF88099.1| cytochrome o ubiquinol oxidase subunit IV [Azorhizobium caulinodans
           ORS 571]
          Length = 132

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 74/105 (70%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H +G+ K  + GFILS+ILT IPF +VM     +  +  + I+  A+ QI+VH+++FLHM
Sbjct: 25  HGHGSFKSYMTGFILSVILTAIPFWLVMTNALGNNQLTAIVIMAFAVVQIVVHMIYFLHM 84

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           + KVE GWS++A+IFT+I+V I   GS+WVMYHLN NMM    MR
Sbjct: 85  TGKVEGGWSMLALIFTVIVVVIALSGSLWVMYHLNANMMPSHDMR 129


>gi|33593692|ref|NP_881336.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis
           Tohama I]
 gi|33595767|ref|NP_883410.1| cytochrome ubiquinol oxidase subunit IV [Bordetella parapertussis
           12822]
 gi|33600293|ref|NP_887853.1| cytochrome ubiquinol oxidase subunit IV [Bordetella bronchiseptica
           RB50]
 gi|33563765|emb|CAE43005.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis
           Tohama I]
 gi|33565846|emb|CAE36392.1| cytochrome ubiquinol oxidase subunit IV [Bordetella parapertussis]
 gi|33567892|emb|CAE31805.1| cytochrome ubiquinol oxidase subunit IV [Bordetella bronchiseptica
           RB50]
 gi|332383096|gb|AEE67943.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis CS]
          Length = 135

 Score =  113 bits (282), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 71/107 (66%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H  +   +GT    L GF+L+ ILT IPF +VM G F       L I+  A+ QI+VHLV
Sbjct: 21  HEDDDGPHGTLASYLTGFVLAAILTAIPFWLVMDGVFASSRTTALVILAFAVVQIVVHLV 80

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +FLHM  K E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M 
Sbjct: 81  YFLHMDAKSESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMS 127


>gi|241667024|ref|YP_002985108.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862481|gb|ACS60146.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 133

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT +  + GF+LS+ILT IPF +VM G F    +  + ++     QI+VH+VFFLHM+T
Sbjct: 26  HGTFRSYMTGFVLSIILTAIPFWLVMSGVFESPAVTAVLVMGLGAIQIVVHMVFFLHMNT 85

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           + E GW+IMA+IFT+I+VAI   GS+WVM+HLN NMM M 
Sbjct: 86  RSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNTNMMPMS 125


>gi|146338788|ref|YP_001203836.1| cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobium sp.
           ORS278]
 gi|146191594|emb|CAL75599.1| cytochrome o ubiquinol oxidase, subunit IV (Ubiquinol oxidase chain
           D) [Bradyrhizobium sp. ORS278]
          Length = 123

 Score =  112 bits (280), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           GT++  L+GF LS++LT IPF +VM G  LDK +  L I+  A  Q++VH++FFLHM+TK
Sbjct: 20  GTRQGQLIGFGLSVVLTAIPFLLVMNGS-LDKQVSALIIMAFAAVQVVVHMIFFLHMNTK 78

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            E GW++MA+IFTIIMV I   GS+WVM+HL  NMM +  M S
Sbjct: 79  AEGGWTMMALIFTIIMVVIALSGSLWVMHHLTTNMMPVHEMGS 121


>gi|27375263|ref|NP_766792.1| cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobium japonicum
           USDA 110]
 gi|27348399|dbj|BAC45417.1| cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobium japonicum
           USDA 110]
          Length = 126

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 74/99 (74%), Gaps = 3/99 (3%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LS++LT IPF +VM G    K I  L I+  A+ QI+VH+++FLHM+TK E+GWS
Sbjct: 28  MLGFVLSVVLTAIPFWLVMSGTLPSKQITALVIMAFAVVQIVVHMIYFLHMNTKSENGWS 87

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS---MEGMR 116
           +MA+IFTI+MV I   GS+WVM HLN+NMM    M GM+
Sbjct: 88  MMALIFTIVMVVIALSGSLWVMNHLNSNMMPIHQMSGMK 126


>gi|163853731|ref|YP_001641774.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens PA1]
 gi|240141156|ref|YP_002965636.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens AM1]
 gi|254563668|ref|YP_003070763.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens DM4]
 gi|163665336|gb|ABY32703.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens PA1]
 gi|240011133|gb|ACS42359.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens AM1]
 gi|254270946|emb|CAX26951.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens DM4]
          Length = 126

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D+ H  + H +G+ K  + GF+LS+ILT IPF +VM     DK I  + I+     QI+V
Sbjct: 9   DHGHGQDAHGHGSFKDYVTGFVLSVILTAIPFWLVMGDVLGDKLITGVVILGLGAVQIVV 68

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM--SMEGMR 116
           H+++FLHM+TK E GW+ MA+IFTI +V I   GS+WVM+HLN NMM  S E MR
Sbjct: 69  HMIYFLHMNTKSEGGWTFMALIFTITLVVITLCGSIWVMHHLNTNMMPISPEEMR 123


>gi|116255239|ref|YP_771072.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259887|emb|CAK02981.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 133

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 72/101 (71%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +GT +  + GF+LS+ILT IPF +VM G F    +  + ++     QI+VH+VFFLHM+
Sbjct: 25  GHGTFRSYMTGFVLSVILTAIPFWLVMSGVFASPVLTAVLVMGLGAIQIVVHMVFFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           T+ E GW+IMA+IFT+I+VAI   GS+WVM+HLN NMM M 
Sbjct: 85  TRSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNTNMMPMS 125


>gi|91975078|ref|YP_567737.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris BisB5]
 gi|91681534|gb|ABE37836.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris BisB5]
          Length = 130

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/115 (46%), Positives = 78/115 (67%), Gaps = 2/115 (1%)

Query: 3   YDNIHNMNM--HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           +D+ H  ++  H++GT K  L+GF LS++LT IPF +VM     +K    L I+  A  Q
Sbjct: 13  HDHGHEAHVAAHNHGTLKSYLIGFGLSVVLTAIPFWLVMGDVLGNKQATGLVIMAFAAVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           I+VH+++FLHM+T  E+GW++MA+IFTI+MV I   GS+WVM+HL  NMM    M
Sbjct: 73  IVVHMIYFLHMTTAAEEGWTMMALIFTIVMVVIALAGSLWVMHHLTTNMMPAHDM 127


>gi|86360305|ref|YP_472193.1| cytochrome O ubiquinol oxidase, subunit IV protein [Rhizobium etli
           CFN 42]
 gi|86284407|gb|ABC93466.1| cytochrome O ubiquinol oxidase, subunit IV protein [Rhizobium etli
           CFN 42]
          Length = 133

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT +  + GF LS++LT IPF +VM G F    +  + ++     QI+VH+VFFLHM+ 
Sbjct: 26  HGTFRSYMAGFALSVVLTAIPFWLVMAGVFASPAVTAVLVMAIGAVQIVVHMVFFLHMNP 85

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           + E GW++MA+IFT+I+VAI   GS+WVM+HLN NMM M 
Sbjct: 86  RSEGGWTMMALIFTLIIVAIALSGSLWVMHHLNTNMMPMS 125


>gi|254420203|ref|ZP_05033927.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas sp. BAL3]
 gi|196186380|gb|EDX81356.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas sp. BAL3]
          Length = 131

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H++G+ +  ++GF+LS+ILT IPF +VM G  L      L ++  A+ QI+VH+++FLHM
Sbjct: 23  HNHGSFRSYMIGFVLSVILTAIPFALVMTGA-LPPQATALIVMAFAVVQIVVHMIYFLHM 81

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++K E GW+++A+IFTII+V I   GS+WVMYHLN NMM 
Sbjct: 82  NSKSEGGWTMLALIFTIIVVVIALSGSLWVMYHLNTNMMP 121


>gi|218532589|ref|YP_002423405.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           chloromethanicum CM4]
 gi|218524892|gb|ACK85477.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           chloromethanicum CM4]
          Length = 126

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 56/115 (48%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D+ H  + H +G+ K  + GF+LS+ILT IPF +VM     DK I  + I+     QI+V
Sbjct: 9   DHGHGQDAHGHGSFKDYVTGFVLSVILTAIPFWLVMGDVLGDKLITGVVILGLGAVQIVV 68

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM--SMEGMR 116
           H+++FLHM+TK E GW+ MA+IFTI +V I   GS+WVM+HLN NMM  S E +R
Sbjct: 69  HMIYFLHMNTKSEGGWTFMALIFTITLVVITLCGSIWVMHHLNTNMMPISPEEIR 123


>gi|329915608|ref|ZP_08276292.1| Cytochrome O ubiquinol oxidase subunit IV [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544869|gb|EGF30239.1| Cytochrome O ubiquinol oxidase subunit IV [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 180

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           ++D  H+ +   +G+ K  L GFIL++ILT IPF +V+   F   +   L ++  A  QI
Sbjct: 17  EHDESHHTHA-DHGSVKSYLTGFILAVILTAIPFWVVLGKVFEKSSTTALVVLGFAAVQI 75

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VH+V+FLHM+TK E GWSI+A+IFT I+V I   GS+WVMYHLN+NMM 
Sbjct: 76  VVHMVYFLHMNTKSEGGWSILALIFTTILVVIMLSGSIWVMYHLNHNMMP 125


>gi|190895344|ref|YP_001985636.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CIAT 652]
 gi|218514327|ref|ZP_03511167.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           8C-3]
 gi|190699289|gb|ACE93373.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CIAT 652]
 gi|327188656|gb|EGE55862.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CNPAF512]
          Length = 133

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 70/100 (70%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT +  + GF LS++LT IPF +VM G F    +  + ++     QI+VH+VFFLHM+ 
Sbjct: 26  HGTFRSYMTGFALSIVLTAIPFWLVMSGVFESPAVTAVLVMAIGAIQIVVHMVFFLHMNP 85

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           + E GW++MA+IFTII+VAI   GS+WVM+HLN NMM M 
Sbjct: 86  RSEGGWTMMALIFTIIIVAIALSGSLWVMHHLNTNMMPMS 125


>gi|209546368|ref|YP_002278258.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209539225|gb|ACI59158.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 133

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 71/100 (71%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT +  + GF LS++LT IPF +VM G F    +  L ++     QI+VH+VFFLHM+ 
Sbjct: 26  HGTFRSYMTGFALSVVLTAIPFWLVMAGVFASPLVTALLVMGIGAIQIVVHMVFFLHMNP 85

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           + E GW++MA+IFTII+VAI   GS+WVM+HLN+NMM M 
Sbjct: 86  RSEGGWTMMALIFTIIIVAIALSGSLWVMHHLNSNMMPMS 125


>gi|148253544|ref|YP_001238129.1| cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobium sp.
           BTAi1]
 gi|146405717|gb|ABQ34223.1| cytochrome bo3 quinol oxidase subunit 4 [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            + + H+      GT++  L+GF  S++LT IPF +VM G  LDK    L I+  A  Q+
Sbjct: 5   AHAHAHDSADAHAGTRQGQLIGFGASVVLTAIPFLLVMHGT-LDKQATALIIMAFAAVQV 63

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           +VH++FFLHM+TK E GW++MA+IFTIIMV I   GS+WVM+HL  NMM +  M
Sbjct: 64  VVHMIFFLHMNTKAEGGWTMMALIFTIIMVVIALSGSLWVMHHLTTNMMPVHEM 117


>gi|222084384|ref|YP_002542913.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           radiobacter K84]
 gi|221721832|gb|ACM24988.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           radiobacter K84]
          Length = 133

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 77/108 (71%), Gaps = 2/108 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+GT K  + GF+LS+ILT IPF +VM   F D  +    I++    QIIVH+++FLHM+
Sbjct: 25  SHGTFKSYMTGFVLSVILTAIPFWLVMGKVFADPVVTAALIMVFGAIQIIVHMIYFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM--MSMEGMRSI 118
           TK E GW++MA+IFTI++V I   GS+WVM+HLN NM  MS E MR++
Sbjct: 85  TKSEGGWNMMALIFTIVLVIIALSGSLWVMHHLNANMMVMSPEMMRNM 132


>gi|86747365|ref|YP_483861.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris HaA2]
 gi|86570393|gb|ABD04950.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris HaA2]
          Length = 130

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 3   YDNIHNMNM--HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           +D+ H  ++   ++GT K  L+GF LS++LT IPF +VM     +K    L I+  A  Q
Sbjct: 13  HDHGHEAHVAAQTHGTLKSYLIGFGLSVVLTAIPFWLVMGDVLGNKQATGLVIMAFAAVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           I+VH+++FLHM+T  E+GW++MA+IFTI+MV I   GS+WVM+HL  NMM    M
Sbjct: 73  IVVHMIYFLHMTTAAEEGWTMMALIFTIVMVVIALAGSLWVMHHLTTNMMPAHDM 127


>gi|170748152|ref|YP_001754412.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654674|gb|ACB23729.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
          Length = 134

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 83/115 (72%), Gaps = 7/115 (6%)

Query: 4   DNIHNMNMHS---YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA- 59
            + H+ + HS   +GT +  + GF+LS+ILT+IPF +VM G  LD N +  T+V+ A+  
Sbjct: 13  QDTHDAHAHSEGGHGTFQSYMTGFVLSVILTVIPFWLVM-GNVLD-NSLVTTLVILALGG 70

Query: 60  -QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            Q++VH+++FLHMSTK E GW+ MA+IFTI +V I   GS+WVMYHLN+NMM M+
Sbjct: 71  VQMVVHVIYFLHMSTKSEGGWTFMALIFTITLVVIMLAGSVWVMYHLNHNMMPMD 125


>gi|91775645|ref|YP_545401.1| cytochrome C oxidase subunit IV [Methylobacillus flagellatus KT]
 gi|91709632|gb|ABE49560.1| cytochrome bo3 quinol oxidase subunit 4 [Methylobacillus
           flagellatus KT]
          Length = 112

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/97 (51%), Positives = 76/97 (78%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           + + K  ++GF+LS+ILT+IPFG++M    L  + + +TI++ A+ QI+VHLV+FLHM+T
Sbjct: 13  HASVKSYIIGFVLSVILTVIPFGLLMFPNDLSSSTILVTILVFAVVQIVVHLVYFLHMNT 72

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             E  W++MA IFT+I++AI  VGS+WVM+HLN+NMM
Sbjct: 73  SSEQSWNVMAFIFTVIILAIVVVGSLWVMFHLNHNMM 109


>gi|13475709|ref|NP_107276.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium loti
           MAFF303099]
 gi|14026465|dbj|BAB53062.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium loti
           MAFF303099]
          Length = 125

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 71/101 (70%), Gaps = 1/101 (0%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+LS+ILT IPF +VM G   +K    + I+  A+ QI+VH+VFFLHM T  E 
Sbjct: 23  KGYLIGFVLSVILTAIPFWLVMSGAIDNKQATAIVIMAFAVVQIVVHMVFFLHMKTASEG 82

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS-MEGMRS 117
           GWS++A+IFT+I+V I   GS+WVMYHLN NMM  +  MR 
Sbjct: 83  GWSMLALIFTLILVVIVLTGSLWVMYHLNANMMPGLHDMRE 123


>gi|222107117|ref|YP_002547908.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium vitis S4]
 gi|221738296|gb|ACM39192.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium vitis S4]
          Length = 132

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 78/108 (72%), Gaps = 2/108 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ LT IPF +VM G   +K ++   ++     Q++VH+++FLHM+
Sbjct: 24  SHGSMKTYMIGFILSVTLTSIPFYLVMSGSLTNKALLAGIVMGLGAIQVVVHMIYFLHMN 83

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM--EGMRSI 118
           TK E GW++MA+IFTII+V I   GS+WVM+HLN NMM M  E MR++
Sbjct: 84  TKSEGGWNMMALIFTIIVVVIALSGSLWVMHHLNTNMMPMSPEMMRNV 131


>gi|307309510|ref|ZP_07589166.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           BL225C]
 gi|306900095|gb|EFN30715.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           BL225C]
          Length = 133

 Score =  108 bits (269), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 74/101 (73%), Gaps = 2/101 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA-QIIVHLVFFLHMS 72
           +GT K  + GF+LS+ILT IPF +VM    LD  ++   I++   A QI+VH++FFLHM+
Sbjct: 26  HGTLKSYMTGFVLSVILTAIPFWLVMADV-LDSAVLTAAIIMALGALQIVVHMIFFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           T+ E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M 
Sbjct: 85  TRSEGGWTMMALIFTILLVAIALSGSLWVMHHLNTNMMPMS 125


>gi|145299868|ref|YP_001142709.1| cytochrome o ubiquinol oxidase subunit IV [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852640|gb|ABO90961.1| cytochrome O ubiquinol oxidase protein CyoD [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 110

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 81/106 (76%), Gaps = 3/106 (2%)

Query: 7   HNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           H+++ H  S+G+ K  L+GF+LS+ILT IPF +VM G F  +  M +T+V  A+ QI VH
Sbjct: 4   HSVDNHGASHGSAKSYLIGFVLSVILTAIPFWMVMDGGFTHQT-MLITVVAMAVVQIFVH 62

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LV+FLHM+T  E+ W+++A++FT++++AI  VGS+W+MY+LN NMM
Sbjct: 63  LVYFLHMNTSSEERWNLVALVFTVLIIAIVVVGSLWIMYNLNINMM 108


>gi|293607337|ref|ZP_06689676.1| quinol oxidase subunit IV [Achromobacter piechaudii ATCC 43553]
 gi|292814181|gb|EFF73323.1| quinol oxidase subunit IV [Achromobacter piechaudii ATCC 43553]
          Length = 139

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 68/98 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GFIL+ ILT IPF +VM   F       L I+  A+ QI+VH+++FLHM TK 
Sbjct: 34  TLKSYVTGFILAAILTAIPFWLVMDRVFASSRTTALVILAFAVVQIVVHIIYFLHMDTKS 93

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M 
Sbjct: 94  ESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMS 131


>gi|195970075|ref|YP_002122335.1| cytochrome o ubiquinol oxidase protein CyoD [Sinorhizobium meliloti
           1021]
 gi|307320582|ref|ZP_07599996.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           AK83]
 gi|186929524|emb|CAQ51297.1| Cytochrome o ubiquinol oxidase protein cyoD [Sinorhizobium meliloti
           1021]
 gi|306893732|gb|EFN24504.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           AK83]
          Length = 133

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 2/101 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA-QIIVHLVFFLHMS 72
           +GT K    GF+LS+ILT IPF +VM    LD  ++   I++   A QI+VH++FFLHM+
Sbjct: 26  HGTLKSYATGFVLSVILTAIPFWLVMADI-LDSAVLTAAIIMALGAVQIVVHMIFFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           T+ E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M 
Sbjct: 85  TRSEGGWTMMALIFTILLVAIALSGSLWVMHHLNTNMMPMS 125


>gi|85058642|ref|YP_454344.1| cytochrome o ubiquinol oxidase subunit IV [Sodalis glossinidius
           str. 'morsitans']
 gi|84779162|dbj|BAE73939.1| cytochrome o ubiquinol oxidase subunit IV [Sodalis glossinidius
           str. 'morsitans']
          Length = 110

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 77/98 (78%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S G+ K  L+GFILS+ILT+IPF IVM+G    ++++   +V+CA+ QI+VHLV+FLH+S
Sbjct: 12  SQGSHKSYLIGFILSIILTVIPFAIVMQGS-ASESMLIAVLVICAVVQIVVHLVYFLHLS 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E  W+++A +F ++++AI  VGS+W+M++LN+N+M
Sbjct: 71  TSSEQQWNLIAFVFAVMIIAILVVGSLWIMWYLNHNLM 108


>gi|239830890|ref|ZP_04679219.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum intermedium
           LMG 3301]
 gi|239823157|gb|EEQ94725.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum intermedium
           LMG 3301]
          Length = 122

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 79/110 (71%), Gaps = 5/110 (4%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L+++LT++PF + M G+F       + + L A+ QI+VHLV+FLH+ 
Sbjct: 13  AHGSLKSYLIGFVLAVVLTVVPFMLAMNGYFTPATTAAIVLGL-AVVQILVHLVYFLHLD 71

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM----EGMRSI 118
            K E GW+I+A+IFT+I++AI   GS+WVM+HL+ NMM M    E +R++
Sbjct: 72  PKSEGGWNILALIFTVIILAIVLAGSIWVMHHLDTNMMPMYMSPEDVRNL 121


>gi|254690357|ref|ZP_05153611.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
 gi|260755901|ref|ZP_05868249.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
 gi|260676009|gb|EEX62830.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
          Length = 121

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+
Sbjct: 2   SSAHQTHDHAAHGSVKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|62289032|ref|YP_220825.1| ubiquinol oxidase subunit IV [Brucella abortus bv. 1 str. 9-941]
 gi|82698969|ref|YP_413543.1| cytochrome C oxidase subunit IV [Brucella melitensis biovar Abortus
           2308]
 gi|148560321|ref|YP_001258092.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ovis ATCC
           25840]
 gi|161618035|ref|YP_001591922.1| cytochrome o ubiquinol oxidase subunit IV [Brucella canis ATCC
           23365]
 gi|163842321|ref|YP_001626725.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis ATCC
           23445]
 gi|189023307|ref|YP_001934075.1| cytochrome C oxidase subunit IV [Brucella abortus S19]
 gi|254694846|ref|ZP_05156674.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|254696475|ref|ZP_05158303.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254705226|ref|ZP_05167054.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 3
           str. 686]
 gi|254707255|ref|ZP_05169083.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|254709204|ref|ZP_05171015.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|254713371|ref|ZP_05175182.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M644/93/1]
 gi|254716271|ref|ZP_05178082.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M13/05/1]
 gi|254718265|ref|ZP_05180076.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. 83/13]
 gi|254731387|ref|ZP_05189965.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|256030728|ref|ZP_05444342.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|256158735|ref|ZP_05456610.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M490/95/1]
 gi|256254132|ref|ZP_05459668.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti B1/94]
 gi|256258611|ref|ZP_05464147.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|256368511|ref|YP_003106017.1| cytochrome o ubiquinol oxidase subunit IV [Brucella microti CCM
           4915]
 gi|260169631|ref|ZP_05756442.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. F5/99]
 gi|260546326|ref|ZP_05822066.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus NCTC
           8038]
 gi|260567307|ref|ZP_05837777.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 4
           str. 40]
 gi|260759125|ref|ZP_05871473.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|260760850|ref|ZP_05873193.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260884925|ref|ZP_05896539.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|261215176|ref|ZP_05929457.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|261218048|ref|ZP_05932329.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M13/05/1]
 gi|261221275|ref|ZP_05935556.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti B1/94]
 gi|261314737|ref|ZP_05953934.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|261316705|ref|ZP_05955902.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|261321102|ref|ZP_05960299.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M644/93/1]
 gi|261755935|ref|ZP_05999644.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 3 str.
           686]
 gi|261759161|ref|ZP_06002870.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. F5/99]
 gi|265983226|ref|ZP_06095961.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. 83/13]
 gi|265987775|ref|ZP_06100332.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|265997236|ref|ZP_06109793.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M490/95/1]
 gi|297247450|ref|ZP_06931168.1| cytochrome o ubiquinol oxidase operon protein cyoD [Brucella
           abortus bv. 5 str. B3196]
 gi|306840008|ref|ZP_07472802.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. NF 2653]
 gi|306842662|ref|ZP_07475307.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO2]
 gi|306843645|ref|ZP_07476246.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO1]
 gi|62195164|gb|AAX73464.1| QoxD, ubiquinol oxidase subunit IV [Brucella abortus bv. 1 str.
           9-941]
 gi|82615070|emb|CAJ09998.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           biovar Abortus 2308]
 gi|148371578|gb|ABQ61557.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ovis ATCC
           25840]
 gi|161334846|gb|ABX61151.1| cytochrome o ubiquinol oxidase subunit IV [Brucella canis ATCC
           23365]
 gi|163673044|gb|ABY37155.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis ATCC
           23445]
 gi|189018879|gb|ACD71601.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus S19]
 gi|255998669|gb|ACU47068.1| cytochrome o ubiquinol oxidase subunit IV [Brucella microti CCM
           4915]
 gi|260096433|gb|EEW80309.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus NCTC
           8038]
 gi|260156825|gb|EEW91905.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 4
           str. 40]
 gi|260669443|gb|EEX56383.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|260671282|gb|EEX58103.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260874453|gb|EEX81522.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|260916783|gb|EEX83644.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|260919859|gb|EEX86512.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti B1/94]
 gi|260923137|gb|EEX89705.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M13/05/1]
 gi|261293792|gb|EEX97288.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M644/93/1]
 gi|261295928|gb|EEX99424.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|261303763|gb|EEY07260.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|261739145|gb|EEY27141.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. F5/99]
 gi|261745688|gb|EEY33614.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 3 str.
           686]
 gi|262551704|gb|EEZ07694.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M490/95/1]
 gi|264659972|gb|EEZ30233.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|264661818|gb|EEZ32079.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. 83/13]
 gi|297174619|gb|EFH33966.1| cytochrome o ubiquinol oxidase operon protein cyoD [Brucella
           abortus bv. 5 str. B3196]
 gi|306276336|gb|EFM58036.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO1]
 gi|306287197|gb|EFM58694.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO2]
 gi|306404972|gb|EFM61257.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. NF 2653]
          Length = 121

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+VHL++FLH+ 
Sbjct: 12  AHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QILVHLIYFLHLD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 71  PKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|319795348|ref|YP_004156988.1| cytochrome o ubiquinol oxidase subunit iv [Variovorax paradoxus
           EPS]
 gi|315597811|gb|ADU38877.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           EPS]
          Length = 136

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 50/101 (49%), Positives = 70/101 (69%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+ T K  + GF+L++ILT IPF +VM   F + N   L I+  A  QI+VH+++FLHM 
Sbjct: 28  SHSTFKGYMTGFVLAVILTAIPFWLVMGKVFANTNTTSLIILGFAAVQIVVHMIYFLHMD 87

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            K E GW+++A+IFTI++V I   GS+WVMYH+N NMM M 
Sbjct: 88  AKSESGWNMLALIFTIVLVVITLAGSLWVMYHMNTNMMPMS 128


>gi|256060188|ref|ZP_05450368.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella neotomae
           5K33]
 gi|261324165|ref|ZP_05963362.1| cytochrome o ubiquinol oxidase subunit IV [Brucella neotomae 5K33]
 gi|261300145|gb|EEY03642.1| cytochrome o ubiquinol oxidase subunit IV [Brucella neotomae 5K33]
          Length = 121

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+VHL++FLH+ 
Sbjct: 12  AHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QILVHLIYFLHLD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 71  PKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|23500960|ref|NP_697087.1| ubiquinol oxidase subunit IV [Brucella suis 1330]
 gi|23346817|gb|AAN29002.1| ubiquinol oxidase subunit IV [Brucella suis 1330]
          Length = 121

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+VHL++FLH+ 
Sbjct: 12  AHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QILVHLIYFLHLD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 71  PKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|225626592|ref|ZP_03784631.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti str. Cudo]
 gi|237814519|ref|ZP_04593517.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus str.
           2308 A]
 gi|225618249|gb|EEH15292.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti str. Cudo]
 gi|237789356|gb|EEP63566.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus str.
           2308 A]
          Length = 122

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+VHL++FLH+ 
Sbjct: 13  AHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QILVHLIYFLHLD 71

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 72  PKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 111


>gi|317403926|gb|EFV84395.1| cytochrome ubiquinol oxidase subunit IV [Achromobacter xylosoxidans
           C54]
          Length = 132

 Score =  106 bits (265), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 68/98 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L+ ILT IPF +VM   F       L I+  A+ QI+VH+++FLHM TK 
Sbjct: 27  TLKSYVTGFVLAAILTAIPFWLVMDRVFASSRTTALVILAFAVVQIVVHIIYFLHMDTKS 86

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M 
Sbjct: 87  ESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMS 124


>gi|124266931|ref|YP_001020935.1| cytochrome ubiquinol oxidase subunit IV [Methylibium petroleiphilum
           PM1]
 gi|124259706|gb|ABM94700.1| cytochrome ubiquinol oxidase subunit IV [Methylibium petroleiphilum
           PM1]
          Length = 127

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 79/117 (67%), Gaps = 2/117 (1%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + + H  +   +G+ K  ++GF+LSL+LT IPF +VM        +  L I+  A  QI+
Sbjct: 9   HHDGHEGDEAGHGSLKGYVIGFMLSLVLTAIPFWLVMGKVIASSGLTALVILGFAAVQIV 68

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM--SMEGMRS 117
           VH+V+FLHM+ K E GW+I+A+IFT+++V I   GS+WVMYHLN+NMM  SM  +R+
Sbjct: 69  VHMVYFLHMNAKSEGGWTILALIFTLVLVVITLSGSLWVMYHLNHNMMPASMHEVRN 125


>gi|153007396|ref|YP_001368611.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559284|gb|ABS12782.1| Cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum anthropi
           ATCC 49188]
          Length = 122

 Score =  106 bits (265), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+L+++LT++PF + M G+F       + ++  A+ QI+VHLV+FLH+ 
Sbjct: 13  SHGSLKTYLIGFVLAVVLTVVPFMLAMNGYFTPGTTAAI-VLGIAVVQILVHLVYFLHLD 71

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+I+A+IFT+I++AI   GS+WVM+HL+ NMM M
Sbjct: 72  PKSEGGWNILALIFTVIILAIVLAGSIWVMHHLDTNMMPM 111


>gi|149926920|ref|ZP_01915179.1| Prokaryotic Cytochrome C oxidase subunit IV [Limnobacter sp.
           MED105]
 gi|149824472|gb|EDM83690.1| Prokaryotic Cytochrome C oxidase subunit IV [Limnobacter sp.
           MED105]
          Length = 133

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 68/94 (72%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           +   +GF+L++ILT+IPF +VM G F       L I+     Q++VH+++FLHM++K E 
Sbjct: 26  RDYTIGFVLAVILTVIPFALVMGGVFESSTTTALVILGLGAVQMVVHMIYFLHMNSKSEG 85

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           GWS++AM+FT+I+V I  VGS+WVMYHLN NMM 
Sbjct: 86  GWSMLAMMFTLIIVVITLVGSIWVMYHLNTNMMP 119


>gi|114707979|ref|ZP_01440871.1| Prokaryotic Cytochrome C oxidase subunit IV [Fulvimarina pelagi
           HTCC2506]
 gi|114536608|gb|EAU39740.1| Prokaryotic Cytochrome C oxidase subunit IV [Fulvimarina pelagi
           HTCC2506]
          Length = 223

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (62%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H     ++ T    L GF LS++LT +PF +VM     D     L +V  A+AQI VH++
Sbjct: 20  HGEGGEAHATLSGYLTGFGLSVVLTAVPFWLVMARPIEDGVTTALLVVSLAVAQIFVHMI 79

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           +FLHM  K E GW+IMA+IFT ++V I   GS+WVM+HLN NMM M  M+
Sbjct: 80  YFLHMDAKSEGGWTIMALIFTAVLVIITISGSLWVMFHLNRNMMPMGDMQ 129


>gi|262375302|ref|ZP_06068535.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter lwoffii
           SH145]
 gi|262309556|gb|EEY90686.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter lwoffii
           SH145]
          Length = 123

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  VGFILS+ILT+IPFG+VM G F  + I+   I + A+AQ
Sbjct: 16  MSHD--HNAAGESHGNVKQYTVGFILSVILTVIPFGMVMAGGF-GRGILITVIAITAVAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+V L++FLHM++  E  W+++A ++TI+ +AI  VGS+W+M +L+ NMM
Sbjct: 73  ILVQLIYFLHMNSSSEQRWNVIAFVYTILTIAILLVGSVWIMNYLHYNMM 122


>gi|254700860|ref|ZP_05162688.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 5
           str. 513]
 gi|261751370|ref|ZP_05995079.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 5 str.
           513]
 gi|261741123|gb|EEY29049.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 5 str.
           513]
          Length = 121

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 74/100 (74%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+VHL++FLH+ 
Sbjct: 12  AHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QILVHLIYFLHLD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
            K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 71  PKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMLM 110


>gi|288962725|ref|YP_003453019.1| cytochrome o ubiquinol oxidase operon protein [Azospirillum sp.
           B510]
 gi|288914991|dbj|BAI76475.1| cytochrome o ubiquinol oxidase operon protein [Azospirillum sp.
           B510]
          Length = 139

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 75/99 (75%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    ++GF+LS+ILT+IPF +VM G  LD     + ++  A+ QIIVH+V+FLHM+
Sbjct: 32  AHGTFGSYMIGFVLSVILTVIPFWLVMNGT-LDNVTTTVVVLALAVVQIIVHMVYFLHMN 90

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            + E GWS++AMIFTII+V I F GS+WVMYHLN+NMM 
Sbjct: 91  GRAEGGWSMLAMIFTIIVVVIMFSGSLWVMYHLNHNMMP 129


>gi|237808828|ref|YP_002893268.1| cytochrome o ubiquinol oxidase subunit IV [Tolumonas auensis DSM
           9187]
 gi|237501089|gb|ACQ93682.1| cytochrome o ubiquinol oxidase subunit IV [Tolumonas auensis DSM
           9187]
          Length = 109

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS++LT+IPF IVM+   L  + + L I   A+AQI+V L++FLHM 
Sbjct: 11  SHGSVKSYITGFILSVVLTVIPFWIVMESA-LPPSTVILVIAAFAVAQILVQLIYFLHMD 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK E GW+++A +FT++++AI  VGS+W+M+HLN+NMM
Sbjct: 70  TKSEGGWNMIAFVFTVLIIAIIVVGSLWIMFHLNHNMM 107


>gi|251790656|ref|YP_003005377.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya zeae Ech1591]
 gi|247539277|gb|ACT07898.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya zeae Ech1591]
          Length = 110

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 77/98 (78%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  LVGF+LS+ILT+IPFG+VM G     N++ L ++ CAI QI+VHLV+FLH++
Sbjct: 12  SHGSVKSYLVGFVLSIILTVIPFGLVMNGS-ASHNVILLAVLGCAIIQILVHLVYFLHLN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 71  TSSEERWNVVAIVFTALIIAIVVVGSLWIMMNAHHNMM 108


>gi|311108526|ref|YP_003981379.1| cytochrome O ubiquinol oxidase subunit IV 2 [Achromobacter
           xylosoxidans A8]
 gi|310763215|gb|ADP18664.1| cytochrome O ubiquinol oxidase subunit IV 2 [Achromobacter
           xylosoxidans A8]
          Length = 134

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 69/98 (70%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L+ +LT IPF +VM   F +     L I+  A+ QI+VH+++FLHM TK 
Sbjct: 29  TFKSYMTGFVLAAVLTAIPFWLVMGRVFTESRTTALVILAFAVVQIVVHIIYFLHMDTKS 88

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           E GW+++A+IFT+++V I   GS+W+MYHL++NMM M 
Sbjct: 89  ESGWNMLALIFTLVLVVITLSGSIWIMYHLDSNMMPMS 126


>gi|227820112|ref|YP_002824083.1| cytochrome O ubiquinol oxidase subunit IV [Sinorhizobium fredii
           NGR234]
 gi|227339111|gb|ACP23330.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium fredii
           NGR234]
          Length = 133

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA-QIIVHLVFFLHMS 72
           +GT K  L GF+LS+ILT IPF +VM    LD  ++   I++   A QI+VH++FFLHM+
Sbjct: 26  HGTLKSYLTGFVLSVILTAIPFWLVMAEV-LDSPVLTAVIIMALGAIQIVVHMIFFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           T+ E GW++MA+IFTI++V I   GS+WVM+HL  NMM M
Sbjct: 85  TRSEGGWTMMALIFTIVLVVIALSGSLWVMHHLEENMMPM 124


>gi|159184177|ref|NP_353175.2| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           tumefaciens str. C58]
 gi|159139510|gb|AAK85960.2| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           tumefaciens str. C58]
          Length = 130

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 73/100 (73%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+GT K  ++GF+LS+ILT IPF +VM G   +K ++ + I+   + QI VH+++FLHM 
Sbjct: 22  SHGTFKSYMIGFVLSVILTAIPFWLVMGGVLENKTLLVIAIMGLGVIQIFVHMIYFLHMD 81

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           T+ E GW+ MA+IFT++++ I   GS+WVMY++N NMM +
Sbjct: 82  TRSEGGWTFMALIFTVVVLLITLSGSLWVMYNMNKNMMPL 121


>gi|17988181|ref|NP_540815.1| cytochrome O ubiquinol oxidase operon protein CYOD [Brucella
           melitensis bv. 1 str. 16M]
 gi|17983942|gb|AAL53079.1| cytochrome o ubiquinol oxidase operon protein cyod [Brucella
           melitensis bv. 1 str. 16M]
          Length = 148

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+
Sbjct: 29  SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QIL 87

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FL++  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 88  VHLIYFLYLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 137


>gi|225851588|ref|YP_002731821.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis ATCC
           23457]
 gi|256045835|ref|ZP_05448711.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|256112552|ref|ZP_05453473.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|256264901|ref|ZP_05467433.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260563126|ref|ZP_05833612.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 1 str. 16M]
 gi|265992249|ref|ZP_06104806.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|265993992|ref|ZP_06106549.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|225639953|gb|ACN99866.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis ATCC
           23457]
 gi|260153142|gb|EEW88234.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 1 str. 16M]
 gi|262764973|gb|EEZ10894.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|263003315|gb|EEZ15608.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|263095386|gb|EEZ18987.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 2 str. 63/9]
 gi|326408057|gb|ADZ65122.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis M28]
 gi|326537773|gb|ADZ85988.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis
           M5-90]
          Length = 121

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + + + A+ QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTPATTAVIVLAIAAV-QIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FL++  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLYLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|170743800|ref|YP_001772455.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium sp.
           4-46]
 gi|168198074|gb|ACA20021.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium sp.
           4-46]
          Length = 140

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 75/119 (63%), Gaps = 3/119 (2%)

Query: 4   DNIHNMNMH---SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           D  H    H   ++G+ +  + GF+LS+ILT IPF +VM     D  +  + I+  A  Q
Sbjct: 20  DGAHGSAHHPGGAHGSFRGYVTGFVLSVILTAIPFWLVMANTLDDTLVTSIVIMALAAVQ 79

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           I+VH+++FLHM+TK E GW+ MA++FT+ +V I   GS+WVMYH++ NMM M    ++ 
Sbjct: 80  IVVHMIYFLHMNTKSEGGWTFMALVFTLTLVVITLAGSIWVMYHMDQNMMPMSPHEALQ 138


>gi|307129919|ref|YP_003881935.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii 3937]
 gi|306527448|gb|ADM97378.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii 3937]
          Length = 110

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+    S+G+ K  L+GF+LS+ILT+IPFG+VM G     +++ LT++ CA+ QI+VHLV
Sbjct: 6   HDHAGASHGSVKSYLIGFVLSIILTVIPFGLVMNGS-ASHSVILLTVLGCAVVQILVHLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH++T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 65  YFLHLNTSSEERWNVVAIVFTALIIAIVVVGSLWIMMNAHHNMM 108


>gi|239817019|ref|YP_002945929.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           S110]
 gi|239803596|gb|ACS20663.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           S110]
          Length = 129

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 73/112 (65%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ H+    S+ T K  + GF+L+++LT IPF +VM       +   L I+  A  QI
Sbjct: 10  AHDDHHDDGPVSHSTFKGYMTGFVLAVVLTAIPFWLVMGNVLGKPSTTSLVILGFAAVQI 69

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +VH+++FLHM  K E GW+++A+IFTI++V I   GS+WVMYH+N NMM M 
Sbjct: 70  VVHMIYFLHMDAKSESGWNMLALIFTIVLVVITLAGSLWVMYHMNANMMPMS 121


>gi|299769502|ref|YP_003731528.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. DR1]
 gi|298699590|gb|ADI90155.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. DR1]
          Length = 109

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V LV
Sbjct: 6   HNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAIAAVAQVLVQLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 65  YFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 108


>gi|117617963|ref|YP_857447.1| cytochrome o ubiquinol oxidase subunit IV [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559370|gb|ABK36318.1| cytochrome O ubiquinol oxidase protein CyoD [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 110

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 78/106 (73%), Gaps = 3/106 (2%)

Query: 7   HNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           H ++ H  S+G+ K  L+GF+LSLILT +PF +VM G      ++  T+V  A+ QI VH
Sbjct: 4   HTVDNHGASHGSAKSYLIGFVLSLILTAVPFWMVMDGSASHTTVLA-TVVGMAVVQIFVH 62

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LV+FLHM+T  E+ W+++A+IFT++++AI  VGS+W+MY+LN NMM
Sbjct: 63  LVYFLHMNTSSEERWNLVALIFTVLIIAIVVVGSLWIMYNLNINMM 108


>gi|319783410|ref|YP_004142886.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169298|gb|ADV12836.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 126

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 72/106 (67%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+    L GF LS++LT +PF +VM     ++    + I+  A+ QIIVH+VFFLHM+
Sbjct: 20  NHGSLAGYLTGFGLSVVLTAVPFWLVMTNALGNQMASAIAIMAFAVVQIIVHMVFFLHMN 79

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           T+ E GW++MA+IFT+I+V I   GS+WVMYHLN NMM    M  I
Sbjct: 80  TRSESGWTMMALIFTLILVMIALTGSLWVMYHLNVNMMPGHDMSQI 125


>gi|188584037|ref|YP_001927482.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium populi
           BJ001]
 gi|179347535|gb|ACB82947.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium populi
           BJ001]
          Length = 131

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 71/101 (70%), Gaps = 2/101 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  + GF+LS+ILT IPF +VM     DK +  + I+  A+ QI+VH+++FLHM+TK E 
Sbjct: 28  KDYVTGFVLSVILTAIPFWLVMDNVIEDKIVTGVVILALAVVQIVVHMIYFLHMNTKSEG 87

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM--SMEGMR 116
           GW+ +A+IFTI +V I   GS+WVM+HLN NMM  S E MR
Sbjct: 88  GWTFLALIFTITLVVITLCGSIWVMHHLNTNMMPISAEEMR 128


>gi|226952679|ref|ZP_03823143.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ATCC
           27244]
 gi|294649993|ref|ZP_06727381.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226836585|gb|EEH68968.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ATCC
           27244]
 gi|292824086|gb|EFF82901.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 109

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V LV
Sbjct: 6   HNAAGASHGNVKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAITAVAQVLVQLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  +  W+++A I+TI+ +A+  VGS+W+M +L+ NMM
Sbjct: 65  YFLHMNTSSDQRWNLIAFIYTILCIAVLLVGSVWIMNYLHYNMM 108


>gi|262372200|ref|ZP_06065479.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter junii
           SH205]
 gi|262312225|gb|EEY93310.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter junii
           SH205]
          Length = 124

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS++LTIIPFG+VM G F  + I+   I + A+AQ++V LV
Sbjct: 21  HNAAGASHGNFKQYTVGFILSVVLTIIPFGMVMAGGF-SRGILMTVIAITAVAQVLVQLV 79

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  E  W+++A I+TI+ +A+  VGS+W+M +L+ NMM
Sbjct: 80  YFLHMNTSSEQRWNLIAFIYTILCIAVLLVGSVWIMNYLHYNMM 123


>gi|262279560|ref|ZP_06057345.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus RUH2202]
 gi|262259911|gb|EEY78644.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus RUH2202]
          Length = 124

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V LV
Sbjct: 21  HNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAITAVAQVLVQLV 79

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 80  YFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 123


>gi|317492923|ref|ZP_07951347.1| cytochrome o ubiquinol oxidase subunit IV protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919045|gb|EFV40380.1| cytochrome o ubiquinol oxidase subunit IV protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 116

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 77/101 (76%), Gaps = 1/101 (0%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N  S+G+ K  ++GFILS+ILT+IPF +VM+G    + I+ +T+V  A+ QI VHLV+FL
Sbjct: 15  NGASHGSAKSYMIGFILSVILTVIPFWMVMEGTASHQTIL-ITVVAMAVIQIFVHLVYFL 73

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HM+T  E+ W+++A+ FT +++AI  VGS+W+MY+LN NMM
Sbjct: 74  HMNTSSEERWNLIALAFTALIIAIVVVGSLWIMYNLNINMM 114


>gi|238754225|ref|ZP_04615582.1| hypothetical protein yruck0001_21740 [Yersinia ruckeri ATCC 29473]
 gi|238707472|gb|EEP99832.1| hypothetical protein yruck0001_21740 [Yersinia ruckeri ATCC 29473]
          Length = 110

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ QIIVHLV+FLHM+
Sbjct: 12  SHGSLKSYLIGFILSIILTVIPFVMVMQGTASHTMILA-TVVTLAVVQIIVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            K E+ W+++A +FT++++AI  VGS+W+MY+LN NMM
Sbjct: 71  GKSEERWNLVAFLFTVMIIAIVVVGSLWIMYNLNINMM 108


>gi|218679506|ref|ZP_03527403.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           etli CIAT 894]
          Length = 133

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT K  + GF+LS+ILT IPF +VM G      +  + ++     QI+VH++FFLHM+T
Sbjct: 26  HGTFKSYMAGFVLSVILTAIPFWLVMSGVIASPALTAVLVMGLGAVQIVVHMIFFLHMNT 85

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
           + E GW+IMA+IFT+I+VAI   GS+WVM+HLN 
Sbjct: 86  RSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNT 119


>gi|119387827|ref|YP_918861.1| cytochrome C oxidase subunit IV [Paracoccus denitrificans PD1222]
 gi|461330|emb|CAA55035.1| cytochrome ba(3) [Paracoccus denitrificans]
 gi|119378402|gb|ABL73165.1| cytochrome ba3 quinol oxidase subunit 4 [Paracoccus denitrificans
           PD1222]
          Length = 127

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 69/89 (77%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GF+LS+ILT IPFG+VM G F  + +  +T++  A+ QI+VH+V+FLHM+ K E+GW+++
Sbjct: 27  GFLLSVILTAIPFGLVMAGGFESRALTAVTVIGFAVVQILVHMVYFLHMNGKQEEGWTML 86

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           + IFT+++V I   GS+WVMYH+N NMM 
Sbjct: 87  STIFTVVVVVILLAGSLWVMYHMNTNMMP 115


>gi|169633240|ref|YP_001706976.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           SDF]
 gi|169795506|ref|YP_001713299.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AYE]
 gi|260549406|ref|ZP_05823625.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp.
           RUH2624]
 gi|260554568|ref|ZP_05826789.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 19606]
 gi|169148433|emb|CAM86299.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AYE]
 gi|169152032|emb|CAP00912.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii]
 gi|260407515|gb|EEX00989.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp.
           RUH2624]
 gi|260411110|gb|EEX04407.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 19606]
          Length = 124

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + ++   I + A+AQ++V LV
Sbjct: 21  HNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGLLVTVIAITAVAQVLVQLV 79

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 80  YFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 123


>gi|184158692|ref|YP_001847031.1| Heme/copper-type cytochrome/quinol oxidase subunit 4 [Acinetobacter
           baumannii ACICU]
 gi|213158554|ref|YP_002319852.1| cytochrome O ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB0057]
 gi|215482993|ref|YP_002325198.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB307-0294]
 gi|239501440|ref|ZP_04660750.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB900]
 gi|293609458|ref|ZP_06691760.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|301345100|ref|ZP_07225841.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB056]
 gi|301510828|ref|ZP_07236065.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB058]
 gi|301595309|ref|ZP_07240317.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB059]
 gi|332850731|ref|ZP_08432978.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013150]
 gi|332866968|ref|ZP_08437285.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013113]
 gi|332873684|ref|ZP_08441627.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6014059]
 gi|183210286|gb|ACC57684.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Acinetobacter baumannii ACICU]
 gi|193077738|gb|ABO12596.2| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 17978]
 gi|213057714|gb|ACJ42616.1| cytochrome O ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB0057]
 gi|213988781|gb|ACJ59080.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB307-0294]
 gi|292827910|gb|EFF86273.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|322507498|gb|ADX02952.1| cyoD [Acinetobacter baumannii 1656-2]
 gi|323518606|gb|ADX92987.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           TCDC-AB0715]
 gi|325122720|gb|ADY82243.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus PHEA-2]
 gi|332730568|gb|EGJ61884.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013150]
 gi|332734297|gb|EGJ65425.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013113]
 gi|332738072|gb|EGJ68956.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6014059]
          Length = 109

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 75/104 (72%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + ++   I + A+AQ++V LV
Sbjct: 6   HNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGLLVTVIAITAVAQVLVQLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 65  YFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 108


>gi|150376510|ref|YP_001313106.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium medicae
           WSM419]
 gi|150031057|gb|ABR63173.1| Cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium medicae
           WSM419]
          Length = 133

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 72/99 (72%), Gaps = 2/99 (2%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA-QIIVHLVFFLHMSTK 74
           T K  + GFILS++LT IPF +VM    L+  I+   I++   A QI+VH++FFLHM+T+
Sbjct: 28  TLKSYVTGFILSVLLTAIPFWLVMADV-LESAILTAAIIMALGAIQIVVHMIFFLHMNTR 86

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M 
Sbjct: 87  SEGGWTMMALIFTIVLVAIALSGSLWVMHHLNTNMMPMS 125


>gi|262369760|ref|ZP_06063088.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter johnsonii
           SH046]
 gi|262315828|gb|EEY96867.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter johnsonii
           SH046]
          Length = 123

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  +GFILS+ILT+IPFG+VM G F  + I+   I + A+AQ
Sbjct: 16  MSHD--HNSAGASHGNTKQYTIGFILSVILTVIPFGMVMAGGF-GRGIVMAVIAITAVAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LV+FLHM++  E  W+++A I+T++ +A+  VGS+W+M +L+ NMM
Sbjct: 73  VLVQLVYFLHMNSSSEQRWNVIAFIYTVLCIAVLLVGSVWIMNYLHYNMM 122


>gi|332184971|ref|ZP_08386720.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
 gi|332014695|gb|EGI56751.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
          Length = 101

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 65/91 (71%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LS+ILT IPF  VM G   D     L I+  A  QI+VH+++FLHM+TK E GW+
Sbjct: 1   MIGFVLSVILTAIPFWAVMTGALGDTQTTALVIMGLAFVQIVVHMIYFLHMNTKSEGGWT 60

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +MA++FT ++V I   GS+WVMYH+N NMM 
Sbjct: 61  MMALVFTAVLVVITLSGSIWVMYHMNTNMMP 91


>gi|329890316|ref|ZP_08268659.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas diminuta
           ATCC 11568]
 gi|328845617|gb|EGF95181.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas diminuta
           ATCC 11568]
          Length = 128

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 71/102 (69%), Gaps = 1/102 (0%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF LS++LT IPF +VM G  L   +  L I   A+ QI+VH++FFLHM+ K 
Sbjct: 26  TYKGYLIGFGLSVVLTAIPFWLVMAGV-LAPQLTGLIITAFAVVQIVVHMIFFLHMNHKS 84

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           E GW+++A+IFT+++V I   GS+WVMYHLN NMM +  M+ 
Sbjct: 85  EGGWNMLALIFTLVIVVIAVAGSVWVMYHLNTNMMPVHDMQG 126


>gi|37527738|ref|NP_931083.1| cytochrome o ubiquinol oxidase subunit IV [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787174|emb|CAE16250.1| cytochrome O ubiquinol oxidase protein cyoD (ubiquinol oxidase
           chain D) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 110

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+LS+ILT+IPF +VM G      I+  T+V  A+ QIIVH ++FLHM+
Sbjct: 12  SHGSLKSYLIGFVLSVILTVIPFWMVMDGSASHTTILT-TVVALAVVQIIVHFIYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FTI+++ I  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNLVALLFTILIIGIVVVGSLWIMYNLNINMM 108


>gi|260773172|ref|ZP_05882088.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio metschnikovii CIP
           69.14]
 gi|260612311|gb|EEX37514.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio metschnikovii CIP
           69.14]
          Length = 112

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 74/109 (67%), Gaps = 3/109 (2%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            Y+  H    H  G+ K+ L+GF+ S++LT+IPF +VM           + I++CA+AQI
Sbjct: 4   SYEQTHGGQAH--GSVKEYLLGFLYSVLLTLIPFAMVMADIG-SPTTKVVVILICAVAQI 60

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +V LVFFLHM+T  E  W+++  +F++++VAI  VGSMW+M HLN+NM+
Sbjct: 61  LVQLVFFLHMNTSSEQAWNVITAVFSVVIVAIVLVGSMWIMQHLNHNML 109


>gi|146310557|ref|YP_001175631.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter sp. 638]
 gi|145317433|gb|ABP59580.1| cytochrome bo3 quinol oxidase subunit 4 [Enterobacter sp. 638]
          Length = 108

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   +++ A+ Q
Sbjct: 1   MSHSNDHGA---SHGSVKTYMTGFILSIILTVIPFWMVMNGS-ASKPVLLGVVLVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW+I A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNITAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|260221199|emb|CBA29525.1| Cytochrome o ubiquinol oxidase protein cyoD [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 148

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 71/108 (65%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D+ H+     + T    + GF+LS+ILT IPF +VM     D+    L +   A+ QI+V
Sbjct: 18  DDGHHAANEPHSTFSGYMTGFVLSIILTAIPFWLVMAKVITDRPTAVLVLGGFAVVQILV 77

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           H+V+FLHM+ K+E GW++++ IFT++ VAI   G++WVM+H+N NMM 
Sbjct: 78  HMVYFLHMNGKIEGGWTLLSTIFTVVFVAIAITGTLWVMFHMNANMMP 125


>gi|242240301|ref|YP_002988482.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech703]
 gi|242132358|gb|ACS86660.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech703]
          Length = 110

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 80/104 (76%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +  S+G+ K  L+GF+LS+ILT+IPF +VM G     +I+ LT++ CA+ QI+VHLV
Sbjct: 6   HDHSGASHGSVKSYLMGFVLSIILTVIPFSMVMNGT-TAHSIILLTVLGCAVVQILVHLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH++T  E+ W+++A++FT++++AI  VGS+W+M   ++NMM
Sbjct: 65  YFLHLNTASEERWNVVAIVFTVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|45440613|ref|NP_992152.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595299|ref|YP_069490.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808652|ref|YP_652568.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis Antiqua]
 gi|108811089|ref|YP_646856.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|145600061|ref|YP_001164137.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides F]
 gi|149364987|ref|ZP_01887022.1| cytochrome O ubiquinol oxidase subunit [Yersinia pestis CA88-4125]
 gi|153949808|ref|YP_001402061.1| cytochrome O ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 31758]
 gi|162420623|ref|YP_001607429.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis Angola]
 gi|165935892|ref|ZP_02224462.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011041|ref|ZP_02231939.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212919|ref|ZP_02238954.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167423433|ref|ZP_02315186.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469782|ref|ZP_02334486.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis FV-1]
 gi|170025461|ref|YP_001721966.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis YPIII]
 gi|186894316|ref|YP_001871428.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930197|ref|YP_002348072.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis CO92]
 gi|229838772|ref|ZP_04458931.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896074|ref|ZP_04511244.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides A]
 gi|229899340|ref|ZP_04514483.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901316|ref|ZP_04516438.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|294504897|ref|YP_003568959.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Z176003]
 gi|45435470|gb|AAS61029.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588581|emb|CAH20189.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774737|gb|ABG17256.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Nepal516]
 gi|108780565|gb|ABG14623.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Antiqua]
 gi|115348808|emb|CAL21762.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis CO92]
 gi|145211757|gb|ABP41164.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Pestoides F]
 gi|149291400|gb|EDM41474.1| cytochrome O ubiquinol oxidase subunit [Yersinia pestis CA88-4125]
 gi|152961303|gb|ABS48764.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia
           pseudotuberculosis IP 31758]
 gi|162353438|gb|ABX87386.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis Angola]
 gi|165916037|gb|EDR34644.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165990041|gb|EDR42342.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205706|gb|EDR50186.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167057603|gb|EDR67349.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751995|gb|ACA69513.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis YPIII]
 gi|186697342|gb|ACC87971.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681245|gb|EEO77339.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|229687742|gb|EEO79815.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695138|gb|EEO85185.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700997|gb|EEO89026.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides A]
 gi|262362963|gb|ACY59684.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           D106004]
 gi|262366882|gb|ACY63439.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           D182038]
 gi|294355356|gb|ADE65697.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Z176003]
 gi|320016354|gb|ADV99925.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 110

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 77/107 (71%), Gaps = 4/107 (3%)

Query: 7   HNMNMH---SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           H+   H   S+G+ K  ++GF+LS+ILT+IPF +VM G         LT+V  A+ QI+V
Sbjct: 3   HSTTTHGGASHGSLKSYIIGFVLSVILTVIPFVMVMSGT-ASYTTTLLTVVGLAVVQIVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV+FLHM+T  E+ W+++A++FT +++AI  VGS+W+MY+LN NMM
Sbjct: 62  HLVYFLHMNTSSEERWNLVALLFTAMIIAIVVVGSLWIMYNLNINMM 108


>gi|16126014|ref|NP_420578.1| ubiquinol oxidase subunit IV [Caulobacter crescentus CB15]
 gi|221234785|ref|YP_002517221.1| quinol cytochrome oxidase polypeptide IV [Caulobacter crescentus
           NA1000]
 gi|13423196|gb|AAK23746.1| ubiquinol oxidase subunit IV [Caulobacter crescentus CB15]
 gi|220963957|gb|ACL95313.1| quinol cytochrome oxidase polypeptide IV [Caulobacter crescentus
           NA1000]
          Length = 129

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 79/118 (66%), Gaps = 2/118 (1%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D   + +  ++GT K  ++GF+L++ILT IPF +VM        +  + ++  A+ Q+
Sbjct: 10  PHDEHGDAHEAAHGTLKDYVIGFVLAVILTAIPFWLVMGDVLPSAQMTAVAVMGLAVIQV 69

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS--MEGMRS 117
           +VH+++FLHM+T+ E GW+++A+IFT+I+V I   GS+WVM++LN +MM   M  MR 
Sbjct: 70  VVHMIYFLHMNTRSEGGWTMLALIFTLILVVITLAGSLWVMHNLNTHMMPEMMPDMRQ 127


>gi|50085513|ref|YP_047023.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ADP1]
 gi|49531489|emb|CAG69201.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ADP1]
          Length = 108

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  +GFILS++LTIIPFG+VM G F  + ++   I + A+AQ
Sbjct: 1   MSHD--HNSAGASHGNFKQYTIGFILSVVLTIIPFGMVMAGGF-GRGLLMTVIGITAVAQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LVFFLHM+T  E  W+++A I+T++ +AI  VGS+W+M +L+ NMM
Sbjct: 58  VLVQLVFFLHMNTSSEQRWNLIAFIYTVLCIAILLVGSVWIMNYLHFNMM 107


>gi|255319502|ref|ZP_05360716.1| cytOchrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SK82]
 gi|262378474|ref|ZP_06071631.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SH164]
 gi|255303442|gb|EET82645.1| cytOchrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SK82]
 gi|262299759|gb|EEY87671.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SH164]
          Length = 123

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    ++G  KQ  +GFILS+ILTIIPFG+VM G F ++ ++   I + A AQ
Sbjct: 16  MSHD--HNSAGAAHGNFKQYTIGFILSVILTIIPFGMVMSGGF-ERGLLVTVIAITAAAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LVFFLHM+   E  W+++A I+T++ +AI  VGS+W+M +L+ NMM
Sbjct: 73  VLVQLVFFLHMNASSEQRWNVIAFIYTVLCIAILLVGSVWIMNYLHFNMM 122


>gi|332160740|ref|YP_004297317.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604619|emb|CBY26117.1| cytochrome O ubiquinol oxidase subunit IV [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664970|gb|ADZ41614.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859963|emb|CBX70292.1| cytochrome o ubiquinol oxidase protein cyoD [Yersinia
           enterocolitica W22703]
          Length = 115

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/107 (48%), Positives = 76/107 (71%), Gaps = 4/107 (3%)

Query: 7   HNMNMH---SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           H+   H   S+G+ K  ++GFILS+ILT+IPF +VM G      I+  T+V  A+ QIIV
Sbjct: 8   HSTTTHGGASHGSLKSYIIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIV 66

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV+FLHM+   E+ W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 67  HLVYFLHMNGSSEERWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 113


>gi|319786908|ref|YP_004146383.1| cytochrome o ubiquinol oxidase subunit IV [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465420|gb|ADV27152.1| cytochrome o ubiquinol oxidase subunit IV [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 139

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 71/99 (71%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ +  ++GF+LS+ILT IPF +VM     D+    L I+  A+ QI+V +V+FLHM+
Sbjct: 30  AHGSMRDYVIGFVLSVILTAIPFWLVMGNVIQDQGTTALVILGFAVVQIVVQMVYFLHMN 89

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            + E GW+++A++FT+++V I   GS+WVM+H+N NMM 
Sbjct: 90  ARSEGGWNMLALMFTVVLVVIVLAGSLWVMHHMNANMMP 128


>gi|300715583|ref|YP_003740386.1| cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Erwinia billingiae Eb661]
 gi|299061419|emb|CAX58531.1| Cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Erwinia billingiae Eb661]
          Length = 109

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 51/107 (47%), Positives = 79/107 (73%), Gaps = 3/107 (2%)

Query: 7   HNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           H+ N H  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + IV CAI Q++VH
Sbjct: 3   HSTNEHGASHGSVKSYMIGFILSIILTAIPFWMVMDGGASKATILGVVIV-CAIVQVLVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLH++T  E+ W+++A++F+ I++ I  VGS+W+M++LN NMM+
Sbjct: 62  LVYFLHLNTSSEERWNLVAIVFSAIIILIVVVGSLWIMWNLNYNMMA 108


>gi|270263562|ref|ZP_06191831.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera
           4Rx13]
 gi|270042446|gb|EFA15541.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera
           4Rx13]
          Length = 112

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM G      I+ + +V  A+ Q+IVHL++FLHM+
Sbjct: 14  SHGSVKSYLIGFILSIILTVIPFAMVMSGTASHSTILAV-VVGMAVIQVIVHLIYFLHMN 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 73  TSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|241663143|ref|YP_002981503.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|309781939|ref|ZP_07676670.1| ubiquinol oxidase subunit IV [Ralstonia sp. 5_7_47FAA]
 gi|240865170|gb|ACS62831.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|308919283|gb|EFP64949.1| ubiquinol oxidase subunit IV [Ralstonia sp. 5_7_47FAA]
          Length = 141

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 67/99 (67%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    L GF+LS+ LT IPF +VM   F   +   +TI+L    QI+VH++FFLHM+
Sbjct: 26  PHATLGGYLTGFVLSVFLTAIPFWLVMANVFDRSSTTAVTILLIGAVQIVVHMIFFLHMN 85

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            K E GW++++++FT+++V I   GS+WVMYHLN NMM 
Sbjct: 86  AKSEGGWNMLSLMFTLVLVVITLSGSLWVMYHLNTNMMP 124


>gi|307545742|ref|YP_003898221.1| cytochrome O ubiquinol oxidase cyoD [Halomonas elongata DSM 2581]
 gi|307217766|emb|CBV43036.1| K02300 cytochrome o ubiquinol oxidase operon protein cyoD
           [Halomonas elongata DSM 2581]
          Length = 109

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           HS+G+ K  +VG ILS++LTIIPFG+VM G F       L IV  A+AQ++V L+ F+HM
Sbjct: 10  HSHGSVKSYVVGLILSIVLTIIPFGVVMTGSF-GTPATVLIIVATAVAQVLVQLILFMHM 68

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +TK ++GW+ M+ +FT+ ++ +   GS+W+MY+L+ NMM
Sbjct: 69  NTKADEGWNFMSFVFTVSILVLIIGGSVWIMYNLHQNMM 107


>gi|120610894|ref|YP_970572.1| cytochrome C oxidase subunit IV [Acidovorax citrulli AAC00-1]
 gi|120589358|gb|ABM32798.1| cytochrome bo3 quinol oxidase subunit 4 [Acidovorax citrulli
           AAC00-1]
          Length = 142

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 70/105 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    +VGF+LS+ILT IPF +VM     D+N   L +   A+ QI+VH+V FLHM+
Sbjct: 25  PHSTFSGYMVGFVLSVILTAIPFWLVMAKVISDRNTAVLVLGAFAVVQILVHMVCFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            KVE GW++++ IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 85  GKVEGGWTMLSTIFTVVFVAIAIAGTLWVMFHMNTNMMPEHTMPA 129


>gi|103486990|ref|YP_616551.1| cytochrome C oxidase subunit IV [Sphingopyxis alaskensis RB2256]
 gi|98977067|gb|ABF53218.1| cytochrome C oxidase subunit IV [Sphingopyxis alaskensis RB2256]
          Length = 128

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T +  ++GF+LS+ILT IPF +VM    L        I+  A+ QI+VH+VFFLHM+
Sbjct: 17  PHATMRDYVIGFVLSVILTAIPFWLVMT-MPLSAGTTGAIIMAFAVVQIVVHMVFFLHMT 75

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            K E GWS+ +++FT+I+V I   GS+WVM+HLN NMM M 
Sbjct: 76  PKAEGGWSLTSLVFTVIVVVIMLAGSLWVMHHLNTNMMPMP 116


>gi|261341030|ref|ZP_05968888.1| cytochrome o ubiquinol oxidase, subunit IV [Enterobacter
           cancerogenus ATCC 35316]
 gi|296101550|ref|YP_003611696.1| cytochrome o ubiquinol oxidase operon protein cyoD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|288316895|gb|EFC55833.1| cytochrome o ubiquinol oxidase, subunit IV [Enterobacter
           cancerogenus ATCC 35316]
 gi|295056009|gb|ADF60747.1| cytochrome o ubiquinol oxidase operon protein cyoD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 108

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   I++ A+ Q
Sbjct: 1   MSHSNDHGA---SHGSVKTYMTGFILSIILTVIPFWMVMSGS-ASKPVILGAILVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNMTAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|295096783|emb|CBK85873.1| cytochrome bo3 quinol oxidase subunit 4 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 108

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   I++ A+ Q
Sbjct: 1   MSHSNDHGA---SHGSVKTYMTGFILSIILTVIPFWMVMNGS-ASKPVILGAILVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNMTAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|152980590|ref|YP_001354327.1| cytochrome o ubiquinol oxidase operon protein [Janthinobacterium
           sp. Marseille]
 gi|151280667|gb|ABR89077.1| cytochrome o ubiquinol oxidase operon protein [Janthinobacterium
           sp. Marseille]
          Length = 149

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K   +GFILS+ILT IPF +VM   F   +     I+  A  QI+VH+V+FLHM+TK E 
Sbjct: 30  KSYTIGFILSVILTAIPFWLVMGKVFDSSSTTAFVILGFAAVQIVVHMVYFLHMNTKSEG 89

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           GWS++ +IFTI++V I   GS+WVMYH+N+NMM 
Sbjct: 90  GWSMLGLIFTIMVVVIMLAGSIWVMYHMNHNMMP 123


>gi|220924640|ref|YP_002499942.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           nodulans ORS 2060]
 gi|219949247|gb|ACL59639.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           nodulans ORS 2060]
          Length = 130

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 69/104 (66%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T +  + GF+LS ILT IPF +VM     D+    + ++  A+ QI+VH+V+FLHM+T+ 
Sbjct: 24  TFEGYVTGFVLSAILTAIPFWLVMANVLDDRVQTTIAVLAFAVIQIVVHMVYFLHMNTRS 83

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           E GW+++A+IFT+ +V I   GS+WVM+HLN NMM +      H
Sbjct: 84  EGGWTVLALIFTVTLVVITLTGSIWVMHHLNTNMMPLSAEHVRH 127


>gi|187928955|ref|YP_001899442.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|187725845|gb|ACD27010.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
          Length = 142

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 67/99 (67%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    L GF+LS+ LT IPF +VM   F   +   +TI+L    QI+VH+++FLHM+
Sbjct: 26  PHATLGGYLTGFVLSVFLTAIPFWLVMANVFDRSSTTAVTILLIGAVQIVVHMIYFLHMN 85

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            K E GW++++++FT+++V I   GS+WVMYHLN NMM 
Sbjct: 86  AKSEGGWNMLSLMFTLVLVVITLSGSLWVMYHLNTNMMP 124


>gi|253990904|ref|YP_003042260.1| cytochrome o ubiquinol oxidase subunit IV [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782354|emb|CAQ85518.1| cyoD; Cytochrome O ubiquinol oxidase protein cyoD (Ubiquinol
           oxidase chain D) [Photorhabdus asymbiotica]
          Length = 110

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V  A+ QI+VH ++FLHM+
Sbjct: 12  SHGSLKSYVIGFVLSVILTVIPFWMVMDGSASHTTILT-TVVALAVVQILVHFIYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FTI+++ I  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNLVALLFTILIIGIVVVGSLWIMYNLNINMM 108


>gi|157369330|ref|YP_001477319.1| cytochrome o ubiquinol oxidase subunit IV [Serratia proteamaculans
           568]
 gi|157321094|gb|ABV40191.1| Cytochrome o ubiquinol oxidase subunit IV [Serratia proteamaculans
           568]
          Length = 112

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM G      I+ + +V  A+ Q++VHL++FLHM+
Sbjct: 14  SHGSVKTYLIGFILSIILTVIPFAMVMSGTASHSTILAV-VVGMAVIQVVVHLIYFLHMN 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 73  TSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|304395491|ref|ZP_07377374.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. aB]
 gi|308185899|ref|YP_003930030.1| Cytochrome o ubiquinol oxidase protein cyoD [Pantoea vagans C9-1]
 gi|304356785|gb|EFM21149.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. aB]
 gi|308056409|gb|ADO08581.1| Cytochrome o ubiquinol oxidase protein cyoD [Pantoea vagans C9-1]
          Length = 109

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 79/107 (73%), Gaps = 3/107 (2%)

Query: 7   HNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           H++N H  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V CA+ Q++VH
Sbjct: 3   HSVNEHGASHGSVKSYMIGFILSIILTAIPFWMVMDGSASHGTILGVVLV-CAVIQVLVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLH+ +K E GW+++A++F+ I++ I  VGS+W+M++LN NMM 
Sbjct: 62  LVYFLHLDSKSEGGWNMVAIVFSAIIILIVVVGSLWIMWNLNYNMMP 108


>gi|304414866|ref|ZP_07395784.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Regiella
           insecticola LSR1]
 gi|304283135|gb|EFL91549.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Regiella
           insecticola LSR1]
          Length = 108

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/99 (50%), Positives = 72/99 (72%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+LS+ILT+IPF +VM        ++  T+V  AI QIIVHLV+FLHM+
Sbjct: 11  SHGSLKSYLIGFVLSIILTVIPFAMVMSNT-ASHTLILTTVVALAIVQIIVHLVYFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
              E+ W++ A +FTI+++AI  VGS+W+MY+LN NMM 
Sbjct: 70  GSSEERWNLGAFLFTILVIAIIVVGSLWIMYNLNINMMP 108


>gi|271499589|ref|YP_003332614.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech586]
 gi|270343144|gb|ACZ75909.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech586]
          Length = 110

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+LS+ILT+IPFG+VM        I+ LT++ CA+ QI+VHLV+FLH++
Sbjct: 12  SHGSVKSYLIGFVLSIILTVIPFGLVMNSSASHSAIL-LTVLGCAVIQILVHLVYFLHLN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 71  TSSEERWNLVAIVFTALIIAIVVVGSIWIMMNAHHNMM 108


>gi|253687435|ref|YP_003016625.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754013|gb|ACT12089.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 110

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM G     N +  T+V CA+ QI+VHLV+FLH++
Sbjct: 12  SHGSVKSYVIGFVLSVILTVIPFSMVMSGT-ASHNAILFTVVGCAVVQILVHLVYFLHLN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 71  TSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|50120079|ref|YP_049246.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           atrosepticum SCRI1043]
 gi|261822515|ref|YP_003260621.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium wasabiae
           WPP163]
 gi|49610605|emb|CAG74050.1| cytochrome O ubiquinol oxidase subunit IV [Pectobacterium
           atrosepticum SCRI1043]
 gi|261606528|gb|ACX89014.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium wasabiae
           WPP163]
          Length = 110

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM G     N +  T+V CA+ QI+VHLV+FLH++
Sbjct: 12  SHGSVKSYVIGFVLSVILTVIPFSMVMSGT-ASHNAILFTVVGCAVVQILVHLVYFLHLN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 71  TSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|300311776|ref|YP_003775868.1| ubiquinol oxidase subunit IV protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074561|gb|ADJ63960.1| ubiquinol oxidase subunit IV protein [Herbaspirillum seropedicae
           SmR1]
          Length = 158

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L++ILT IPF +VM         M + ++  A  QI+VH+ +FLHM+ K 
Sbjct: 33  TMKDYVTGFVLAVILTAIPFWLVMNKSISSSATMGIVLLALAAVQIVVHIKYFLHMNGKS 92

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           E GW+++AMIFTI++V I   GS+WVMYHLN+NMM 
Sbjct: 93  EGGWNMLAMIFTIVIVVITLAGSLWVMYHLNHNMMP 128


>gi|226329082|ref|ZP_03804600.1| hypothetical protein PROPEN_02985 [Proteus penneri ATCC 35198]
 gi|225202268|gb|EEG84622.1| hypothetical protein PROPEN_02985 [Proteus penneri ATCC 35198]
          Length = 110

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ QI+VHLV FLHM+
Sbjct: 12  SHGSMKSYLIGFILSVILTVIPFWMVMEGTATPATILW-TVVGMAVVQIVVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A +FT++++ I  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNVVAFLFTLLIIGIVVVGSLWIMYNLNINMM 108


>gi|238897313|ref|YP_002922990.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465068|gb|ACQ66842.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 132

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 72/96 (75%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ K  +VGFILS++LT+IPF +VM      + ++  T++  A+ QIIVHLV+FLHM+  
Sbjct: 36  GSLKSYVVGFILSVMLTVIPFMMVMNQS-ASRTVILATVIATAVVQIIVHLVYFLHMNGA 94

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E+ W+++A IFT+I++AI  VGS+W+M+HLN NMM
Sbjct: 95  SEERWNLVAFIFTVIIIAIVLVGSLWIMHHLNINMM 130


>gi|326317721|ref|YP_004235393.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323374557|gb|ADX46826.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 144

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 70/105 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    +VGF+LS+ILT IPF +VM     D++   L +   A+ QI+VH+V FLHM+
Sbjct: 27  PHSTFSGYMVGFVLSIILTAIPFWLVMAKVISDRSTAVLVLGAFAVVQILVHMVCFLHMN 86

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            KVE GW++++ IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 87  GKVEGGWTMLSTIFTVVFVAIAIAGTLWVMFHMNTNMMPEHNMPA 131


>gi|197284017|ref|YP_002149889.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis HI4320]
 gi|227358113|ref|ZP_03842454.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis ATCC
           29906]
 gi|194681504|emb|CAR40376.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis HI4320]
 gi|227161449|gb|EEI46486.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis ATCC
           29906]
          Length = 110

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ QI+VHLV FLHM+
Sbjct: 12  SHGSMKSYLIGFILSVILTVIPFWMVMEGTATTSTILW-TVVGMAVVQIVVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 71  TSSEERWNVIAFLFTLLIIGIVVIGSLWIMYNLNINMM 108


>gi|322834054|ref|YP_004214081.1| cytochrome o ubiquinol oxidase subunit IV [Rahnella sp. Y9602]
 gi|321169255|gb|ADW74954.1| cytochrome o ubiquinol oxidase subunit IV [Rahnella sp. Y9602]
          Length = 110

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K   +GFILS+ILT+IPF +VM       +++  T+V  AI QI+VHLVFFLHM+
Sbjct: 12  SHGSLKSYAIGFILSVILTVIPFAMVMTDT-ASHSLILGTVVASAIIQIVVHLVFFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNLVALLFTAVIIFIVVVGSLWIMYNLNLNMM 108


>gi|116694973|ref|YP_729184.1| bo3-type chinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113529472|emb|CAJ95819.1| bo3-type chinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 141

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 76/112 (67%), Gaps = 1/112 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ ++  + T    L GF+LS+ LT IPF +VM   F   +   + I+L    QI+VH++
Sbjct: 17  HDEDVGPHATLGGYLTGFVLSVFLTAIPFWLVMGKVFDKSSTTAIVILLIGAVQIVVHMI 76

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM-SMEGMRS 117
           +FLHM+ + E GW++++++FT+++V I   GS+WVM+HLN+NMM +M+  R+
Sbjct: 77  YFLHMNARSEGGWNMLSLMFTLVLVVITLTGSLWVMFHLNSNMMPTMQHERT 128


>gi|134095867|ref|YP_001100942.1| cytochrome o ubiquinol oxidase subunit IV [Herminiimonas
           arsenicoxydans]
 gi|133739770|emb|CAL62821.1| Cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Herminiimonas arsenicoxydans]
          Length = 136

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K   +GFILS+ILT IPF +VM     D     L I+  A  QI+VH+++FLHM+TK E 
Sbjct: 26  KSYAIGFILSVILTAIPFWMVMNDVLKDSGTTGLVILGFAAVQIVVHMIYFLHMNTKSEG 85

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           GWS++A+IFT+++V I   GS+WVMYH+N NMM 
Sbjct: 86  GWSMLALIFTVVIVVIVLAGSLWVMYHMNTNMMP 119


>gi|227113457|ref|ZP_03827113.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227327520|ref|ZP_03831544.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 110

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V CA+ QI+VHLV+FLH++
Sbjct: 12  SHGSVKSYVIGFVLSVILTVIPFSMVMSGTASHSAIL-FTVVGCAVVQILVHLVYFLHLN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 71  TSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|283784255|ref|YP_003364120.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter rodentium
           ICC168]
 gi|282947709|emb|CBG87264.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter rodentium
           ICC168]
          Length = 109

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSNDHGGA--SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPGVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|332094584|gb|EGI99630.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii 5216-82]
          Length = 109

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMIGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|91209498|ref|YP_539484.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UTI89]
 gi|110640689|ref|YP_668417.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 536]
 gi|215485510|ref|YP_002327941.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O127:H6
           str. E2348/69]
 gi|218557338|ref|YP_002390251.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli S88]
 gi|218688292|ref|YP_002396504.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ED1a]
 gi|237707577|ref|ZP_04538058.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp.
           3_2_53FAA]
 gi|300997384|ref|ZP_07181724.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           200-1]
 gi|91071072|gb|ABE05953.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           UTI89]
 gi|110342281|gb|ABG68518.1| cytochrome O ubiquinol oxidase C subunit [Escherichia coli 536]
 gi|215263582|emb|CAS07912.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O127:H6
           str. E2348/69]
 gi|218364107|emb|CAR01772.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli S88]
 gi|218425856|emb|CAR06662.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ED1a]
 gi|222032224|emb|CAP74963.1| Cytochrome o ubiquinol oxidase protein cyoD [Escherichia coli LF82]
 gi|226898787|gb|EEH85046.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp.
           3_2_53FAA]
 gi|281177599|dbj|BAI53929.1| cytochrome O ubiquinol oxidase subunit IV [Escherichia coli SE15]
 gi|294494005|gb|ADE92761.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           IHE3034]
 gi|300304203|gb|EFJ58723.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           200-1]
 gi|307628102|gb|ADN72406.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UM146]
 gi|312945006|gb|ADR25833.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315289856|gb|EFU49246.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           110-3]
 gi|315299551|gb|EFU58799.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           16-3]
 gi|323952959|gb|EGB48827.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H252]
 gi|323958622|gb|EGB54325.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H263]
 gi|324010059|gb|EGB79278.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           57-2]
 gi|324010689|gb|EGB79908.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           60-1]
          Length = 109

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|260426875|ref|ZP_05780854.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
 gi|260421367|gb|EEX14618.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
          Length = 128

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/115 (41%), Positives = 75/115 (65%), Gaps = 7/115 (6%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H +GT  Q ++GF L+ ILTIIPF +VM    L +  +   I+     QIIVHLV+FLH+
Sbjct: 10  HGHGTMGQLMIGFALAAILTIIPFFLVMVDTGLSRTALVGIIMGLGAVQIIVHLVYFLHL 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS-------MEGMRSIH 119
           ++  E+GW+++A +F+++++ I   GS+WVM+++N NMM        ME MRS+ 
Sbjct: 70  NSSSEEGWTLLASMFSVVILVIVLAGSLWVMHNMNENMMPMPDMDRHMEQMRSLQ 124


>gi|170767810|ref|ZP_02902263.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia albertii
           TW07627]
 gi|170123298|gb|EDS92229.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia albertii
           TW07627]
          Length = 109

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILVMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|121595099|ref|YP_986995.1| cytochrome C oxidase subunit IV [Acidovorax sp. JS42]
 gi|120607179|gb|ABM42919.1| cytochrome bo3 quinol oxidase subunit 4 [Acidovorax sp. JS42]
          Length = 142

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 71/96 (73%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           TK   + GFIL++ILT+IPF +VM     +++   L + + A+ Q++VH+V+FLHM+ K+
Sbjct: 26  TKGDYVKGFILAVILTVIPFALVMGDVIQNRSTAVLVLGIFAMVQVVVHMVYFLHMNGKI 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           + GW++++ IFTI+ +A+  +G++WVM+H+N NMM 
Sbjct: 86  QGGWTMLSTIFTIVFLAVTIIGTLWVMFHMNANMMP 121


>gi|320540328|ref|ZP_08039980.1| cytochrome o ubiquinol oxidase subunit IV [Serratia symbiotica str.
           Tucson]
 gi|320029648|gb|EFW11675.1| cytochrome o ubiquinol oxidase subunit IV [Serratia symbiotica str.
           Tucson]
          Length = 112

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM        I+ + +V  A+ Q++VHL++FLHM+
Sbjct: 14  SHGSVKSYLIGFILSIILTVIPFAMVMNDSASHATILAV-VVGTAVIQVLVHLIYFLHMN 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 73  TSSEERWNLVALLFTAMVIGIVVVGSLWIMYNLNINMM 110


>gi|26246435|ref|NP_752474.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli CFT073]
 gi|227884562|ref|ZP_04002367.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 83972]
 gi|300988018|ref|ZP_07178498.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           45-1]
 gi|301049630|ref|ZP_07196581.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           185-1]
 gi|26106833|gb|AAN79018.1|AE016756_201 Cytochrome O ubiquinol oxidase protein cyoD [Escherichia coli
           CFT073]
 gi|227838648|gb|EEJ49114.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 83972]
 gi|300298623|gb|EFJ55008.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           185-1]
 gi|300407570|gb|EFJ91108.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           45-1]
 gi|307552335|gb|ADN45110.1| cytochrome o ubiquinol oxidase protein CyoD [Escherichia coli ABU
           83972]
 gi|315294192|gb|EFU53543.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           153-1]
          Length = 109

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|293392553|ref|ZP_06636873.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera DSM
           4582]
 gi|291424955|gb|EFE98164.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera DSM
           4582]
          Length = 112

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+ + K  ++GFILS+ILT+IPF +VM G      I+ + +V  A+ Q+IVHLV+FLHM+
Sbjct: 14  SHSSVKSYVIGFILSVILTVIPFSMVMSGTASHATILAV-VVGMAVIQVIVHLVYFLHMN 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 73  TSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|306813105|ref|ZP_07447298.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli NC101]
 gi|331656484|ref|ZP_08357446.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA206]
 gi|305853868|gb|EFM54307.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli NC101]
 gi|331054732|gb|EGI26741.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA206]
          Length = 109

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|325291581|ref|YP_004277445.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium sp. H13-3]
 gi|325059434|gb|ADY63125.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium sp. H13-3]
          Length = 131

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 69/97 (71%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  ++GF++S+ILT IPF +VM     +K ++ + I+   + QI VH+++FLHM TK 
Sbjct: 26  TFKSYMIGFVMSVILTAIPFWLVMGDVLENKTLLVIAIMGLGVIQIFVHMIYFLHMDTKS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           E GW+ MA+IFT++++ I   GS+WVMY++N NMM +
Sbjct: 86  EGGWTFMALIFTVVVLLITLSGSLWVMYNMNKNMMPL 122


>gi|160899494|ref|YP_001565076.1| cytochrome o ubiquinol oxidase subunit IV [Delftia acidovorans
           SPH-1]
 gi|160365078|gb|ABX36691.1| cytochrome o ubiquinol oxidase subunit IV [Delftia acidovorans
           SPH-1]
          Length = 146

 Score = 97.1 bits (240), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 66/95 (69%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GF+LS+ILT IPF +VM     D+    + +   A+ QI+VH+VFFLHM+ K+E GW+++
Sbjct: 39  GFVLSIILTAIPFWLVMSNVISDRATAVMVLGGFAVVQILVHMVFFLHMNGKIEGGWTLL 98

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           + IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 99  STIFTVVFVAIGIAGTLWVMFHMNTNMMPQHTMPA 133


>gi|15800159|ref|NP_286171.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           EDL933]
 gi|15829737|ref|NP_308510.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. Sakai]
 gi|16128414|ref|NP_414963.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24111811|ref|NP_706321.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 301]
 gi|30061928|ref|NP_836099.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|74311004|ref|YP_309423.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei Ss046]
 gi|82542917|ref|YP_406864.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii Sb227]
 gi|89107299|ref|AP_001079.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. W3110]
 gi|110804456|ref|YP_687976.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 5 str.
           8401]
 gi|157157013|ref|YP_001461615.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           E24377A]
 gi|157159954|ref|YP_001457272.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli HS]
 gi|168749891|ref|ZP_02774913.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4113]
 gi|168756971|ref|ZP_02781978.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4401]
 gi|168761635|ref|ZP_02786642.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4501]
 gi|168776265|ref|ZP_02801272.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4196]
 gi|168800312|ref|ZP_02825319.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC508]
 gi|170021199|ref|YP_001726153.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ATCC
           8739]
 gi|170080015|ref|YP_001729335.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170683697|ref|YP_001742570.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           SMS-3-5]
 gi|188496374|ref|ZP_03003644.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 53638]
 gi|191166691|ref|ZP_03028518.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B7A]
 gi|193065222|ref|ZP_03046295.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli E22]
 gi|195938504|ref|ZP_03083886.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EC4024]
 gi|208815375|ref|ZP_03256554.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4045]
 gi|209395894|ref|YP_002269075.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4115]
 gi|209917645|ref|YP_002291729.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli SE11]
 gi|218549903|ref|YP_002383694.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ATCC 35469]
 gi|218552995|ref|YP_002385908.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI1]
 gi|218693892|ref|YP_002401559.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 55989]
 gi|218698659|ref|YP_002406288.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI39]
 gi|218703712|ref|YP_002411231.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UMN026]
 gi|238899717|ref|YP_002925513.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli BW2952]
 gi|253774583|ref|YP_003037414.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160498|ref|YP_003043606.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B str.
           REL606]
 gi|254791613|ref|YP_003076450.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. TW14359]
 gi|256020399|ref|ZP_05434264.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sp. D9]
 gi|256023954|ref|ZP_05437819.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp. 4_1_40B]
 gi|260842630|ref|YP_003220408.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O103:H2
           str. 12009]
 gi|260853652|ref|YP_003227543.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O26:H11
           str. 11368]
 gi|260866590|ref|YP_003232992.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O111:H-
           str. 11128]
 gi|261223910|ref|ZP_05938191.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261256376|ref|ZP_05948909.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. FRIK966]
 gi|291281336|ref|YP_003498154.1| Cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403549|ref|ZP_06647640.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1412]
 gi|293408578|ref|ZP_06652417.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B354]
 gi|293413684|ref|ZP_06656333.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B185]
 gi|293418499|ref|ZP_06660934.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B088]
 gi|297516402|ref|ZP_06934788.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli OP50]
 gi|298379161|ref|ZP_06989042.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1302]
 gi|300818242|ref|ZP_07098453.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           107-1]
 gi|300820328|ref|ZP_07100480.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           119-7]
 gi|300900497|ref|ZP_07118664.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           198-1]
 gi|300903306|ref|ZP_07121234.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           84-1]
 gi|300918190|ref|ZP_07134797.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           115-1]
 gi|300924154|ref|ZP_07140146.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           182-1]
 gi|300930271|ref|ZP_07145684.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           187-1]
 gi|300957994|ref|ZP_07170159.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           175-1]
 gi|301022580|ref|ZP_07186452.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           69-1]
 gi|301301577|ref|ZP_07207712.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           124-1]
 gi|301330705|ref|ZP_07223307.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           78-1]
 gi|301647352|ref|ZP_07247164.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           146-1]
 gi|307137072|ref|ZP_07496428.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H736]
 gi|307312193|ref|ZP_07591829.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|309794841|ref|ZP_07689262.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           145-7]
 gi|331661808|ref|ZP_08362731.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA143]
 gi|331666783|ref|ZP_08367657.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA271]
 gi|331681823|ref|ZP_08382456.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H299]
 gi|78099997|sp|P0ABJ7|CYOD_ECO57 RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|78099998|sp|P0ABJ6|CYOD_ECOLI RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|78099999|sp|P0ABJ8|CYOD_SHIFL RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|12513288|gb|AAG54779.1|AE005222_4 cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EDL933]
 gi|145655|gb|AAA23634.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|1786632|gb|AAC73532.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13359940|dbj|BAB33906.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. Sakai]
 gi|24050601|gb|AAN42028.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 301]
 gi|30040172|gb|AAP15905.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|73854481|gb|AAZ87188.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei Ss046]
 gi|81244328|gb|ABB65036.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii Sb227]
 gi|85674569|dbj|BAE76209.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K12 substr. W3110]
 gi|110614004|gb|ABF02671.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 5 str.
           8401]
 gi|157065634|gb|ABV04889.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli HS]
 gi|157079043|gb|ABV18751.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E24377A]
 gi|169756127|gb|ACA78826.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ATCC
           8739]
 gi|169887850|gb|ACB01557.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170521415|gb|ACB19593.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           SMS-3-5]
 gi|187768304|gb|EDU32148.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4196]
 gi|188015898|gb|EDU54020.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4113]
 gi|188491573|gb|EDU66676.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 53638]
 gi|189356033|gb|EDU74452.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4401]
 gi|189368086|gb|EDU86502.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4501]
 gi|189377391|gb|EDU95807.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC508]
 gi|190903202|gb|EDV62924.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B7A]
 gi|192927196|gb|EDV81817.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli E22]
 gi|208732023|gb|EDZ80711.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4045]
 gi|209157294|gb|ACI34727.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4115]
 gi|209743934|gb|ACI70274.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743936|gb|ACI70275.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743938|gb|ACI70276.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743940|gb|ACI70277.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743942|gb|ACI70278.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209910904|dbj|BAG75978.1| cytochrome O ubiquinol oxidase subunit IV [Escherichia coli SE11]
 gi|218350624|emb|CAU96316.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 55989]
 gi|218357444|emb|CAQ90083.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ATCC 35469]
 gi|218359763|emb|CAQ97304.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI1]
 gi|218368645|emb|CAR16384.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI39]
 gi|218430809|emb|CAR11683.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UMN026]
 gi|238860710|gb|ACR62708.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli BW2952]
 gi|242376210|emb|CAQ30901.1| cytochrome bo terminal oxidase subunit IV, subunit of cytochrome bo
           terminal oxidase [Escherichia coli BL21(DE3)]
 gi|253325627|gb|ACT30229.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972399|gb|ACT38070.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B str.
           REL606]
 gi|253976609|gb|ACT42279.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           BL21(DE3)]
 gi|254591013|gb|ACT70374.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. TW14359]
 gi|257752301|dbj|BAI23803.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O26:H11
           str. 11368]
 gi|257757777|dbj|BAI29274.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O103:H2
           str. 12009]
 gi|257762946|dbj|BAI34441.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O111:H-
           str. 11128]
 gi|260450384|gb|ACX40806.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli DH1]
 gi|281599765|gb|ADA72749.1| Cytochrome O ubiquinol oxidase protein CyoD [Shigella flexneri
           2002017]
 gi|284920239|emb|CBG33298.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Escherichia coli 042]
 gi|290761209|gb|ADD55170.1| Cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           O55:H7 str. CB9615]
 gi|291325027|gb|EFE64442.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B088]
 gi|291429402|gb|EFF02422.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1412]
 gi|291433742|gb|EFF06715.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B185]
 gi|291471756|gb|EFF14239.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B354]
 gi|298280274|gb|EFI21778.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1302]
 gi|300315330|gb|EFJ65114.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           175-1]
 gi|300355978|gb|EFJ71848.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           198-1]
 gi|300397461|gb|EFJ80999.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           69-1]
 gi|300404601|gb|EFJ88139.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           84-1]
 gi|300414641|gb|EFJ97951.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           115-1]
 gi|300419607|gb|EFK02918.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           182-1]
 gi|300461843|gb|EFK25336.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           187-1]
 gi|300527113|gb|EFK48182.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           119-7]
 gi|300529133|gb|EFK50195.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           107-1]
 gi|300843074|gb|EFK70834.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           124-1]
 gi|300843366|gb|EFK71126.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           78-1]
 gi|301074497|gb|EFK89303.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           146-1]
 gi|306907695|gb|EFN38197.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|308121494|gb|EFO58756.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           145-7]
 gi|313646949|gb|EFS11406.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|315059709|gb|ADT74036.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|315135111|dbj|BAJ42270.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli DH1]
 gi|315256254|gb|EFU36222.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           85-1]
 gi|320173753|gb|EFW48936.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella dysenteriae CDC
           74-1112]
 gi|320192843|gb|EFW67483.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EC1212]
 gi|320638423|gb|EFX08137.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. G5101]
 gi|320643803|gb|EFX12926.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H-
           str. 493-89]
 gi|320649154|gb|EFX17732.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H-
           str. H 2687]
 gi|320656047|gb|EFX23963.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661197|gb|EFX28628.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320665173|gb|EFX32266.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. LSU-61]
 gi|323184741|gb|EFZ70112.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 1357]
 gi|323379726|gb|ADX51994.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli KO11]
 gi|323938614|gb|EGB34863.1| cytochrome o ubiquinol oxidase IV [Escherichia coli E1520]
 gi|323943235|gb|EGB39391.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli E482]
 gi|323945333|gb|EGB41389.1| cytochrome o ubiquinol oxidase IV [Escherichia coli H120]
 gi|323963418|gb|EGB58980.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H489]
 gi|323965115|gb|EGB60574.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli M863]
 gi|323972282|gb|EGB67492.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli TA007]
 gi|323976087|gb|EGB71180.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           TW10509]
 gi|324016711|gb|EGB85930.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           117-3]
 gi|324114656|gb|EGC08624.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           B253]
 gi|324116916|gb|EGC10829.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli E1167]
 gi|326341191|gb|EGD64983.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. 1044]
 gi|326346034|gb|EGD69773.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. 1125]
 gi|327254755|gb|EGE66371.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           STEC_7v]
 gi|331060230|gb|EGI32194.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA143]
 gi|331066007|gb|EGI37891.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA271]
 gi|331081025|gb|EGI52190.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H299]
 gi|332341792|gb|AEE55126.1| cytochrome O ubiquinol oxidase subunit IV CyoD [Escherichia coli
           UMNK88]
          Length = 109

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|326389123|ref|ZP_08210703.1| cytochrome o ubiquinol oxidase subunit IV [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206354|gb|EGD57191.1| cytochrome o ubiquinol oxidase subunit IV [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 104

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 66/96 (68%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K    GF+L++ILT+IPF +VM     DK++  L I   A  Q+IVH+++FLHM+ K E 
Sbjct: 2   KDYATGFVLAVILTVIPFYLVMTDALGDKSLTTLVIAGFAGVQVIVHMIYFLHMNAKSEG 61

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           GW+++A++FT I+V I   G  WVMYHLN+NMM M 
Sbjct: 62  GWNLLALVFTCILVFIVLSGVTWVMYHLNHNMMPMP 97


>gi|300937043|ref|ZP_07151909.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           21-1]
 gi|300457874|gb|EFK21367.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           21-1]
          Length = 109

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|110834895|ref|YP_693754.1| cytochrome o ubiquinol oxidase, protein CyoD [Alcanivorax
           borkumensis SK2]
 gi|110648006|emb|CAL17482.1| cytochrome o ubiquinol oxidase, protein CyoD [Alcanivorax
           borkumensis SK2]
          Length = 131

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 80/120 (66%), Gaps = 3/120 (2%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ HN     + + K+   GF+L++ILT+IPF +VM G F       + I+  A+ QI
Sbjct: 5   THDHDHNDADIPHVSLKEYATGFVLAVILTVIPFWLVMGGVFESSATTVMVILGFALVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS--MEGMRSIH 119
           +VH+VFFLHM+   E GW+++A++FT+I+V I   GS+WVM++LN NMM   MEG  S+H
Sbjct: 65  VVHMVFFLHMNFHSEGGWNMLALMFTLILVFITLAGSLWVMHNLNVNMMPGMMEG-ASLH 123


>gi|157146955|ref|YP_001454274.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter koseri ATCC
           BAA-895]
 gi|157084160|gb|ABV13838.1| hypothetical protein CKO_02732 [Citrobacter koseri ATCC BAA-895]
          Length = 109

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGTG-SPAVILGTILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|307293187|ref|ZP_07573033.1| cytochrome o ubiquinol oxidase subunit IV [Sphingobium
           chlorophenolicum L-1]
 gi|306881253|gb|EFN12469.1| cytochrome o ubiquinol oxidase subunit IV [Sphingobium
           chlorophenolicum L-1]
          Length = 133

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 71/99 (71%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ +  ++GF LS+ILT IPF +VM G   D  +  + I+  A  Q++VH+++FLHM+
Sbjct: 19  AHGSLRSNMIGFGLSVILTAIPFWLVMSGVLGDPQLTGVIIMGFAAVQVVVHMIYFLHMN 78

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T+VE GWS MAM+ T+++V I   GS+WVMYHLN NMM 
Sbjct: 79  TRVEGGWSFMAMMLTVVLVVIVLSGSLWVMYHLNANMMP 117


>gi|16759420|ref|NP_455037.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16763821|ref|NP_459436.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142808|ref|NP_806150.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56414404|ref|YP_151479.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62179052|ref|YP_215469.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161504383|ref|YP_001571495.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161615370|ref|YP_001589335.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167551747|ref|ZP_02345500.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167992292|ref|ZP_02573390.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232415|ref|ZP_02657473.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237552|ref|ZP_02662610.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168240264|ref|ZP_02665196.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261126|ref|ZP_02683099.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465531|ref|ZP_02699413.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818951|ref|ZP_02830951.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194446490|ref|YP_002039682.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450588|ref|YP_002044475.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470587|ref|ZP_03076571.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737366|ref|YP_002113471.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197250726|ref|YP_002145421.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264545|ref|ZP_03164619.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197363324|ref|YP_002142961.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198243661|ref|YP_002214394.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200389690|ref|ZP_03216301.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204927364|ref|ZP_03218566.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|207855920|ref|YP_002242571.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213023462|ref|ZP_03337909.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213052103|ref|ZP_03344981.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213416725|ref|ZP_03349869.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213584681|ref|ZP_03366507.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213649241|ref|ZP_03379294.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213857960|ref|ZP_03384931.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224582278|ref|YP_002636076.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238911428|ref|ZP_04655265.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289825082|ref|ZP_06544434.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25331177|pir||AC0557 cytochrome o ubiquinol oxidase C chain [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16418947|gb|AAL19395.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16501711|emb|CAD08899.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138440|gb|AAO70010.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56128661|gb|AAV78167.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62126685|gb|AAX64388.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|160865730|gb|ABX22353.1| hypothetical protein SARI_02494 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161364734|gb|ABX68502.1| hypothetical protein SPAB_03141 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405153|gb|ACF65375.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408892|gb|ACF69111.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456951|gb|EDX45790.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712868|gb|ACF92089.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195631677|gb|EDX50197.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197094801|emb|CAR60334.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197214429|gb|ACH51826.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242800|gb|EDY25420.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289479|gb|EDY28842.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197938177|gb|ACH75510.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602135|gb|EDZ00681.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204324029|gb|EDZ09224.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205323488|gb|EDZ11327.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205329509|gb|EDZ16273.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333521|gb|EDZ20285.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340021|gb|EDZ26785.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344082|gb|EDZ30846.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349794|gb|EDZ36425.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707723|emb|CAR32008.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224466805|gb|ACN44635.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261245723|emb|CBG23520.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992153|gb|ACY87038.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157051|emb|CBW16535.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911473|dbj|BAJ35447.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320084713|emb|CBY94504.1| Cytochrome o ubiquinol oxidase protein cyoD Ubiquinol oxidase chain
           D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226016|gb|EFX51067.1| Cytochrome O ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322614718|gb|EFY11647.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618824|gb|EFY15712.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623531|gb|EFY20370.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629171|gb|EFY25950.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631891|gb|EFY28645.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637372|gb|EFY34074.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642057|gb|EFY38667.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647876|gb|EFY44351.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652554|gb|EFY48908.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653284|gb|EFY49617.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660567|gb|EFY56803.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322664719|gb|EFY60912.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669228|gb|EFY65378.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670773|gb|EFY66906.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678988|gb|EFY75043.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682016|gb|EFY78041.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322685155|gb|EFY81152.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322713513|gb|EFZ05084.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128759|gb|ADX16189.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192952|gb|EFZ78175.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196966|gb|EFZ82108.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203951|gb|EFZ88968.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323206964|gb|EFZ91917.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323210818|gb|EFZ95690.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214509|gb|EFZ99260.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323223066|gb|EGA07409.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227015|gb|EGA11196.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230167|gb|EGA14287.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233905|gb|EGA17994.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238401|gb|EGA22459.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244089|gb|EGA28098.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323246249|gb|EGA30232.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323251875|gb|EGA35738.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323257872|gb|EGA41551.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261115|gb|EGA44707.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264955|gb|EGA48454.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323272518|gb|EGA55925.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622142|gb|EGE28487.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332987389|gb|AEF06372.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 109

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSVILTVIPFWMVMTGA-ASPAVILGSILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|330821325|ref|YP_004350187.1| Ubiquinol oxidase, subunit IV [Burkholderia gladioli BSR3]
 gi|327373320|gb|AEA64675.1| Ubiquinol oxidase, subunit IV [Burkholderia gladioli BSR3]
          Length = 113

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 68/99 (68%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+GT    LVGF+LS+ILT   FG+V+ G+F     M + + + A  QI+VHL+FFLHM+
Sbjct: 14  SHGTVSSYLVGFVLSVILTAASFGVVLGGWFASTTTMVIALAVLAAVQIVVHLIFFLHMN 73

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++ A ++T++ V I  VGS+W+M++++ NMMS
Sbjct: 74  TSSGQRWNLTAFVYTVLTVGIVIVGSLWIMHNVSMNMMS 112


>gi|123443352|ref|YP_001007326.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090313|emb|CAL13179.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 95

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/93 (52%), Positives = 69/93 (74%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GFILS+ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+
Sbjct: 2   KSYLIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEE 60

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 61  RWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 93


>gi|163857711|ref|YP_001632009.1| hypothetical protein Bpet3398 [Bordetella petrii DSM 12804]
 gi|163261439|emb|CAP43741.1| conserved hypothetical protein [Bordetella petrii]
          Length = 125

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 74/112 (66%), Gaps = 6/112 (5%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           + D + + ++H Y      L+GF L+ ILT IPF IVM   F    +  L ++  AI QI
Sbjct: 12  EEDPLAHASLHGY------LLGFALAAILTAIPFFIVMANVFSSSRVTGLVLLALAIVQI 65

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +VH+++FLH+  + E GW++++++FT+++V I   GS+W+MYHL++NMM M 
Sbjct: 66  VVHVIYFLHVDFQSEGGWNMLSIVFTLVLVVIALSGSIWIMYHLDHNMMPMS 117


>gi|311280674|ref|YP_003942905.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter cloacae
           SCF1]
 gi|308749869|gb|ADO49621.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter cloacae
           SCF1]
          Length = 108

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  T+++ A+ QI+VHLV FLHM+
Sbjct: 10  SHGSVKTYMTGFILSIILTLIPFWMVMNGSASHVALLG-TVLVSAVVQILVHLVCFLHMN 68

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  +GS+W+M++LN NMM
Sbjct: 69  TKSDEGWNLTAFVFTVLIIAIVVIGSIWIMWNLNYNMM 106


>gi|187734216|ref|YP_001879139.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii CDC
           3083-94]
 gi|187431208|gb|ACD10482.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella boydii CDC
           3083-94]
          Length = 109

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI   A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTIRAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|283834252|ref|ZP_06353993.1| cytochrome o ubiquinol oxidase, subunit IV [Citrobacter youngae
           ATCC 29220]
 gi|291069774|gb|EFE07883.1| cytochrome o ubiquinol oxidase, subunit IV [Citrobacter youngae
           ATCC 29220]
          Length = 109

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVIPFWMVMTGS-ASPAVILGTILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +K ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  SKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|222111442|ref|YP_002553706.1| cytochrome o ubiquinol oxidase subunit Iv [Acidovorax ebreus TPSY]
 gi|221730886|gb|ACM33706.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax ebreus TPSY]
          Length = 139

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 70/96 (72%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           TK   + GFIL++ILT+IPF +VM     ++    L + + A+ Q++VH+V+FLHM+ K+
Sbjct: 23  TKGDYVKGFILAVILTVIPFWLVMADVIQNRTTAVLVLGIFAMVQVVVHMVYFLHMNGKI 82

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           + GW++++ IFTI+ +A+  +G++WVM+H+N NMM 
Sbjct: 83  QGGWTMLSTIFTIVFLAVTIIGTLWVMFHMNANMMP 118


>gi|261346373|ref|ZP_05974017.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rustigianii
           DSM 4541]
 gi|282565690|gb|EFB71225.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rustigianii
           DSM 4541]
          Length = 110

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 77/107 (71%), Gaps = 4/107 (3%)

Query: 7   HNMNMH---SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           H  + H   S+G+ K  L+GFILS+ILT+IPF +VM G    + ++  T+V  A+ QI+V
Sbjct: 3   HERDAHTGASHGSVKTYLIGFILSVILTVIPFWMVMNGT-ASQGVILATVVGMAVVQILV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+T  ++ W+++A +FT+++V I  +GS+W+MY+LN NMM
Sbjct: 62  HLVCFLHMNTSSDERWNLVAFLFTMLIVGIVVIGSLWIMYNLNINMM 108


>gi|191173515|ref|ZP_03035042.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli F11]
 gi|190906224|gb|EDV65836.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli F11]
          Length = 124

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 26  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQILVHLVCFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 85  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 122


>gi|205351751|ref|YP_002225552.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205271532|emb|CAR36350.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326626786|gb|EGE33129.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 109

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSVILTVIPFWMVMTGA-ASPAVILGSILAMAVLQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|117622689|ref|YP_851602.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli APEC
           O1]
 gi|331645603|ref|ZP_08346707.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M605]
 gi|115511813|gb|ABI99887.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli APEC
           O1]
 gi|331045765|gb|EGI17891.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M605]
          Length = 136

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 38  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQILVHLVCFLHMN 96

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 97  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|94314530|ref|YP_587739.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|93358382|gb|ABF12470.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|222831883|gb|EEE70360.1| predicted protein [Populus trichocarpa]
          Length = 142

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    L GF+LS+ LT +PF +VM   F   +   + I+L    QI+VH+++FLHM+
Sbjct: 23  PHATLGGYLTGFVLSVFLTAVPFWLVMGKVFEKSSTTAIAILLIGAVQIVVHMIYFLHMN 82

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            K E GW++++++FT+ +V I   GS+WVM+HLN+NMM 
Sbjct: 83  AKSEGGWNMLSLMFTLTLVVITLTGSLWVMFHLNSNMMP 121


>gi|290474675|ref|YP_003467555.1| cytochrome o ubiquinol oxidase subunit IV [Xenorhabdus bovienii
           SS-2004]
 gi|289173988|emb|CBJ80775.1| cytochrome o ubiquinol oxidase, subunit IV [Xenorhabdus bovienii
           SS-2004]
          Length = 110

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+ K  ++GFILS+ILT+IPF +VM G      I+ LT++  A+ QI VH V FLHM+
Sbjct: 12  DHGSFKTYMIGFILSVILTVIPFWMVMDGSASQSTIL-LTVIGMAVIQIFVHFVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A+IFT++++AI  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNLVALIFTLLVIAIVVVGSLWIMYNLNINMM 108


>gi|189010631|ref|ZP_03006400.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4076]
 gi|189403117|ref|ZP_03006965.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4486]
 gi|189404836|ref|ZP_03007598.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC869]
 gi|193068714|ref|ZP_03049675.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E110019]
 gi|194428823|ref|ZP_03061358.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B171]
 gi|194432628|ref|ZP_03064914.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella dysenteriae
           1012]
 gi|194438861|ref|ZP_03070946.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 101-1]
 gi|208807081|ref|ZP_03249418.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4206]
 gi|208822824|ref|ZP_03263142.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4042]
 gi|217326573|ref|ZP_03442657.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. TW14588]
 gi|188999375|gb|EDU68361.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4076]
 gi|189362449|gb|EDU80868.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4486]
 gi|189373698|gb|EDU92114.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC869]
 gi|192958077|gb|EDV88519.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E110019]
 gi|194413126|gb|EDX29413.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B171]
 gi|194419189|gb|EDX35272.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella dysenteriae
           1012]
 gi|194422155|gb|EDX38157.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 101-1]
 gi|208726882|gb|EDZ76483.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4206]
 gi|208737017|gb|EDZ84701.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4042]
 gi|217322794|gb|EEC31218.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. TW14588]
          Length = 124

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 26  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 85  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 122


>gi|238750997|ref|ZP_04612493.1| hypothetical protein yrohd0001_1290 [Yersinia rohdei ATCC 43380]
 gi|238765442|ref|ZP_04626363.1| hypothetical protein ykris0001_44090 [Yersinia kristensenii ATCC
           33638]
 gi|238696336|gb|EEP89132.1| hypothetical protein ykris0001_44090 [Yersinia kristensenii ATCC
           33638]
 gi|238710687|gb|EEQ02909.1| hypothetical protein yrohd0001_1290 [Yersinia rohdei ATCC 43380]
          Length = 95

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 69/93 (74%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  ++GFILS+ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+
Sbjct: 2   KSYIIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEE 60

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 61  RWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 93


>gi|213425865|ref|ZP_03358615.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 109

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSVILTVIPFWMVMTGA-ASPAVILGSILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A IFT +++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFIFTALIIAILVVGSIWIMWNLNYNMM 107


>gi|152968964|ref|YP_001334073.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206576416|ref|YP_002240092.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella pneumoniae
           342]
 gi|238893376|ref|YP_002918110.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262042465|ref|ZP_06015624.1| cytochrome o ubiquinol oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936842|ref|YP_003440901.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella variicola
           At-22]
 gi|330011525|ref|ZP_08307111.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella sp. MS 92-3]
 gi|150953813|gb|ABR75843.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206565474|gb|ACI07250.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella pneumoniae
           342]
 gi|238545692|dbj|BAH62043.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040169|gb|EEW41281.1| cytochrome o ubiquinol oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891551|gb|ADC59869.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella variicola
           At-22]
 gi|328534142|gb|EGF60777.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella sp. MS 92-3]
          Length = 109

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ QI+VHLV+FLHM+
Sbjct: 11  SHGSVKSYMTGFILSIILTVIPFAMVMSGS-ASHAVILGTILVTAVVQIVVHLVYFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +K ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 70  SKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNYNMM 107


>gi|331640947|ref|ZP_08342082.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H736]
 gi|331651365|ref|ZP_08352390.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M718]
 gi|331671975|ref|ZP_08372771.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA280]
 gi|331676100|ref|ZP_08376812.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H591]
 gi|332281579|ref|ZP_08393992.1| cytochrome o ubiquinol oxidase C subunit [Shigella sp. D9]
 gi|1773113|gb|AAB40185.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|331037745|gb|EGI09965.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H736]
 gi|331051106|gb|EGI23158.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M718]
 gi|331070964|gb|EGI42323.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA280]
 gi|331076158|gb|EGI47440.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H591]
 gi|332103931|gb|EGJ07277.1| cytochrome o ubiquinol oxidase C subunit [Shigella sp. D9]
          Length = 136

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 38  SHGSVKTYMTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 96

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 97  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|268592045|ref|ZP_06126266.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rettgeri
           DSM 1131]
 gi|291312438|gb|EFE52891.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rettgeri
           DSM 1131]
          Length = 110

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ QI+VHLV FLHM+
Sbjct: 12  SHGSVKTYLIGFILSVILTVIPFWMVMEGTASTSAILW-TVVGMAVVQILVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  ++ W+++A +FT+++V I  +GS+W+MY+LN NMM
Sbjct: 71  TSSDERWNLVAFLFTMLIVGIVVIGSLWIMYNLNINMM 108


>gi|294012087|ref|YP_003545547.1| cytochrome o ubiquinol oxidase operon protein cyoD [Sphingobium
           japonicum UT26S]
 gi|292675417|dbj|BAI96935.1| cytochrome o ubiquinol oxidase operon protein cyoD [Sphingobium
           japonicum UT26S]
          Length = 139

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 69/99 (69%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+    ++GF LS ILT IPF +VM G   D  +  + I+  A  Q++VH+++FLHM+
Sbjct: 17  AHGSFGSYMIGFGLSAILTAIPFWLVMSGALNDPQLTGVVIMGFAAVQVVVHMIYFLHMN 76

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T+VE GWS MAM+ T+++V I   GS+WVMYHLN NMM 
Sbjct: 77  TRVEGGWSFMAMMLTVVLVVIVLSGSLWVMYHLNANMMP 115


>gi|212709187|ref|ZP_03317315.1| hypothetical protein PROVALCAL_00220 [Providencia alcalifaciens DSM
           30120]
 gi|212688099|gb|EEB47627.1| hypothetical protein PROVALCAL_00220 [Providencia alcalifaciens DSM
           30120]
          Length = 110

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GFILS+ILT+IPF +VM G    + ++  T+V  A+ QI+VHLV FLHM+
Sbjct: 12  SHGSVKTYLIGFILSVILTVIPFWMVMNGT-ASQGVILATVVGMAVVQILVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  ++ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 71  TSSDERWNLIAFLFTMLIIGIVVIGSLWIMYNLNINMM 108


>gi|114767474|ref|ZP_01446257.1| cytochrome o ubiquinol oxidase subunit IV [Pelagibaca bermudensis
           HTCC2601]
 gi|114540454|gb|EAU43536.1| cytochrome o ubiquinol oxidase subunit IV [Roseovarius sp.
           HTCC2601]
          Length = 127

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 67/104 (64%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H +GT  Q ++GF L+ ILTIIPF +VM    + ++ +   I+     QI+VHLV+FLH+
Sbjct: 9   HDHGTMGQLMIGFALAAILTIIPFYLVMAEVDMARSTLVGIIMGLGAVQIVVHLVYFLHL 68

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
               E+GW+  A IF +I++ I   GS+WVM+++N NMM M  M
Sbjct: 69  KRSSEEGWNFFATIFAVIILVIVLAGSLWVMHNMNENMMPMHEM 112


>gi|319762686|ref|YP_004126623.1| cytochrome o ubiquinol oxidase subunit iv [Alicycliphilus
           denitrificans BC]
 gi|330824827|ref|YP_004388130.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans K601]
 gi|317117247|gb|ADU99735.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans BC]
 gi|329310199|gb|AEB84614.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans K601]
          Length = 124

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 67/96 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T+   + GF+L++ILT IPF +VM G   D+    L + L A  QI+VH+V+FLHM+ K+
Sbjct: 26  TRGDYVKGFVLAVILTAIPFWLVMNGAIQDRTTGALVLGLFAAVQIVVHMVYFLHMNGKI 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           + GW++++ +FTI+ +A+   G++WVM+H+N  MM 
Sbjct: 86  QGGWTMLSTLFTIVFLAVTIAGTLWVMFHMNAAMMP 121


>gi|264678283|ref|YP_003278190.1| cytochrome C oxidase subunit IV [Comamonas testosteroni CNB-2]
 gi|299532079|ref|ZP_07045473.1| cytochrome C oxidase subunit IV [Comamonas testosteroni S44]
 gi|262208796|gb|ACY32894.1| cytochrome C oxidase subunit IV [Comamonas testosteroni CNB-2]
 gi|298719741|gb|EFI60704.1| cytochrome C oxidase subunit IV [Comamonas testosteroni S44]
          Length = 141

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 65/95 (68%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GFIL++ILT IPF +VM     D+      + L A+ Q+IVH+V+FLHM+ K++ GW+++
Sbjct: 29  GFILAVILTAIPFYLVMNNIITDRTTAVAVLGLFAVIQVIVHMVYFLHMNGKIQGGWTML 88

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           + IFT+I +AI   G++WVM+H+N NMM    M  
Sbjct: 89  STIFTVIFLAIAISGTLWVMFHMNTNMMPGHEMHQ 123


>gi|237730406|ref|ZP_04560887.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter sp. 30_2]
 gi|226905945|gb|EEH91863.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter sp. 30_2]
          Length = 136

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+
Sbjct: 38  SHGSVKTYMTGFILSIILTVIPFWMVMTGS-ASPAVILGTILAMAVVQILVHLVCFLHMN 96

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +K ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 97  SKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|99082127|ref|YP_614281.1| cytochrome C oxidase subunit IV [Ruegeria sp. TM1040]
 gi|99038407|gb|ABF65019.1| cytochrome C oxidase subunit IV [Ruegeria sp. TM1040]
          Length = 115

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 67/103 (65%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ HS+G+ K   +GF+LS+ILT+IPF +V+    +  N     I      QIIVH+ +F
Sbjct: 1   MSAHSHGSYKSYAIGFVLSVILTVIPFWLVLGEVDIGVNTAIAVIFGLGAVQIIVHMHYF 60

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LH++   EDGW +M+++FT I++ I   GS+WVM HL+ NMM 
Sbjct: 61  LHVTYGAEDGWQVMSLVFTGILLIIVLAGSIWVMAHLHENMMP 103


>gi|221067298|ref|ZP_03543403.1| cytochrome o ubiquinol oxidase subunit IV [Comamonas testosteroni
           KF-1]
 gi|220712321|gb|EED67689.1| cytochrome o ubiquinol oxidase subunit IV [Comamonas testosteroni
           KF-1]
          Length = 141

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 65/95 (68%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GFIL++ILT IPF +VM     D+      + L A+ Q++VH+V+FLHM+ K++ GW+++
Sbjct: 29  GFILAVILTAIPFYLVMNNVITDRTTAVAVLGLFAVIQVLVHMVYFLHMNGKIQGGWTML 88

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           + IFT+I +AI   G++WVM+H+N NMM    M  
Sbjct: 89  STIFTVIFLAIAISGTLWVMFHMNTNMMPGHEMHQ 123


>gi|194292955|ref|YP_002008862.1| transmembrane cytochrome o ubiquinol oxidase subunit iv
           [Cupriavidus taiwanensis LMG 19424]
 gi|193226859|emb|CAQ72810.1| TRANSMEMBRANE CYTOCHROME O UBIQUINOL OXIDASE (SUBUNIT IV)
           OXIDOREDUCTASE PROTEIN [Cupriavidus taiwanensis LMG
           19424]
          Length = 135

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 65/91 (71%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GF+LS+ILT IPF +VM   F   +   + ++     QI+VH+++FLH++ + E GW+
Sbjct: 36  VTGFVLSVILTAIPFWLVMGRVFEQSSTTAMVLLALGAVQIVVHMIYFLHLNARSEGGWN 95

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++A+IFT+++V I   G++WVM+HLN+NMM 
Sbjct: 96  MLALIFTLVLVVITLTGTLWVMFHLNSNMMP 126


>gi|183601051|ref|ZP_02962544.1| hypothetical protein PROSTU_04673 [Providencia stuartii ATCC 25827]
 gi|188019390|gb|EDU57430.1| hypothetical protein PROSTU_04673 [Providencia stuartii ATCC 25827]
          Length = 110

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 74/98 (75%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM+G      I+  T+V  A+ QI+VHLV FLHM+
Sbjct: 12  SHGSMKTYVIGFVLSVILTVIPFWMVMEGTASQATILW-TVVGMAVVQILVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  ++ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 71  TSSDERWNLIAFLFTMLIIGIVVIGSLWIMYNLNINMM 108


>gi|300947920|ref|ZP_07162068.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           116-1]
 gi|300452520|gb|EFK16140.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           116-1]
          Length = 109

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 47/98 (47%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+I F +VM G      ++  TI+  A+ Q++VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSIILTVISFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 70  TKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|213621013|ref|ZP_03373796.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 105

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 72/96 (75%), Gaps = 1/96 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+VHLV FLHM+
Sbjct: 11  SHGSVKTYMTGFILSVILTVIPFWMVMTGA-ASPAVILGSILAMAVVQILVHLVCFLHMN 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
           TK ++GW++ A IFT++++AI  VGS+W+M++LN N
Sbjct: 70  TKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYN 105


>gi|290510102|ref|ZP_06549472.1| cytochrome o ubiquinol oxidase operon protein cyoD [Klebsiella sp.
           1_1_55]
 gi|289776818|gb|EFD84816.1| cytochrome o ubiquinol oxidase operon protein cyoD [Klebsiella sp.
           1_1_55]
          Length = 136

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 75/98 (76%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ QI+VHLV+FLHM+
Sbjct: 38  PHGSVKSYMTGFILSIILTVIPFAMVMSGS-ASHAVILGTILVTAVVQIVVHLVYFLHMN 96

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +K ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 97  SKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNYNMM 134


>gi|295691073|ref|YP_003594766.1| cytochrome o ubiquinol oxidase subunit IV [Caulobacter segnis ATCC
           21756]
 gi|295432976|gb|ADG12148.1| cytochrome o ubiquinol oxidase subunit IV [Caulobacter segnis ATCC
           21756]
          Length = 129

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 72/99 (72%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  ++GF+L++ILT IPF +VM        +  + ++  A+ Q++VH+++FLHM+
Sbjct: 21  AHGSLKDYVIGFVLAVILTAIPFWLVMGNVLPTAQMTAVAVMGLAVIQVLVHMIYFLHMN 80

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++ E GW+++A++FT+I+V I   GS+WVM++LN +MM 
Sbjct: 81  SRSEGGWTLLALMFTLILVVITLSGSLWVMHNLNTHMMP 119


>gi|300722000|ref|YP_003711280.1| cytochrome o ubiquinol oxidase subunit IV [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628497|emb|CBJ89064.1| cytochrome o ubiquinol oxidase, subunit IV [Xenorhabdus nematophila
           ATCC 19061]
          Length = 110

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/98 (46%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GF+LS+ILT+IPF +VM+G      I+ LT++  A+ QI+VH ++FLHM+
Sbjct: 12  SHGSFKTYMIGFVLSVILTVIPFWMVMEGTASHSTIL-LTVLAMAVVQIVVHFIYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  E+ W+++A++FT++++ I  VGS+W+MY+LN NMM
Sbjct: 71  TSSEERWNLVALLFTLLVIVIVVVGSLWIMYNLNINMM 108


>gi|238025053|ref|YP_002909285.1| Ubiquinol oxidase subunit IV [Burkholderia glumae BGR1]
 gi|237879718|gb|ACR32050.1| Ubiquinol oxidase, subunit IV [Burkholderia glumae BGR1]
          Length = 113

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 66/99 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+GT    LVGF+LS+ILT   FG+V+ G+F    +  L + + A  QI+VHL+FFLHM+
Sbjct: 14  SHGTVSSYLVGFVLSVILTAASFGVVLGGWFSTNEVKILVLAVLAAVQIVVHLIFFLHMN 73

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++ A  +T++ V I  VGS+W+M++++ NMMS
Sbjct: 74  GSSSQRWNVTAFAYTVLTVGIVIVGSLWIMHNVSINMMS 112


>gi|260596797|ref|YP_003209368.1| cytochrome o ubiquinol oxidase protein cyoD [Cronobacter turicensis
           z3032]
 gi|260215974|emb|CBA28615.1| Cytochrome o ubiquinol oxidase protein cyoD [Cronobacter turicensis
           z3032]
          Length = 109

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 75/110 (68%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   HN   H  G  K  L+GFILS+ILT+IPF +VM G      ++ + +V  A+ Q
Sbjct: 1   MSHSTDHNGAHH--GGVKTYLIGFILSVILTVIPFWMVMNGSASHGTLLGV-VVATAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+   E+ W+++A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNASSEERWNLVAFIFTLLIIAIVVVGSIWIMWNLNYNMM 107


>gi|238920118|ref|YP_002933633.1| cytochrome o ubiquinol oxidase subunit IV [Edwardsiella ictaluri
           93-146]
 gi|238869687|gb|ACR69398.1| cytochrome o ubiquinol oxidase subunit IV, putative [Edwardsiella
           ictaluri 93-146]
          Length = 112

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G  K  L+GFILS++LT+IPF +VM G       + + +V  A+ Q+IVHLV FLHM+
Sbjct: 14  GHGGVKSYLIGFILSIVLTVIPFAVVMSGGVAHSTTLAV-VVGMAVIQVIVHLVCFLHMN 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T  +  W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 73  TSSQGRWNLVALLFTAVIIGIVVVGSLWIMYNLNINMM 110


>gi|187930227|ref|YP_001900714.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|241664394|ref|YP_002982754.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|309782937|ref|ZP_07677657.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia sp.
           5_7_47FAA]
 gi|187727117|gb|ACD28282.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|240866421|gb|ACS64082.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|308918361|gb|EFP64038.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia sp.
           5_7_47FAA]
          Length = 122

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 71/97 (73%), Gaps = 1/97 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT IPF +VM G +  + ++  T++  A+ QI+VHL++FLH+    
Sbjct: 27  TVKGYLIGFVLAVILTAIPFKMVMDGGYSHQTVLV-TVMALAVVQIVVHLIYFLHLDGSS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
              W++MA +FT++++AI  VGS+WVM+++N NMM+M
Sbjct: 86  AQRWNVMAFLFTLLILAIVVVGSLWVMHNMNANMMTM 122


>gi|73538718|ref|YP_299085.1| cytochrome C oxidase subunit IV [Ralstonia eutropha JMP134]
 gi|72122055|gb|AAZ64241.1| Prokaryotic Cytochrome C oxidase subunit IV [Ralstonia eutropha
           JMP134]
          Length = 130

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 64/89 (71%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GF+LS+ILT IPF +VM   F   +   + ++     QI+VH+++FLHM+ K E GW+++
Sbjct: 38  GFVLSVILTTIPFWLVMGKVFEKSSTTAILLLALGAVQIVVHMIYFLHMNAKSEGGWNML 97

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           A++FT+++V I   G++WVM+HLN+NMM 
Sbjct: 98  ALMFTLVLVVITLSGTLWVMFHLNSNMMP 126


>gi|284006411|emb|CBA71647.1| cytochrome O ubiquinol oxidase protein [Arsenophonus nasoniae]
          Length = 132

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M Y N  +    S+G+ K  L+GFILS+ILT++PF +VM        I+ + ++  AIAQ
Sbjct: 23  MSYTNTPHSGA-SHGSMKTYLIGFILSIILTVVPFWMVMNSTASHDTILWI-VIGTAIAQ 80

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  +D W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 81  ILVHLVCFLHMNTSSDDRWNLVAFLFTMLIIGIVVIGSLWIMYNLNINMM 130


>gi|156935022|ref|YP_001438938.1| hypothetical protein ESA_02873 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533276|gb|ABU78102.1| hypothetical protein ESA_02873 [Cronobacter sakazakii ATCC BAA-894]
          Length = 109

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   HN   H  G  K  L+GFILS+ILT+IPF +VM G      ++ + +V  A+ Q
Sbjct: 1   MSHSTDHNGAHH--GGVKTYLIGFILSVILTVIPFWMVMNGSASHGTLLGV-VVATAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+   E+ W+++A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNASSEERWNLVAFVFTLLIIAIVVVGSIWIMWNLNYNMM 107


>gi|20378346|gb|AAM20917.1|AF439739_4 cytochrome bo subunit D [Vitreoscilla sp. C1]
          Length = 103

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/101 (46%), Positives = 67/101 (66%), Gaps = 2/101 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H  G+ KQ +VGFI+S+ILT+IPFG+VM G  + K I   T+V+   AQ+ V LVFFL
Sbjct: 5   NNHDAGSVKQYVVGFIISIILTVIPFGMVMGG--MPKGITVATLVITMFAQVWVQLVFFL 62

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HM  +    W I +  +T + +AI FVGS+W++  L++ MM
Sbjct: 63  HMKREDAQRWHIASFWYTFLTIAILFVGSVWILSELHSFMM 103


>gi|319945343|ref|ZP_08019605.1| cytochrome o ubiquinol oxidase subunit IV [Lautropia mirabilis ATCC
           51599]
 gi|319741913|gb|EFV94338.1| cytochrome o ubiquinol oxidase subunit IV [Lautropia mirabilis ATCC
           51599]
          Length = 105

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/103 (39%), Positives = 67/103 (65%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M    + +   C +GF+L++ILT+IPFG+VM G F D     L I+   + QIIVH+V+F
Sbjct: 1   MGQPPHVSGTDCNIGFLLAVILTLIPFGLVMTGAFEDTGTAALIIMGLGVVQIIVHMVYF 60

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           L ++ + E  W++ A+I T+++VAI  VG++W M  L+ N++ 
Sbjct: 61  LQLNCRAEGSWTLPALIVTVLLVAILLVGTLWGMPPLDGNVVP 103


>gi|300702890|ref|YP_003744491.1| cytochrome o ubiquinol oxidase, subunit iv [Ralstonia solanacearum
           CFBP2957]
 gi|299070552|emb|CBJ41847.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           CFBP2957]
          Length = 122

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+    
Sbjct: 27  TVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
              W++MA +FT++++AI  VGS+WVM+++N NMM+
Sbjct: 86  AQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMMT 121


>gi|312964549|ref|ZP_07778805.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           2362-75]
 gi|312290783|gb|EFR18660.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           2362-75]
 gi|323191347|gb|EFZ76610.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           RN587/1]
 gi|330910221|gb|EGH38731.1| cytochrome O ubiquinol oxidase subunit 4 [Escherichia coli AA86]
          Length = 91

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQILVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIIAILVVGSIWIMWNLNYNMM 89


>gi|207721795|ref|YP_002252233.1| transmembrane cytochrome o ubiquinol oxidase (subunit iv) protein
           [Ralstonia solanacearum MolK2]
 gi|206586959|emb|CAQ17543.1| transmembrane cytochrome o ubiquinol oxidase (subunit iv) protein
           [Ralstonia solanacearum MolK2]
          Length = 123

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 70/94 (74%), Gaps = 1/94 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+      
Sbjct: 30  KGYLIGFVLAVILTVIPFKMVMSGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSSAQ 88

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            W++MA +FT++++AI  VGS+WVM+++N NMM+
Sbjct: 89  RWNVMAFLFTLLILAIVIVGSLWVMHNMNINMMT 122


>gi|301025684|ref|ZP_07189200.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           196-1]
 gi|312970524|ref|ZP_07784705.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           1827-70]
 gi|299879996|gb|EFI88207.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           196-1]
 gi|310337173|gb|EFQ02311.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           1827-70]
 gi|315616631|gb|EFU97248.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 3431]
 gi|320181589|gb|EFW56504.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella boydii ATCC
           9905]
 gi|320197133|gb|EFW71750.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli
           WV_060327]
 gi|320201673|gb|EFW76249.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli
           EC4100B]
 gi|323157117|gb|EFZ43241.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           EPECa14]
 gi|323160461|gb|EFZ46409.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           E128010]
 gi|323164228|gb|EFZ50035.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei 53G]
 gi|323170514|gb|EFZ56164.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli LT-68]
 gi|323178303|gb|EFZ63881.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 1180]
 gi|325498280|gb|EGC96139.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ECD227]
 gi|332085679|gb|EGI90843.1| cytochrome o ubiquinol oxidase subunit IV [Shigella dysenteriae
           155-74]
 gi|332098563|gb|EGJ03529.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii 3594-74]
 gi|332760715|gb|EGJ91003.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           4343-70]
 gi|332761669|gb|EGJ91948.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           2747-71]
 gi|332763720|gb|EGJ93958.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-671]
 gi|332768345|gb|EGJ98529.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           2930-71]
 gi|333007851|gb|EGK27327.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-218]
 gi|333010886|gb|EGK30312.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-272]
 gi|333021384|gb|EGK40637.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-227]
 gi|333021987|gb|EGK41233.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-304]
          Length = 91

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIIAILVVGSIWIMWNLNYNMM 89


>gi|17547633|ref|NP_521035.1| transmembrane cytochrome O ubiquinol oxidase subunit IV [Ralstonia
           solanacearum GMI1000]
 gi|17429937|emb|CAD16621.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit iv)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 121

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+ 
Sbjct: 23  GHATVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMGLAVVQIVVHLIYFLHLD 81

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA +FT++++ I  VGS+WVM+++N NMM+
Sbjct: 82  GSSAQRWNVMAFLFTLLILVIVIVGSLWVMHNMNVNMMT 120


>gi|83747511|ref|ZP_00944549.1| CyoD [Ralstonia solanacearum UW551]
 gi|83725825|gb|EAP72965.1| CyoD [Ralstonia solanacearum UW551]
          Length = 122

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 70/94 (74%), Gaps = 1/94 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+      
Sbjct: 29  KGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSSAQ 87

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            W++MA +FT++++AI  VGS+WVM+++N NMM+
Sbjct: 88  RWNVMAFLFTLLILAIVIVGSLWVMHNMNINMMT 121


>gi|254428964|ref|ZP_05042671.1| cytochrome o ubiquinol oxidase subunit IV [Alcanivorax sp. DG881]
 gi|196195133|gb|EDX90092.1| cytochrome o ubiquinol oxidase subunit IV [Alcanivorax sp. DG881]
          Length = 118

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/94 (46%), Positives = 65/94 (69%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K+   GF+L++ILT+IPF +VM           + I+  A+ QI+VH+VFFLHM+   E 
Sbjct: 21  KEYATGFVLAVILTVIPFWLVMGDVLESSTTTVMVILGFALVQIVVHMVFFLHMNFHSEG 80

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           GW+++A+IFT+I+V I   GS+WVM++LN NMM 
Sbjct: 81  GWNMLALIFTLILVFITLAGSLWVMHNLNVNMMP 114


>gi|320186058|gb|EFW60803.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella flexneri CDC
           796-83]
          Length = 91

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/90 (48%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGA-ASPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++ I  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIITILVVGSIWIMWNLNYNMM 89


>gi|73540688|ref|YP_295208.1| cytochrome C oxidase subunit IV [Ralstonia eutropha JMP134]
 gi|72118101|gb|AAZ60364.1| Prokaryotic Cytochrome C oxidase subunit IV [Ralstonia eutropha
           JMP134]
          Length = 116

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 67/100 (67%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H + + K   +GF+L++ILT+IPF IVM G  +D+    L I+  A  Q++VHL +FLHM
Sbjct: 14  HGHSSFKSYAIGFVLAVILTVIPFKIVMDGT-MDRGTTLLIILGMAAVQVVVHLKYFLHM 72

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
               E  W++M+ +FT++++ I   GS+W+M+++N NMM 
Sbjct: 73  DGSKEQRWNVMSFLFTLLILFIVLAGSLWIMHNMNANMMP 112


>gi|194289183|ref|YP_002005090.1| cytochrome o ubiquinol oxidase subunit iv [Cupriavidus taiwanensis
           LMG 19424]
 gi|193223018|emb|CAQ69023.1| cytochrome o ubiquinol oxidase, subunit IV [Cupriavidus taiwanensis
           LMG 19424]
          Length = 122

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/106 (41%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   + + K   +GFIL++ILT+IPF IVM G  +DK  +  TI+  A+ Q+IVHL 
Sbjct: 18  HDSHAGGHASFKGYAIGFILAVILTVIPFKIVMDGT-MDKGTILWTILGMAVVQMIVHLK 76

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           +FLH+ +  E   +++A++FT +++ I   GS+W+M++LN NMM M
Sbjct: 77  YFLHLDSSSEQRSNVIALLFTALILVIVVAGSLWIMHNLNANMMVM 122


>gi|296156344|ref|ZP_06839183.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. Ch1-1]
 gi|295893850|gb|EFG73629.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. Ch1-1]
          Length = 110

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+     VGFILS++LT+  FG+VM G    ++ +   I   A+ QI+
Sbjct: 2   DHSHNAHAGESHGSLGSYTVGFILSVVLTVAAFGLVMTGKLTGEHAL-FAIAGLALVQIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLVFFLHM+T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLVFFLHMNTSSEQRWNVMAFAFTLLTAIIVIGGTLWVMHNVSMHMMS 109


>gi|285017726|ref|YP_003375437.1| cytochrome o ubiquinol oxidase subunit iv transmembrane protein
           [Xanthomonas albilineans GPE PC73]
 gi|283472944|emb|CBA15449.1| probable cytochrome o ubiquinol oxidase subunit iv transmembrane
           protein [Xanthomonas albilineans]
          Length = 112

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 68/99 (68%), Gaps = 2/99 (2%)

Query: 13  SYGTK-KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           S+G+  K  L+GF+L++ILT+IPFG+VM G F  K    + I + A  Q++VHLV+FLHM
Sbjct: 14  SHGSSLKSYLIGFVLAVILTVIPFGMVMSGAF-PKGATVIAIAVMAAVQMLVHLVYFLHM 72

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
               E   ++   +F+++++ I  VGS+WV+++LN NMM
Sbjct: 73  DRSPEQRSNVHVGLFSLLIIGIVVVGSLWVLHNLNVNMM 111


>gi|94309896|ref|YP_583106.1| cytochrome c oxidase subunit IV [Cupriavidus metallidurans CH34]
 gi|93353748|gb|ABF07837.1| Cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|222871193|gb|EEF08324.1| predicted protein [Populus trichocarpa]
          Length = 116

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H + + K  ++GF+L++ILT+IPF IVM G  +++  M   I+  A  QI+VHL +FLH+
Sbjct: 15  HGHSSVKSYVIGFVLAVILTVIPFKIVMDGT-MERGTMLWIILGMAAVQIVVHLKYFLHL 73

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                  W++MA++FT++++ I   GS+W+M+++N NMM 
Sbjct: 74  DGSNGQRWNVMALLFTVLILFIVLAGSLWIMHNMNANMMP 113


>gi|167563463|ref|ZP_02356379.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis EO147]
          Length = 110

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 68/105 (64%), Gaps = 1/105 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+    ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A AQI+VHLV
Sbjct: 6   HSYGDEAHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAGAQIVVHLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +FLHM+T     W++MA  +T++   I   G++WVM+++N NMMS
Sbjct: 65  YFLHMNTSSSQRWNVMAFSYTVLTALILIFGTLWVMHNVNMNMMS 109


>gi|92113085|ref|YP_573013.1| cytochrome C oxidase subunit IV [Chromohalobacter salexigens DSM
           3043]
 gi|91796175|gb|ABE58314.1| cytochrome bo3 quinol oxidase subunit 4 [Chromohalobacter
           salexigens DSM 3043]
          Length = 111

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 69/98 (70%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  ++G ILS++LTIIPFG+VM G F +   + +TI + AI Q++V L+ F+H+ 
Sbjct: 12  NHGSVKSYVIGLILSIVLTIIPFGMVMSGGF-ETMTVVVTISIMAILQVLVQLIMFMHLD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            K E+GW+  + IFT +++ I   GS+W+M +L+ NMM
Sbjct: 71  FKTEEGWNAGSFIFTALILVILVGGSLWIMQNLHANMM 108


>gi|91778473|ref|YP_553681.1| CyoD [Burkholderia xenovorans LB400]
 gi|91691133|gb|ABE34331.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia xenovorans
           LB400]
          Length = 110

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+      GF+LS+ILT+  FG+VM G    ++ +   I   A  QI+
Sbjct: 2   DHSHNAHAGESHGSIGSYTAGFVLSVILTVAAFGLVMTGKLTGEHAL-FAIAGLAFVQIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLVFFLHM+T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLVFFLHMNTSSEQRWNVMAFAFTLLTAIIVIGGTLWVMHNVSMHMMS 109


>gi|296533148|ref|ZP_06895777.1| cytochrome o ubiquinol oxidase subunit IV [Roseomonas cervicalis
           ATCC 49957]
 gi|296266520|gb|EFH12516.1| cytochrome o ubiquinol oxidase subunit IV [Roseomonas cervicalis
           ATCC 49957]
          Length = 123

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D     + H++G     L G + SL LT +PF IV+ G+ L + +    ++L A+AQ+ V
Sbjct: 15  DPAAAQSAHAHGDALGYLRGLLWSLALTALPFAIVLGGW-LPRELAVPAVLLLAVAQMAV 73

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH+ T   + W++MA +FT ++V I  +GS+WVM +L+ NMM 
Sbjct: 74  HLVYFLHLRTAPGERWTLMAFLFTAVVVGIVVIGSLWVMQNLDANMMP 121


>gi|299065536|emb|CBJ36707.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           CMR15]
          Length = 121

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 71/99 (71%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+ 
Sbjct: 23  GHATVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMGLAVVQIVVHLIYFLHLD 81

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA +FT++++ I  VGS+WVM+++N NMM+
Sbjct: 82  GSSAQRWNVMAFLFTLLILLIVIVGSLWVMHNMNVNMMT 120


>gi|291616541|ref|YP_003519283.1| CyoD [Pantoea ananatis LMG 20103]
 gi|291151571|gb|ADD76155.1| CyoD [Pantoea ananatis LMG 20103]
 gi|327392972|dbj|BAK10394.1| cytochrome o ubiquinol oxidase protein CyoD [Pantoea ananatis
           AJ13355]
          Length = 109

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 75/107 (70%), Gaps = 3/107 (2%)

Query: 7   HNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           H++N H  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V   +  + VH
Sbjct: 3   HSVNEHGASHGSVKSYMIGFILSIILTGIPFWMVMDGSASHGTILGVVLVCAVVQVL-VH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLH+ +K E GW+++A++F+ I++ I  VGS+W+M++LN NMM 
Sbjct: 62  LVYFLHLDSKSEGGWNMVAIVFSAIIILIVVVGSLWIMWNLNYNMMP 108


>gi|113867094|ref|YP_725583.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113525870|emb|CAJ92215.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 68/100 (68%), Gaps = 1/100 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++ + K   +GFIL++ILT+IPF +VM G  +DK  +   I+  A  QI+VHL +FLH+ 
Sbjct: 24  THASFKSYAIGFILAVILTVIPFKLVMDGS-MDKGTILWIILGMAAVQILVHLKYFLHLD 82

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           T  E   +++A++FT +++ I   GS+W+M++LN NMM M
Sbjct: 83  TSSEQRSNVIALLFTALILVIVVAGSLWIMHNLNANMMVM 122


>gi|238791422|ref|ZP_04635060.1| hypothetical protein yinte0001_25730 [Yersinia intermedia ATCC
           29909]
 gi|238729038|gb|EEQ20554.1| hypothetical protein yinte0001_25730 [Yersinia intermedia ATCC
           29909]
          Length = 84

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 61/83 (73%), Gaps = 1/83 (1%)

Query: 28  LILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFT 87
           +ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT
Sbjct: 1   MILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFT 59

Query: 88  IIMVAICFVGSMWVMYHLNNNMM 110
            +++AI  VGS+W+MY+LN NMM
Sbjct: 60  AMIIAIVVVGSLWIMYNLNINMM 82


>gi|317047167|ref|YP_004114815.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. At-9b]
 gi|316948784|gb|ADU68259.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. At-9b]
          Length = 109

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/98 (45%), Positives = 73/98 (74%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ILT IPF +VM G    K  +   +++CA+ Q++VHLV+FLH+ 
Sbjct: 11  SHGSVKSYMIGFILSIILTAIPFWMVMDGS-ASKGTILAVVLVCAVVQVLVHLVYFLHLD 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +K E GW+++A++F  +++ I  VGS+W+M++LN NMM
Sbjct: 70  SKSEGGWNMVAIVFAAVIILIVVVGSLWIMWNLNYNMM 107


>gi|330502492|ref|YP_004379361.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas mendocina
           NK-01]
 gi|328916778|gb|AEB57609.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas mendocina
           NK-01]
          Length = 111

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 70/105 (66%), Gaps = 3/105 (2%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKG--FFLDKNIMCLTIVLCAIAQIIVHL 65
           N   H+ G K   L GFILS+ILT+IPF +VM      L +    +T+VL  +AQ++VHL
Sbjct: 6   NHAAHAVGFK-DYLTGFILSVILTVIPFMLVMHPEVLGLSRGATLITVVLFGLAQVLVHL 64

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           V+FLHM T  E  W++++MIFT++++A     S+W+M+ ++ +MM
Sbjct: 65  VYFLHMKTDAEGRWNVVSMIFTVLIIAFVVGLSVWIMWSMHYHMM 109


>gi|190573374|ref|YP_001971219.1| putative transmembrane quinol oxidase subunit 4 [Stenotrophomonas
           maltophilia K279a]
 gi|254523523|ref|ZP_05135578.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
 gi|30351180|gb|AAP22951.1| cytochrome oxidase subunit IV [Rhizobium arachis]
 gi|190011296|emb|CAQ44909.1| putative transmembrane quinol oxidase subunit 4 [Stenotrophomonas
           maltophilia K279a]
 gi|219721114|gb|EED39639.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
          Length = 113

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 75/113 (66%), Gaps = 4/113 (3%)

Query: 1   MKYDN---IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +DN    H     S+GT K  L+GF+L+++LT+IPF +VM G F  + +  + I + A
Sbjct: 1   MAHDNHAHDHGTGGESHGTVKSYLIGFVLAVVLTVIPFWMVMSGDF-SRTVNGVVIAITA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + Q++VHLVFFLH+    E  W++ A  FT++++ I  VG++WVM+++N +MM
Sbjct: 60  VLQMLVHLVFFLHLDRSSESRWNVNAAAFTVVVIGIIVVGTLWVMHNMNVHMM 112


>gi|188534643|ref|YP_001908440.1| Cytochrome o ubiquinol oxidase protein cyoD (Ubiquinol oxidase
           chain D) [Erwinia tasmaniensis Et1/99]
 gi|292487459|ref|YP_003530331.1| cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora
           CFBP1430]
 gi|292898701|ref|YP_003538070.1| cytochrome O ubiquinol oxidase subunit IV [Erwinia amylovora ATCC
           49946]
 gi|188029685|emb|CAO97564.1| Cytochrome o ubiquinol oxidase protein cyoD (Ubiquinol oxidase
           chain D) [Erwinia tasmaniensis Et1/99]
 gi|291198549|emb|CBJ45657.1| cytochrome O ubiquinol oxidase subunit IV [Erwinia amylovora ATCC
           49946]
 gi|291552878|emb|CBA19923.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora
           CFBP1430]
 gi|312171563|emb|CBX79821.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora ATCC
           BAA-2158]
          Length = 109

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 74/99 (74%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ILT IPF +VM G    K  +   +++CA+ Q++VHLV+FLH+ 
Sbjct: 11  SHGSVKSYMIGFILSIILTGIPFWMVMDGG-ASKATILAVVLVCAVVQVLVHLVYFLHLD 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +K E GW+++A++F  +++ I  VGS+W+M++LN NMMS
Sbjct: 70  SKSEGGWNLIAIVFAALIILIVVVGSLWIMWNLNYNMMS 108


>gi|259909263|ref|YP_002649619.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia pyrifoliae
           Ep1/96]
 gi|224964885|emb|CAX56407.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia pyrifoliae
           Ep1/96]
 gi|283479315|emb|CAY75231.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia pyrifoliae DSM
           12163]
 gi|310766834|gb|ADP11784.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia sp. Ejp617]
          Length = 109

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 70/99 (70%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V   +  + VHLV+FLH+ 
Sbjct: 11  SHGSVKSYMIGFILSIILTGIPFWMVMDGGASKATILTVVLVCAVVQVL-VHLVYFLHLD 69

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +K E GW+++A++F  +++ I  VGS+W+M++LN NMMS
Sbjct: 70  SKSEGGWNLIAIVFAALIILIVVVGSLWIMWNLNYNMMS 108


>gi|217422660|ref|ZP_03454163.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|217394891|gb|EEC34910.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
          Length = 107

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    L GFILS++LT   FG+V+ G  L  +   + + + A  QI+VHLV+FLHM+
Sbjct: 9   AHGTVGGYLAGFILSVLLTAASFGLVLSGA-LSSHASLIALAVLAFVQIVVHLVYFLHMN 67

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 68  GSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 106


>gi|53716518|ref|YP_105024.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|53722915|ref|YP_111900.1| cytochrome O ubiquinol oxidase protein [Burkholderia pseudomallei
           K96243]
 gi|67641747|ref|ZP_00440515.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei GB8
           horse 4]
 gi|76817781|ref|YP_336148.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1710b]
 gi|121597003|ref|YP_990968.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124382029|ref|YP_001025369.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126445034|ref|YP_001063705.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 668]
 gi|126446731|ref|YP_001077433.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|126456685|ref|YP_001076599.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1106a]
 gi|134278624|ref|ZP_01765338.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|226195663|ref|ZP_03791250.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237510118|ref|ZP_04522833.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|242313191|ref|ZP_04812208.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|251767252|ref|ZP_04820032.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           PRL-20]
 gi|254177413|ref|ZP_04884069.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|254184768|ref|ZP_04891357.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|254185987|ref|ZP_04892505.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|254193750|ref|ZP_04900182.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|254202956|ref|ZP_04909318.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|254208290|ref|ZP_04914639.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|254263772|ref|ZP_04954637.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|254301043|ref|ZP_04968487.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|52213329|emb|CAH39372.1| cytochrome O ubiquinol oxidase protein [Burkholderia pseudomallei
           K96243]
 gi|52422488|gb|AAU46058.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|76582254|gb|ABA51728.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710b]
 gi|121224801|gb|ABM48332.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|126224525|gb|ABN88030.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 668]
 gi|126230453|gb|ABN93866.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|126239585|gb|ABO02697.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           NCTC 10247]
 gi|134250408|gb|EBA50488.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|147746001|gb|EDK53079.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|147750977|gb|EDK58045.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|157811393|gb|EDO88563.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|157933673|gb|EDO89343.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|160698453|gb|EDP88423.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|169650501|gb|EDS83194.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|184215360|gb|EDU12341.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|225932148|gb|EEH28148.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|235002323|gb|EEP51747.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|238522722|gb|EEP86165.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei GB8
           horse 4]
 gi|242136430|gb|EES22833.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|243063388|gb|EES45574.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           PRL-20]
 gi|254214774|gb|EET04159.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|261826610|gb|ABM99196.2| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           NCTC 10229]
          Length = 110

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    L GFILS++LT   FG+V+ G  L  +   + + + A  QI+VHLV+FLHM+
Sbjct: 12  AHGTVGGYLAGFILSVLLTAASFGLVLSGA-LSSHASLIALAVLAFVQIVVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 71  GSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|332290095|ref|YP_004420947.1| cytochrome o ubiquinol oxidase subunit IV [Gallibacterium anatis
           UMN179]
 gi|330432991|gb|AEC18050.1| cytochrome o ubiquinol oxidase subunit IV [Gallibacterium anatis
           UMN179]
          Length = 110

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M YDN H+     +G+ K  L+GF LS+ILT+IPF +VM G    K  + + I + A+ Q
Sbjct: 1   MSYDN-HDYAATEHGSVKSYLIGFGLSVILTLIPFLMVMNGS-ASKMSLLVIIAVTAVIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +IV LV FLHM T  +  W++++ IFT I++ +    S+W+M+ LN NMM+
Sbjct: 59  LIVQLVCFLHMGTSEDGRWNLISFIFTAIVILLLVALSIWIMWSLNANMMA 109


>gi|319760377|ref|YP_004124315.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039091|gb|ADV33641.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 100

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
           M++  +     +GF+LSLILTIIPF  +    F DK I+ +  + CA+ QI +HLV+FLH
Sbjct: 1   MNNNNSNTSYFIGFVLSLILTIIPFYTIQYNIF-DKKILLIITISCALIQIYIHLVYFLH 59

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +    +  W I ++IFTI +V I  +GS+W+M HL++N+M
Sbjct: 60  LIHISDRKWIITSLIFTIFIVFILVLGSVWIMTHLHHNLM 99


>gi|167570631|ref|ZP_02363505.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis C6786]
          Length = 110

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+    ++GT    + GF+LS++LT   FG+VM G    +  +    VL  + QI+VHLV
Sbjct: 6   HSHGDEAHGTVGGYIAGFMLSVLLTAASFGLVMGGVLPPREALVSLAVLAGV-QIVVHLV 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +FLHM+T     W++MA  +T++   I   G++WVM+++N NMMS
Sbjct: 65  YFLHMNTSSSQRWNVMAFSYTVLTALILIFGTLWVMHNVNMNMMS 109


>gi|325921009|ref|ZP_08182892.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas gardneri ATCC
           19865]
 gi|325548516|gb|EGD19487.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas gardneri ATCC
           19865]
          Length = 111

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I L A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVIVISLMAAVQMLVHMVYFLHMDRS 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|312961436|ref|ZP_07775939.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
 gi|311284331|gb|EFQ62909.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
          Length = 112

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           K  +IH+    S+G+ +  LVGF++S++LT+IPFG+ M    L + +    +V     QI
Sbjct: 3   KQSSIHSSAGTSHGSSRSYLVGFVVSVLLTLIPFGLAMFPS-LPRTVTAWLVVALGAIQI 61

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHL FFLH+ T  E  W+++A+IF+ +++ +    S+W+M  +++NM++
Sbjct: 62  VVHLKFFLHLDTAQEQRWNLIALIFSAVIIVLLVGLSLWIMNSIHHNMLA 111


>gi|260769714|ref|ZP_05878647.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio furnissii CIP
           102972]
 gi|260615052|gb|EEX40238.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio furnissii CIP
           102972]
 gi|315182290|gb|ADT89203.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio furnissii NCTC
           11218]
          Length = 104

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 2/102 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H    K   + GFI SLILTIIPF  V     L + +    +  CAI Q+ VH V+FL
Sbjct: 3   NQHVDSGKSDYIKGFIASLILTIIPFYFVATQS-LPEAVTFALMFGCAIVQVFVHFVYFL 61

Query: 70  HMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HM T+ EDG W++++++FT ++V I   GS+W+M++LN NMM
Sbjct: 62  HMETRTEDGRWNLVSLMFTALVVLILIGGSIWIMWNLNINMM 103


>gi|315500561|ref|YP_004089363.1| cytochrome o ubiquinol oxidase subunit IV [Asticcacaulis
           excentricus CB 48]
 gi|315418573|gb|ADU15212.1| cytochrome o ubiquinol oxidase subunit IV [Asticcacaulis
           excentricus CB 48]
          Length = 147

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           + + K  L+GF LS+ILT IPF + M        ++ + ++L  I QI+VHL +FLHM++
Sbjct: 42  HASVKDYLIGFSLSVILTAIPFALTMLKLLPAATLVPVILILGVI-QIVVHLRYFLHMNS 100

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W+ +A IFT I+V I  VGS+WVM HLN+NM  
Sbjct: 101 SSSQVWNNLAFIFTAIIVGILIVGSLWVMTHLNHNMAP 138


>gi|187919715|ref|YP_001888746.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia
           phytofirmans PsJN]
 gi|187718153|gb|ACD19376.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia
           phytofirmans PsJN]
          Length = 110

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+      GFILS++LT+  FG+VM G    +N +     L  + QI+
Sbjct: 2   DHSHNAHAGESHGSIGSYTTGFILSVVLTVAAFGLVMTGTLTGENALLAIAGLALV-QIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHL+FFLH++T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLIFFLHLNTSSEQRWNVMAFAFTLLTAVIVIGGTLWVMHNVSMHMMS 109


>gi|167581212|ref|ZP_02374086.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis TXDOH]
          Length = 108

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    + GF+LS++LT   FG+VM G    +  +    VL A+ QI+VHLV+FLHM+
Sbjct: 10  AHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREALVSLAVLAAV-QIVVHLVYFLHMN 68

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++MA  +T++   I   G++WVM++++ NMMS
Sbjct: 69  TSSSQRWNVMAFSYTVLTALILIFGTVWVMHNVSMNMMS 107


>gi|194364921|ref|YP_002027531.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
 gi|194347725|gb|ACF50848.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
          Length = 113

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 75/113 (66%), Gaps = 4/113 (3%)

Query: 1   MKYDN---IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +DN    H     S+G+ K  L+GF+L+++LT+IPF +VM G F  + +  + I + A
Sbjct: 1   MAHDNHAHDHAAGGESHGSVKSYLIGFVLAVVLTVIPFWMVMSGDF-SRTVNGVVIAITA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + Q++VHLVFFLH+    E  W++ A  FT++++ I  VG++WVM+++N +MM
Sbjct: 60  VLQMLVHLVFFLHLDRSSESRWNVNAAAFTVVVIGIIVVGTLWVMHNMNVHMM 112


>gi|53719988|ref|YP_108974.1| putative cytochrome o ubiquinol oxidase protein [Burkholderia
           pseudomallei K96243]
 gi|53725262|ref|YP_102390.1| ubiquinol oxidase subunit IV [Burkholderia mallei ATCC 23344]
 gi|67641797|ref|ZP_00440564.1| ubiquinol oxidase, subunit IV [Burkholderia mallei GB8 horse 4]
 gi|76809313|ref|YP_334220.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1710b]
 gi|121598783|ref|YP_993720.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124385820|ref|YP_001028822.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126440812|ref|YP_001059741.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 668]
 gi|126450472|ref|YP_001081267.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|126454810|ref|YP_001067026.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|134277478|ref|ZP_01764193.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|167001101|ref|ZP_02266902.1| ubiquinol oxidase, subunit IV [Burkholderia mallei PRL-20]
 gi|167720491|ref|ZP_02403727.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei DM98]
 gi|167744575|ref|ZP_02417349.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 14]
 gi|167816684|ref|ZP_02448364.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 91]
 gi|167846591|ref|ZP_02472099.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei B7210]
 gi|167895177|ref|ZP_02482579.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 7894]
 gi|167903561|ref|ZP_02490766.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei NCTC
           13177]
 gi|167911809|ref|ZP_02498900.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 112]
 gi|167919811|ref|ZP_02506902.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei BCC215]
 gi|217420541|ref|ZP_03452046.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|226199882|ref|ZP_03795432.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237813135|ref|YP_002897586.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|242314110|ref|ZP_04813126.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|254178120|ref|ZP_04884775.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|254184265|ref|ZP_04890855.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|254191300|ref|ZP_04897804.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|254195702|ref|ZP_04902128.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|254199289|ref|ZP_04905655.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|254205599|ref|ZP_04911951.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|254258458|ref|ZP_04949512.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|254296927|ref|ZP_04964380.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|254357761|ref|ZP_04974034.1| ubiquinol oxidase, subunit IV [Burkholderia mallei 2002721280]
 gi|52210402|emb|CAH36383.1| putative cytochrome o ubiquinol oxidase protein [Burkholderia
           pseudomallei K96243]
 gi|52428685|gb|AAU49278.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|76578766|gb|ABA48241.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710b]
 gi|121227593|gb|ABM50111.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124293840|gb|ABN03109.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126220305|gb|ABN83811.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei 668]
 gi|126228452|gb|ABN91992.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|126243342|gb|ABO06435.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|134251128|gb|EBA51207.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|147748885|gb|EDK55959.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|147753042|gb|EDK60107.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|148026888|gb|EDK84909.1| ubiquinol oxidase, subunit IV [Burkholderia mallei 2002721280]
 gi|157807091|gb|EDO84261.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|157938972|gb|EDO94642.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699159|gb|EDP89129.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|169652447|gb|EDS85140.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|184214796|gb|EDU11839.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|217395953|gb|EEC35970.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|225927938|gb|EEH23975.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237504955|gb|ACQ97273.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|238522785|gb|EEP86227.1| ubiquinol oxidase, subunit IV [Burkholderia mallei GB8 horse 4]
 gi|242137349|gb|EES23751.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|243063053|gb|EES45239.1| ubiquinol oxidase, subunit IV [Burkholderia mallei PRL-20]
 gi|254217147|gb|EET06531.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    + GF+LS++LT   FG+VM G    +  +    VL A+ QI+VHLV+FLHM+
Sbjct: 12  AHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREALVSLAVLAAV-QIVVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++MA  +T++   I   G++WVM+++  NMMS
Sbjct: 71  TSSSQRWNVMAFSYTVLTALILIFGTVWVMHNVGMNMMS 109


>gi|33519707|ref|NP_878539.1| cytochrome O ubiquinol oxidase subunit CyoD [Candidatus Blochmannia
           floridanus]
 gi|33504052|emb|CAD83313.1| cytochrome O ubiquinol oxidase subunit CyoD [Candidatus Blochmannia
           floridanus]
          Length = 100

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/94 (42%), Positives = 63/94 (67%), Gaps = 1/94 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K   +GFILSLI TIIPF I+    F ++    + ++ CAI QI +HL++FLH++     
Sbjct: 8   KHYCIGFILSLIFTIIPFYIIQHNCF-EQQTSYIIVIFCAITQIYIHLIYFLHLNQISNQ 66

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            W+++++IFT  +V I   GS+W+M HL++N+MS
Sbjct: 67  MWNVISLIFTTFIVLILITGSIWIMTHLHHNLMS 100


>gi|83718186|ref|YP_438682.1| ubiquinol oxidase subunit IV [Burkholderia thailandensis E264]
 gi|257141752|ref|ZP_05590014.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
 gi|83652011|gb|ABC36075.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
          Length = 110

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (64%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    + GFILS++LT   FG+V+ G  L  +   + + + A  QI+VHLV+FLHM+
Sbjct: 12  AHGTVGGYVAGFILSVLLTAASFGLVLSGA-LSSHASLIALAVLAFVQIVVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 71  GSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|21230619|ref|NP_636536.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769385|ref|YP_244147.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188992572|ref|YP_001904582.1| Cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. B100]
 gi|21112200|gb|AAM40460.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66574717|gb|AAY50127.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167734332|emb|CAP52542.1| Cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris]
          Length = 111

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVIVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|161524385|ref|YP_001579397.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia multivorans
           ATCC 17616]
 gi|189350860|ref|YP_001946488.1| cytochrome o ubiquinol oxidase protein [Burkholderia multivorans
           ATCC 17616]
 gi|221198370|ref|ZP_03571416.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2M]
 gi|221208953|ref|ZP_03581950.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2]
 gi|221215750|ref|ZP_03588710.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD1]
 gi|160341814|gb|ABX14900.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia multivorans
           ATCC 17616]
 gi|189334882|dbj|BAG43952.1| cytochrome o ubiquinol oxidase protein [Burkholderia multivorans
           ATCC 17616]
 gi|221164362|gb|EED96848.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD1]
 gi|221171236|gb|EEE03686.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2]
 gi|221182302|gb|EEE14703.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2M]
          Length = 110

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + + + A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGSYVAGFILSVLLTAASFGLVMGGV-LSPHASLVALAVLAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|71897568|ref|ZP_00679813.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|71732471|gb|EAO34524.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
          Length = 113

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT IPF IVM   F  +  + L   L A+ Q++VHLV+FLHM    E 
Sbjct: 21  KSYLIGFVLAVILTAIPFAIVMNRSFSKETTVALVSALAAV-QMLVHLVYFLHMDRSEEQ 79

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 80  RSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|289670391|ref|ZP_06491466.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 111

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVVVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|58581255|ref|YP_200271.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84623175|ref|YP_450547.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188575779|ref|YP_001912708.1| cytOchrome o ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|289662732|ref|ZP_06484313.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|58425849|gb|AAW74886.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84367115|dbj|BAE68273.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188520231|gb|ACD58176.1| cytOchrome o ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 111

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVVVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|28198530|ref|NP_778844.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           Temecula1]
 gi|182681209|ref|YP_001829369.1| cytochrome o ubiquinol oxidase subunit IV [Xylella fastidiosa M23]
 gi|28056614|gb|AAO28493.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           Temecula1]
 gi|182631319|gb|ACB92095.1| cytochrome o ubiquinol oxidase subunit IV [Xylella fastidiosa M23]
 gi|307579655|gb|ADN63624.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 113

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT IPF IVM   F  +  + L   L A+ Q++VHLV+FLHM    E 
Sbjct: 21  KSYLIGFVLAVILTAIPFAIVMNRSFSKETTVALVSALAAV-QMLVHLVYFLHMDRSKEQ 79

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 80  RSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|83719004|ref|YP_442317.1| ubiquinol oxidase subunit IV [Burkholderia thailandensis E264]
 gi|167619297|ref|ZP_02387928.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis Bt4]
 gi|257138514|ref|ZP_05586776.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
 gi|83652829|gb|ABC36892.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
          Length = 110

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    + GF+LS++LT   FG+VM G    +  +    VL A+ QI+VHLV+FLHM+
Sbjct: 12  AHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREALVSLAVLAAV-QIVVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++MA  +T +   I   G++WVM++++ NMMS
Sbjct: 71  TSSSQRWNVMAFSYTALTALILIFGTVWVMHNVSMNMMS 109


>gi|71274827|ref|ZP_00651115.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Dixon]
 gi|71899871|ref|ZP_00682020.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|170729928|ref|YP_001775361.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa M12]
 gi|71164559|gb|EAO14273.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Dixon]
 gi|71730388|gb|EAO32470.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|167964721|gb|ACA11731.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa M12]
          Length = 113

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT IPF IVM   F  +  + L   L A+ Q++VHLV+FLHM    E 
Sbjct: 21  KSYLIGFVLAVILTAIPFAIVMNRSFSKETTVALVSALAAV-QMLVHLVYFLHMDRSEEQ 79

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 80  RSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|325914849|ref|ZP_08177184.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538940|gb|EGD10601.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 111

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTIVVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|71892023|ref|YP_277753.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71796129|gb|AAZ40880.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 100

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 69/95 (72%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T+K  L+GF+LSL+LTI+PF +V     ++K I+   IV C+I QII+HL+FFLH+    
Sbjct: 6   TQKSYLIGFVLSLVLTIVPFFMVTHDT-INKKILINIIVFCSIMQIIIHLIFFLHLGNVS 64

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W+++++IFTI +V I  +GS+W+M HL++N+M
Sbjct: 65  NQAWNLISLIFTIFIVFILVLGSVWIMTHLHHNLM 99


>gi|21242014|ref|NP_641596.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|78046866|ref|YP_363041.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|294627029|ref|ZP_06705619.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294664345|ref|ZP_06729709.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325928656|ref|ZP_08189835.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas perforans
           91-118]
 gi|21107412|gb|AAM36132.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|78035296|emb|CAJ22941.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|292598691|gb|EFF42838.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292605885|gb|EFF49172.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325540984|gb|EGD12547.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas perforans
           91-118]
          Length = 111

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTIVVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|325522318|gb|EGD00930.1| ubiquinol oxidase, subunit IV [Burkholderia sp. TJI49]
          Length = 110

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + + + A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVLLTAASFGLVMGGV-LSPHASLVALAVLAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|78066842|ref|YP_369611.1| cytochrome C oxidase subunit IV [Burkholderia sp. 383]
 gi|77967587|gb|ABB08967.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia sp. 383]
          Length = 110

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + + + A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVLLTAASFGLVMGGV-LSPHASLIALAVLAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|163857014|ref|YP_001631312.1| cytochrome 0 ubiquinol oxidase [Bordetella petrii DSM 12804]
 gi|163260742|emb|CAP43044.1| Predicted cytochrome 0 ubiquinol oxidase [Bordetella petrii]
          Length = 120

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 68/114 (59%), Gaps = 5/114 (4%)

Query: 1   MKYDNI----HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLC 56
           M +D I    H  +  ++GT K  LVGF LS++LT+  FG+VM G       M   IVLC
Sbjct: 1   MSHDTIAAADHGHDDAAHGTLKSYLVGFGLSILLTLASFGLVMSGAVPRSLAMPGIIVLC 60

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +AQ++V LV+FLHM        ++ A +F + ++AI   GS WV++++N NMM
Sbjct: 61  -VAQLLVQLVYFLHMGASRSQRDNLSAFVFAVFVIAIIVGGSAWVLHNMNANMM 113


>gi|166713085|ref|ZP_02244292.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 111

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 64/96 (66%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G  K  L+GF++++ILT+IPF +VM G F  K +    I + A  Q++VH+V+FLHM   
Sbjct: 16  GGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVTVISVMAAVQMLVHMVYFLHMDRT 74

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 75  PEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|15837988|ref|NP_298676.1| cytochrome O ubiquinol oxidase, subunit IV [Xylella fastidiosa
           9a5c]
 gi|9106395|gb|AAF84196.1|AE003970_3 cytochrome O ubiquinol oxidase, subunit IV [Xylella fastidiosa
           9a5c]
          Length = 113

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 62/93 (66%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L+GF+L++ILT IPF IVM   F  +  + L   L A+ Q++VHLV+FLHM    E 
Sbjct: 21  KSYLIGFVLAVILTAIPFAIVMNRSFSKETSVALVSALAAV-QMLVHLVYFLHMDRSKEQ 79

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 80  RSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|134296911|ref|YP_001120646.1| cytochrome C oxidase subunit IV [Burkholderia vietnamiensis G4]
 gi|134140068|gb|ABO55811.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia vietnamiensis
           G4]
          Length = 110

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT +  +VGF+LS++LT   FG+VM G    K    + + + A AQI+VHLV FLHM+
Sbjct: 12  AHGTARGYVVGFVLSVLLTAASFGLVMAGVLAPK-AAVIALAVLAFAQILVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++MA  +T++   I  VG++WVM++++ NMMS
Sbjct: 71  TASSQRWNVMAFSYTVLTALILIVGTLWVMHNVSMNMMS 109


>gi|107028752|ref|YP_625847.1| cytochrome C oxidase subunit IV [Burkholderia cenocepacia AU 1054]
 gi|116690089|ref|YP_835712.1| cytochrome C oxidase subunit IV [Burkholderia cenocepacia HI2424]
 gi|170733423|ref|YP_001765370.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia cenocepacia
           MC0-3]
 gi|206560505|ref|YP_002231269.1| cytochrome O ubiquinol oxidase protein [Burkholderia cenocepacia
           J2315]
 gi|254247836|ref|ZP_04941157.1| Heme/copper-type cytochrome/quinol oxidase [Burkholderia
           cenocepacia PC184]
 gi|105897916|gb|ABF80874.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia cenocepacia
           AU 1054]
 gi|116648178|gb|ABK08819.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia cenocepacia
           HI2424]
 gi|124872612|gb|EAY64328.1| Heme/copper-type cytochrome/quinol oxidase [Burkholderia
           cenocepacia PC184]
 gi|169816665|gb|ACA91248.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia cenocepacia
           MC0-3]
 gi|198036546|emb|CAR52443.1| cytochrome O ubiquinol oxidase protein [Burkholderia cenocepacia
           J2315]
          Length = 110

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + + + A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVLLTAASFGLVMGGV-LSPHASLIGLAVLAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAIVIVGTLWVMHNVSMNMMS 109


>gi|300690265|ref|YP_003751260.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           PSI07]
 gi|299077325|emb|CBJ49951.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           PSI07]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 61/86 (70%), Gaps = 1/86 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT+IPF +VM G F    ++  T++  A+ QI+VHL++FLH+    
Sbjct: 26  TVKGYLIGFVLAVILTVIPFKMVMGGGFSHGTVLV-TVMALAVVQIVVHLIYFLHLDGSS 84

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWV 101
              W++MA +FT++++AI  VGS+WV
Sbjct: 85  SQRWNVMAFLFTLLILAIVIVGSLWV 110


>gi|238759271|ref|ZP_04620438.1| hypothetical protein yaldo0001_8190 [Yersinia aldovae ATCC 35236]
 gi|238702558|gb|EEP95108.1| hypothetical protein yaldo0001_8190 [Yersinia aldovae ATCC 35236]
          Length = 80

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 1/78 (1%)

Query: 33  IPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVA 92
           IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+ K E+ W+++A +FT +++A
Sbjct: 2   IPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGKSEERWNLVAFLFTAMIIA 60

Query: 93  ICFVGSMWVMYHLNNNMM 110
           I  VGS+W+MY+LN NMM
Sbjct: 61  IVVVGSLWIMYNLNINMM 78


>gi|90409892|ref|ZP_01217909.1| hypothetical protein P3TCK_03976 [Photobacterium profundum 3TCK]
 gi|90329245|gb|EAS45502.1| hypothetical protein P3TCK_03976 [Photobacterium profundum 3TCK]
          Length = 103

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 63/101 (62%), Gaps = 1/101 (0%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H+  +      GFI SL+LTIIPF        L   +  + +  CAI Q++VHLV+FL
Sbjct: 3   NQHAQSSMNGYTKGFIGSLVLTIIPFYFAATKM-LPHAVTLVILFACAIVQVVVHLVYFL 61

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HM    +  W++++++FT I+V I   GS+W+M++LN+NMM
Sbjct: 62  HMDRSEKGQWNLLSLVFTGIVVFILIAGSLWIMWNLNHNMM 102


>gi|170723534|ref|YP_001751222.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida W619]
 gi|169761537|gb|ACA74853.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida W619]
          Length = 110

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 69/109 (63%), Gaps = 4/109 (3%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D  H  N   +G+ K  ++GF+LS+ILT IPFG+VM    L KN+  L +V  A+ Q++
Sbjct: 5   HDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLVMYPS-LPKNLTVLIVVAMAVIQVV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  MM+
Sbjct: 61  VHLVYFLHMDRSKEQRSNVSTFLFTTMVIALLVGLSLWIMFSIHYEMMA 109


>gi|94498851|ref|ZP_01305392.1| Prokaryotic Cytochrome C oxidase subunit IV [Sphingomonas sp.
           SKA58]
 gi|94421692|gb|EAT06752.1| Prokaryotic Cytochrome C oxidase subunit IV [Sphingomonas sp.
           SKA58]
          Length = 85

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 49/66 (74%)

Query: 51  LTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           L I+  A  Q++VH+++FLHM+++VE GWS MAM+ TI++V I   GSMWVMYHLN NMM
Sbjct: 1   LLILAFAAVQVVVHMIYFLHMNSRVEGGWSFMAMMLTIVLVVIVLSGSMWVMYHLNANMM 60

Query: 111 SMEGMR 116
               M+
Sbjct: 61  PHADMQ 66


>gi|70732058|ref|YP_261814.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens
           Pf-5]
 gi|68346357|gb|AAY93963.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           Pf-5]
          Length = 112

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+++  LVGF LSL+LT+IPF +VM    L +N+    +V   + QI+VHL +FLH+ T
Sbjct: 15  HGSRRSYLVGFALSLVLTLIPFALVMYPS-LPRNVTLWAVVGLGMIQILVHLRYFLHLDT 73

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
             E  W++ A+IF+ +++ +    S+W+M  +++NM++
Sbjct: 74  ATEQRWNLTALIFSAVVIFLLVGLSLWIMNSIHHNMLA 111


>gi|104780180|ref|YP_606678.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas entomophila
           L48]
 gi|95109167|emb|CAK13864.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas entomophila
           L48]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 70/109 (64%), Gaps = 4/109 (3%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D  H  N   +G+ K  ++GF+LS+ILT IPFG+VM    L KN+  L +V  A+ Q++
Sbjct: 5   HDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLVMFPS-LPKNLTVLVVVAMAVIQVV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLHM    E   ++   +FT++++A+    S+W+M+ ++  M++
Sbjct: 61  VHLVYFLHMDRSKEQRSNVSTFLFTVLVIALLVGLSLWIMFSIHFEMLA 109


>gi|167589186|ref|ZP_02381574.1| Cytochrome C oxidase subunit IV [Burkholderia ubonensis Bu]
          Length = 110

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 65/98 (66%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+V+ G     +   + + + A+ QI+VHLV+FLHM++
Sbjct: 13  HGSVGGYIAGFILSVLLTAASFGLVLGGV-QSPHASLIALAVLALVQIVVHLVYFLHMNS 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|91225752|ref|ZP_01260781.1| hypothetical protein V12G01_07168 [Vibrio alginolyticus 12G01]
 gi|91189641|gb|EAS75916.1| hypothetical protein V12G01_07168 [Vibrio alginolyticus 12G01]
          Length = 103

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H   +    + GFI SLILT+IPF  V      D     + +  CA+ QI VH  +F
Sbjct: 1   MDQHVETSSSDYVKGFIASLILTVIPFYFVWTKSLPDTTTYAI-LFGCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM TK  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMETKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|262396851|ref|YP_003288704.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio sp. Ex25]
 gi|262340445|gb|ACY54239.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio sp. Ex25]
          Length = 103

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H   +    + GFI SLILT+IPF  V      D     + +  CA+ QI VH  +F
Sbjct: 1   MDQHVETSASDYVKGFIASLILTVIPFYFVWTKSLPDTTTYAI-LFGCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM TK  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMETKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|296115138|ref|ZP_06833779.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978239|gb|EFG84976.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 110

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
            S+G+    L GF++S++LT   FG+VM   F     M   I L A+ QI+VHL+FFLHM
Sbjct: 11  ESHGSVGSYLTGFVISVLLTAAAFGLVMAHTFSPSGTMG-AITLLAVVQIVVHLIFFLHM 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +   E  W+IMA  FT++ V I   G++++M+  + NMMS
Sbjct: 70  NGSSEQRWNIMAFAFTVVTVLILVGGTIFIMHDTSINMMS 109


>gi|209518753|ref|ZP_03267568.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. H160]
 gi|209500795|gb|EEA00836.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. H160]
          Length = 113

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 66/112 (58%), Gaps = 5/112 (4%)

Query: 4   DNIHNMN-MHS---YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           D+ HN +  HS   +G+      GF+LS+ILT+  F IVM G    ++ +   I   A  
Sbjct: 2   DHSHNAHGAHSEGGHGSFGSYTAGFVLSVILTVAAFAIVMTGTLTGQSAL-FAIAGLAFV 60

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHLVFFLHM+T     W++ A  FT +   I   G++WVM++++ NMMS
Sbjct: 61  QILVHLVFFLHMNTSSSQRWNVTAFAFTALTAVIVIGGTLWVMHNVSMNMMS 112


>gi|167585492|ref|ZP_02377880.1| cytochrome C oxidase subunit IV [Burkholderia ubonensis Bu]
          Length = 110

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    +VGF+LS++LT   FG+VM G    K    + + + A AQI+VHLV FLHM+
Sbjct: 12  AHGTAGGYIVGFVLSVLLTAASFGLVMGGVLAPK-AAVIALAVLAFAQILVHLVCFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           T     W++MA  +T++   I  VG++WVM++++ NMMS
Sbjct: 71  TSSSQRWNVMAFSYTVLTALILIVGTLWVMHNVSMNMMS 109


>gi|26987551|ref|NP_742976.1| cytochrome o ubiquinol oxidase, protein CyoD [Pseudomonas putida
           KT2440]
 gi|148546082|ref|YP_001266184.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida F1]
 gi|325275995|ref|ZP_08141820.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas sp. TJI-51]
 gi|24982224|gb|AAN66440.1|AE016273_9 cytochrome o ubiquinol oxidase, protein CyoD [Pseudomonas putida
           KT2440]
 gi|18149144|dbj|BAB83596.1| cytochrome o oxidase D [Pseudomonas putida]
 gi|42795026|gb|AAS45859.1| CyoD [Pseudomonas putida]
 gi|148510140|gb|ABQ77000.1| Cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida F1]
 gi|313497178|gb|ADR58544.1| CyoD [Pseudomonas putida BIRD-1]
 gi|324098876|gb|EGB96897.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas sp. TJI-51]
          Length = 110

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D  H  N   +G+ K  ++GF+LS+ILT IPFG+ M    L KN+  L IV  A+ Q++
Sbjct: 5   HDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLAMTAS-LPKNLTVLIIVAMAVIQVV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 61  VHLVYFLHMDRSKEQRNNVSTFLFTTLVIALLVGLSLWIMFSIHFEMLA 109


>gi|238783618|ref|ZP_04627639.1| hypothetical protein yberc0001_14010 [Yersinia bercovieri ATCC
           43970]
 gi|238715496|gb|EEQ07487.1| hypothetical protein yberc0001_14010 [Yersinia bercovieri ATCC
           43970]
          Length = 80

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 56/78 (71%), Gaps = 1/78 (1%)

Query: 33  IPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVA 92
           IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT +++A
Sbjct: 2   IPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFTAMIIA 60

Query: 93  ICFVGSMWVMYHLNNNMM 110
           I  VGS+W+MY+LN NMM
Sbjct: 61  IVVVGSLWIMYNLNINMM 78


>gi|167031867|ref|YP_001667098.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida GB-1]
 gi|166858355|gb|ABY96762.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida GB-1]
          Length = 110

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D  H  N   +G+ K  ++GF+LS+ILT IPFG+ M    L KN+  L IV  A+ Q++
Sbjct: 5   HDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLAMTAS-LPKNLTVLIIVAMAVIQVV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 61  VHLVYFLHMDRSKEQRNNVSTFLFTTMVIALLVGLSLWIMFSIHFEMLA 109


>gi|190576212|ref|YP_001974057.1| putative cytochrome O ubiquinol oxidase subunit IV
           [Stenotrophomonas maltophilia K279a]
 gi|190014134|emb|CAQ47773.1| putative cytochrome O ubiquinol oxidase subunit IV
           [Stenotrophomonas maltophilia K279a]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +++G+ K  L+GF+L  +LT++PF +VM    L + +    +V  A+AQI+V LV+FLHM
Sbjct: 11  NAHGSTKSYLIGFVLCALLTVVPFALVMNPL-LSRPLTLFLLVGFAVAQILVQLVYFLHM 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 70  DRKSEGGWNLASFVFTLVILFIIVALSVWIIWSMHYHMM 108


>gi|295699447|ref|YP_003607340.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
 gi|295438660|gb|ADG17829.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
          Length = 113

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 60/98 (61%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GF+LS+ILT+  F IVM G  L  +     I   A+ QI+VHLVFFLHM+ 
Sbjct: 16  HGSFGSYMTGFVLSVILTVAAFAIVMTGT-LTGHSALFAIAGLAVVQILVHLVFFLHMNA 74

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++ A +FT +   I   G++WVM++++ NMMS
Sbjct: 75  SSSQRWNVTAFVFTALTAVIVVGGTLWVMHNVSMNMMS 112


>gi|8134389|sp|Q9WWR4|CYOD_PSEPU RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit IV
 gi|4586340|dbj|BAA76359.1| cytochrome o ubiquinol oxidase D [Pseudomonas putida]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 68/109 (62%), Gaps = 4/109 (3%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D  H  N   +G+ K  ++GFILS+ILT IPFG+ M    L KN+  L IV  A+ Q++
Sbjct: 5   HDTHHEGN---HGSVKSYMIGFILSIILTAIPFGLAMSPS-LPKNLTVLIIVAMAVIQVV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 61  VHLVYFLHMDRSKEQRNNVWTFLFTTLVIALLVGLSLWIMFSIHFEMLA 109


>gi|167566667|ref|ZP_02359583.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis EO147]
 gi|167573742|ref|ZP_02366616.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis C6786]
          Length = 110

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++GT    + GFILS++LT   FG+V+ G  L  +   + +   A  QI+VHLV+FLHM+
Sbjct: 12  AHGTVGGYVAGFILSVLLTAASFGLVLSGA-LSSHASLIALAALAFVQIVVHLVYFLHMN 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 71  ASSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|194367564|ref|YP_002030174.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
 gi|194350368|gb|ACF53491.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
          Length = 110

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 67/99 (67%), Gaps = 1/99 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +++G+ K  L+GF+L  +LT++PF +VM    L + +    +V  A+AQI+V LV+FLHM
Sbjct: 11  NAHGSTKSYLIGFVLCALLTVVPFALVMNPV-LSRPLTLFLLVGFAVAQILVQLVYFLHM 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 70  DRKSEGGWNLASFVFTLVILFIVVALSVWIIWSMHYHMM 108


>gi|33595747|ref|NP_883390.1| cytochrome 0 ubiquinol oxidase [Bordetella parapertussis 12822]
 gi|33565826|emb|CAE36371.1| cytochrome 0 ubiquinol oxidase [Bordetella parapertussis]
          Length = 115

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ K  L+GF +SL+LT   FG+VM G       +   +VLC +AQ++V LVFFLHM 
Sbjct: 14  NHGSLKSYLIGFAISLVLTFGSFGLVMAGTVPRSIALAGVVVLC-VAQLLVQLVFFLHMG 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              +   ++   +FTI+++AI   GS+WV++++N NMM
Sbjct: 73  GSKKQRDNVTTFVFTILIIAIIVGGSVWVLHNMNANMM 110


>gi|90579540|ref|ZP_01235349.1| cytochrome o ubiquinol oxidase subunit IV [Vibrio angustum S14]
 gi|90439114|gb|EAS64296.1| cytochrome o ubiquinol oxidase subunit IV [Vibrio angustum S14]
          Length = 112

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/110 (40%), Positives = 73/110 (66%), Gaps = 1/110 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H     ++G+ K+ L G ILS+ILT++PF +VM G    K ++   I++ A+AQ
Sbjct: 1   MANSSEHGQGGQAHGSVKEYLNGLILSIILTVVPFVMVMAGIG-SKPLIIGVIMVFAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I V LV+FLHM+T  +  W+  + +F +++VAI  +GS+W+M HLN+NM+
Sbjct: 60  IFVQLVYFLHMNTSSKQMWNTSSAVFVVVIVAIILIGSLWIMEHLNHNML 109


>gi|89073979|ref|ZP_01160485.1| cytochrome o ubiquinol oxidase subunit IV [Photobacterium sp.
           SKA34]
 gi|89050307|gb|EAR55811.1| cytochrome o ubiquinol oxidase subunit IV [Photobacterium sp.
           SKA34]
          Length = 112

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 72/110 (65%), Gaps = 1/110 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H     ++G+ K+ L G ILS+ILT++PF +VM G    K ++   I++ A+AQ
Sbjct: 1   MANSSEHGQGGQAHGSVKEYLNGLILSIILTVVPFAMVMAGIG-SKPLIIGVIMVFAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I V LV+FLHM+   +  W+  + +F +++VAI  +GS+W+M HLN+NM+
Sbjct: 60  IFVQLVYFLHMNASSKQMWNTSSAVFVVVIVAIILIGSLWIMEHLNHNML 109


>gi|172061019|ref|YP_001808671.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MC40-6]
 gi|171993536|gb|ACB64455.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MC40-6]
          Length = 110

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + +   A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVVLTAASFGLVMGGV-LSPHASLIALAALAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|325161734|gb|ADY89613.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens]
          Length = 111

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 5   NIHNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           N H+ + H  S+G+ K   +GFILS+ILT+IPFG+VM    L K++    ++  A+ Q++
Sbjct: 3   NAHSHDSHDASHGSVKSYAIGFILSVILTVIPFGLVMYPS-LPKSLTLWIVLAFAVIQVL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLH+        +++A +F  I++ +    S+W+M+ ++ NMM+
Sbjct: 62  VHLVYFLHLDRSAAQRNNVIAFVFAAIVIVLLVGLSLWIMFSIHTNMMA 110


>gi|33593868|ref|NP_881512.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33600272|ref|NP_887832.1| cytochrome 0 ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|33563941|emb|CAE43202.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33567870|emb|CAE31784.1| cytochrome 0 ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|332383287|gb|AEE68134.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis CS]
          Length = 115

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+ K  L+GF +SL+LT   FG+VM G       +   +VLC +AQ++V LVFFLHM 
Sbjct: 14  DHGSLKSYLIGFAISLVLTFGSFGLVMAGTVPRGIALAGVVVLC-VAQLLVQLVFFLHMG 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              +   ++   +FTI+++AI   GS+WV++++N NMM
Sbjct: 73  GSKKQRDNVTTFVFTILIIAIIVGGSVWVLHNMNANMM 110


>gi|148978616|ref|ZP_01815043.1| hypothetical protein VSWAT3_04531 [Vibrionales bacterium SWAT-3]
 gi|145962282|gb|EDK27564.1| hypothetical protein VSWAT3_04531 [Vibrionales bacterium SWAT-3]
          Length = 103

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H     K  ++GF+ SLILTIIPF +V     L      + +  CA+ QI VH  +F
Sbjct: 1   MEQHLDSGAKDYVIGFVASLILTIIPFYVVW-AHALPSTETYVVLFGCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTTDGQWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|170701549|ref|ZP_02892499.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           IOP40-10]
 gi|170133543|gb|EDT01921.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           IOP40-10]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 64/98 (65%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + +   A+ QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVLLTAASFGLVMGGV-LSPHASLIALAALALVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|115352155|ref|YP_773994.1| cytochrome C oxidase subunit IV [Burkholderia ambifaria AMMD]
 gi|171318688|ref|ZP_02907832.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MEX-5]
 gi|254252017|ref|ZP_04945335.1| cytochrome o ubiquinol oxidase [Burkholderia dolosa AUO158]
 gi|115282143|gb|ABI87660.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia ambifaria
           AMMD]
 gi|124894626|gb|EAY68506.1| cytochrome o ubiquinol oxidase [Burkholderia dolosa AUO158]
 gi|171096123|gb|EDT41048.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MEX-5]
          Length = 110

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/98 (40%), Positives = 63/98 (64%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+    + GFILS++LT   FG+VM G  L  +   + +   A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYVAGFILSVLLTAASFGLVMGGV-LSPHASLIALAALAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|301058564|ref|ZP_07199569.1| cytochrome o ubiquinol oxidase, subunit IV [delta proteobacterium
           NaphS2]
 gi|300447296|gb|EFK11056.1| cytochrome o ubiquinol oxidase, subunit IV [delta proteobacterium
           NaphS2]
          Length = 109

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 64/96 (66%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ +  + GF+LS++LT+IPF +VM G  + ++++   I    I QI +HL +FLH+ T 
Sbjct: 14  GSLRTYISGFVLSVVLTVIPFALVMGGG-VPRSVVIWGICGAGIVQIFIHLHYFLHLDTS 72

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
               W++MA++FT++++ I   G++WVM  LN+ MM
Sbjct: 73  SAARWNVMALVFTLLIIFIFVGGTVWVMVTLNSRMM 108


>gi|186472798|ref|YP_001860140.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184195130|gb|ACC73094.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 114

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 62/100 (62%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
            ++G+    ++GF+LS+ILT   FG+V+ G+      +   I    + QI+VHLV+FLHM
Sbjct: 15  ENHGSFGSYMIGFVLSVILTAAAFGVVLAGWATGTQAL-YAIAGLGLVQIVVHLVYFLHM 73

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +T     W++ A  FT++   I   G++WVM++++ NMMS
Sbjct: 74  NTSSGQRWNVTAFAFTVLTAVIVIGGTLWVMHNVSMNMMS 113


>gi|330811629|ref|YP_004356091.1| cytochrome o subunit VI [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379737|gb|AEA71087.1| Cytochrome o subunit VI [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 111

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 5   NIHNMNMHS--YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           N H+ + H   +G+ K   +GFILS+ILT+IPFG+VM    L K++    +++ A+ Q++
Sbjct: 3   NAHSHDGHDAGHGSVKSYAIGFILSVILTVIPFGLVMYPS-LPKSLTLWIVLIFAVVQVL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLH+        +++A +F  I++ +    S+W+M+ ++ NMM+
Sbjct: 62  VHLVYFLHLDRSAAQRNNVVAFVFAAIVIVLLVGLSLWIMFSIHTNMMA 110


>gi|94314709|ref|YP_587918.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|93358561|gb|ABF12649.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
          Length = 121

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 39/103 (37%), Positives = 64/103 (62%), Gaps = 1/103 (0%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ +  L+G+ LS++LT++ FG VM G       + + ++LC IAQ++V LVFFLH+ 
Sbjct: 12  SHGSIRSHLIGYGLSVVLTLVSFGAVMSGVLPPGYGLAVIVLLC-IAQLLVQLVFFLHLG 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
            +     +      T+ ++AI   GS+WVM++ N NMM M+ M
Sbjct: 71  PRKGQRGNTAIFACTVFLIAIVVSGSLWVMHNANLNMMPMQSM 113


>gi|77460866|ref|YP_350373.1| cytochrome C oxidase subunit IV [Pseudomonas fluorescens Pf0-1]
 gi|77384869|gb|ABA76382.1| cytochrome bo3 quinol oxidase subunit 4 [Pseudomonas fluorescens
           Pf0-1]
          Length = 111

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 5   NIHNMNMHS--YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           N H+ + H   +G+ K   +GFILS+ILT+IPFG+VM    L K+     ++L A+ Q+I
Sbjct: 3   NAHSHDSHDAGHGSVKSYAIGFILSVILTVIPFGLVMYPT-LPKSTTLAIVLLFAVIQVI 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHL +FLH+   +    +++A +FT I++ +    S+W+M+ ++  MM+
Sbjct: 62  VHLYYFLHLDRSIAQRNNVIAFVFTAIVIVLLVGLSLWIMFSIHTYMMA 110


>gi|153837559|ref|ZP_01990226.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio parahaemolyticus
           AQ3810]
 gi|149749056|gb|EDM59867.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio parahaemolyticus
           AQ3810]
 gi|328470437|gb|EGF41348.1| hypothetical protein VP10329_06552 [Vibrio parahaemolyticus 10329]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF  V     L  +   + +  CA+ QI VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYFVWAQT-LPASTTYVVMFTCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKTSDGRWNLVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|254524619|ref|ZP_05136674.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
 gi|219722210|gb|EED40735.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
          Length = 110

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 66/99 (66%), Gaps = 1/99 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +++G+    L+GF+L  +LT++PF +VM    L + +    +V  A+AQI+V LV+FLHM
Sbjct: 11  NAHGSTTSYLIGFVLCALLTVVPFALVMNPV-LSRPLTLFLLVGFAVAQILVQLVYFLHM 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 70  DRKSEGGWNLASFVFTLVILFIVVALSVWIIWSMHYHMM 108


>gi|114327937|ref|YP_745094.1| cytochrome O ubiquinol oxidase protein cyoD [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316111|gb|ABI62171.1| cytochrome O ubiquinol oxidase protein cyoD [Granulibacter
           bethesdensis CGDNIH1]
          Length = 126

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 68/111 (61%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAI 58
           M   + H  + H  S+G+    ++GFILS+ILT   F IV     + ++++   +   A+
Sbjct: 1   MATAHAHGASDHGSSHGSVGSYIIGFILSVILTAAAFLIVAYKL-VPEHLILPGVAALAV 59

Query: 59  AQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
            QI+VHLVFFLHM+   E  W++ A +F+++++ I   GS+W+MY+L + M
Sbjct: 60  IQILVHLVFFLHMNASSEQRWNVTAFVFSVVVLLILVSGSIWIMYNLTSRM 110


>gi|260778346|ref|ZP_05887239.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260606359|gb|EEX32644.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H        + GF+ SLILT+IPF  V      D     L +  CA+ QI VH  +F
Sbjct: 1   MDQHLETGASDYVKGFVASLILTVIPFYFVWTQSLPDTTTYVL-LFGCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|28900485|ref|NP_800140.1| hypothetical protein VPA0630 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365638|ref|ZP_05778159.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           K5030]
 gi|260877438|ref|ZP_05889793.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AN-5034]
 gi|260898919|ref|ZP_05907360.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           Peru-466]
 gi|260901247|ref|ZP_05909642.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AQ4037]
 gi|28808865|dbj|BAC61973.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308089178|gb|EFO38873.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           Peru-466]
 gi|308090840|gb|EFO40535.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AN-5034]
 gi|308106803|gb|EFO44343.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AQ4037]
 gi|308111444|gb|EFO48984.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           K5030]
          Length = 103

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (59%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF  V     L  +   + +  CA+ QI VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYFVWAQT-LPASATYVVMFTCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKTSDGRWNLVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|134296073|ref|YP_001119808.1| cytochrome C oxidase subunit IV [Burkholderia vietnamiensis G4]
 gi|134139230|gb|ABO54973.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia vietnamiensis
           G4]
          Length = 110

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/98 (39%), Positives = 62/98 (63%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+      GFILS++LT   FG+V+ G  L  +   + +   A  QI+VHLV+FLHM+ 
Sbjct: 13  HGSVGGYFAGFILSVLLTAASFGLVLGGV-LSPHASLIALAALAFVQIVVHLVYFLHMNG 71

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 72  SSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|283850557|ref|ZP_06367845.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio sp.
           FW1012B]
 gi|283574128|gb|EFC22100.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio sp.
           FW1012B]
          Length = 107

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 61/95 (64%), Gaps = 1/95 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ +   VGF+LS++LT+IPF +VM G  L  +     +   AI QI+V L +FLH+ T 
Sbjct: 14  GSVRSYTVGFVLSVVLTVIPFALVMSGA-LSPSATVFCVFAAAIVQIVVQLHYFLHLDTS 72

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               W++++++FT++++ +   GS+WVMY L+  M
Sbjct: 73  SGMHWNLLSLVFTVLIMTLFIGGSIWVMYSLHYRM 107


>gi|329296774|ref|ZP_08254110.1| Cytochrome o ubiquinol oxidase protein cyoD [Plautia stali
           symbiont]
          Length = 91

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 66/91 (72%), Gaps = 1/91 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GFILS+ILT IPF +VM G      I+ + +V   +  + VHLV+FLH+ +K E GW+
Sbjct: 1   MIGFILSIILTAIPFWMVMDGSASHGTILGVVLVCAVVQVL-VHLVYFLHLDSKSEGGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++A++F+ +++ I  +GS+W+M++LN NMM+
Sbjct: 60  MVAIVFSAVIILIVVIGSLWIMWNLNYNMMA 90


>gi|332307456|ref|YP_004435307.1| cytochrome o ubiquinol oxidase subunit IV [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174785|gb|AEE24039.1| cytochrome o ubiquinol oxidase subunit IV [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 105

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 65/104 (62%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+    ++G+ K  LVGF+LS+ILT IPF +VM G F  K+++  ++V  AI QI+VHL 
Sbjct: 3   HSAETTAHGSVKSYLVGFVLSVILTGIPFWMVMSGHF-GKSVLFYSVVSFAIVQIVVHLK 61

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH+   V+      A +FT +++ +    S+W++Y  N  MM
Sbjct: 62  YFLHLDFSVKGRMDTFAFLFTALIIVMVVGLSIWIIYSANAMMM 105


>gi|229592521|ref|YP_002874640.1| cytochrome C oxidase (ubiquinol oxidase) subunit IV [Pseudomonas
           fluorescens SBW25]
 gi|229364387|emb|CAY52169.1| cytochrome C oxidase (ubiquinol oxidase) subunit IV [Pseudomonas
           fluorescens SBW25]
          Length = 113

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 69/105 (65%), Gaps = 1/105 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +  S+G+ K   +GFILS+ILT+IPFG+VM    L K+I  + ++  A+ Q++VHLV
Sbjct: 9   HDSHDASHGSVKSYAIGFILSVILTLIPFGLVMYPT-LPKSITLMIVLAFAVIQVLVHLV 67

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +FLH+    E   +++A +F  +++ +    S+W+M+ ++  MM+
Sbjct: 68  YFLHLDRSKEQRDNVIAFVFAGLVILLLVGLSIWIMFSIHTFMMA 112


>gi|294851454|ref|ZP_06792127.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294820043|gb|EFG37042.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 73

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 47/60 (78%)

Query: 53  IVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           ++  A  QI+VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 3   VLAIAAVQILVHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 62


>gi|109897618|ref|YP_660873.1| cytochrome C oxidase subunit IV [Pseudoalteromonas atlantica T6c]
 gi|109699899|gb|ABG39819.1| cytochrome bo3 quinol oxidase subunit 4 [Pseudoalteromonas
           atlantica T6c]
          Length = 105

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 66/104 (63%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+    ++G+ K  L+GF+LS+ILT IPF +VM G F  K+++  ++V  A+ QI+VHL 
Sbjct: 3   HSAEATAHGSVKSYLIGFVLSVILTAIPFWMVMSGHF-GKSVLFYSVVSFALVQIVVHLK 61

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH++  V+      A +FT +++ +    S+W++Y  N  MM
Sbjct: 62  YFLHLNFSVKGRLDTFAFLFTALIIVMVVGLSIWIIYSANAMMM 105


>gi|312962953|ref|ZP_07777439.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
 gi|311282722|gb|EFQ61317.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
          Length = 111

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 70/109 (64%), Gaps = 3/109 (2%)

Query: 5   NIHNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           N H+ + H  S+G+ K   +GFILS+ILT+IPFG+VM    L K+I  + ++  A+ Q++
Sbjct: 3   NAHSHDSHDASHGSVKSYAIGFILSVILTLIPFGLVMYPT-LPKSITLMIVLAFAVIQVL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLV+FLH+        +++A +F  +++ +    S+W+M+ ++  MM+
Sbjct: 62  VHLVYFLHLDRSEAQRENVIAFVFAGLVIVLLVGLSLWIMFSIHTYMMA 110


>gi|84386634|ref|ZP_00989660.1| hypothetical protein V12B01_00852 [Vibrio splendidus 12B01]
 gi|84378440|gb|EAP95297.1| hypothetical protein V12B01_00852 [Vibrio splendidus 12B01]
          Length = 103

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILTIIPF IV     L      + +  CA+ QI VH  +F
Sbjct: 1   MEQHLDSGATDYVKGFIASLILTIIPFYIVW-AHVLPSTETYVILFGCALVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  DG W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKSSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|186472485|ref|YP_001859827.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184194817|gb|ACC72781.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 113

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 1   MKYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M + N H ++  + +G     +VGF+L+++LT   FGIVM+G+ L      L +   A+ 
Sbjct: 1   MAHSNSHALDAEAGHGGIGGYVVGFVLAVVLTAAAFGIVMQGW-LPAAYAPLVLAALAVV 59

Query: 60  QIIVHLVFFLHMSTKVE-DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHLV FLHMS       W+ +A+ +T++       G++WVM++++ NMMS
Sbjct: 60  QIVVHLVCFLHMSVSTSGQRWNTLALAYTVLAAMFLVFGTVWVMHNVSMNMMS 112


>gi|89072118|ref|ZP_01158714.1| hypothetical protein SKA34_08788 [Photobacterium sp. SKA34]
 gi|89052219|gb|EAR57670.1| hypothetical protein SKA34_08788 [Photobacterium sp. SKA34]
          Length = 103

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 58/88 (65%), Gaps = 2/88 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG-WSI 81
           GFI SLI+T+IPF  V    F +     + ++ CAI QI VH  +FLHM  K  +G W+I
Sbjct: 15  GFIASLIITVIPFYCVWAKIFTEATTYAV-LLGCAIVQIFVHFKYFLHMEAKSSEGKWNI 73

Query: 82  MAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           ++++FT I+V I   GS+W++Y++N NM
Sbjct: 74  VSLMFTSIVVLILIAGSVWIIYNMNVNM 101


>gi|296444724|ref|ZP_06886687.1| cytochrome o ubiquinol oxidase subunit IV [Methylosinus
           trichosporium OB3b]
 gi|296257672|gb|EFH04736.1| cytochrome o ubiquinol oxidase subunit IV [Methylosinus
           trichosporium OB3b]
          Length = 378

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 66/105 (62%), Gaps = 4/105 (3%)

Query: 9   MNMHSYGTKKQCL---VGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           M+   +G ++  L   +GF+L+++LT   F +V   F     I+ + +V  AIAQI VHL
Sbjct: 17  MDAPGHGLREGLLTYSIGFVLAVLLTAASFYLVRTTFIWGPGII-MALVALAIAQIGVHL 75

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VFFLH++T  ++  + +A+ F +++V +   GS+W+M HL +N+M
Sbjct: 76  VFFLHLTTAPDNTNNALALAFGVLIVTLVVGGSLWIMSHLAHNVM 120


>gi|312881378|ref|ZP_07741175.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309371018|gb|EFP98473.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 103

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF +      L   +    +  CAI QI+VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYLAYTKA-LPNGVTYALLFGCAIVQILVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +G W+I+++ FT I+V I   GS+W++Y++  NM
Sbjct: 60  LHMEAKTSEGQWNIVSLAFTAIIVLILIAGSVWIIYNMTANM 101


>gi|17224969|gb|AAL37191.1|AF321090_3 cytochrome o ubiquinol oxidase D [Pseudomonas putida]
          Length = 111

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 68/109 (62%), Gaps = 3/109 (2%)

Query: 5   NIHNMNMHS--YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           N H+ + H   +G+ K   +GF LS+ILT+IPFG+VM    L K+     ++L A+ Q+I
Sbjct: 3   NAHSHDSHDAGHGSVKSYAIGFSLSVILTVIPFGLVMYPT-LPKSTTLAIVLLFAVIQVI 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHL +FLH+   +    +++A +FT I++ +    S+W+M+ ++  MM+
Sbjct: 62  VHLYYFLHLDRSIAQRNNVIAFVFTAIVIVLLVGLSLWIMFSIHTYMMA 110


>gi|46446826|ref|YP_008191.1| putative cytochrome O ubiquinol oxidase chain IV cyoD [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46400467|emb|CAF23916.1| putative cytochrome O ubiquinol oxidase chain IV cyoD [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 120

 Score = 72.0 bits (175), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 5/109 (4%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFF--LDKNIMCLTIVLCAIAQII 62
           N+ ++    +GT K  ++GF  SLILT++ F  V   FF  L    +  T++  A+ Q  
Sbjct: 6   NLDDVKKEWHGTIKSYVIGFTASLILTLLSFSFV---FFKILKGQDLVYTLIGFALTQTF 62

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           V LVFFLH+  + +  W  +A+ FTI+++ I  +GS+W+M+ LN  MM 
Sbjct: 63  VQLVFFLHIGQEPKPRWESIALGFTILILLIVVIGSLWIMHDLNERMMG 111


>gi|269964141|ref|ZP_06178438.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269831096|gb|EEZ85258.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 103

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILT+IPF  V      D     + +  CAI QI VH  +F
Sbjct: 1   MEQHLDTGASDYVKGFIASLILTVIPFYCVWAQVLPDTATYAV-LFGCAIVQIFVHFKYF 59

Query: 69  LHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +G W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTSEGQWNVVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|332532049|ref|ZP_08407932.1| cytochrome O ubiquinol oxidase, subunit IV [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038390|gb|EGI74834.1| cytochrome O ubiquinol oxidase, subunit IV [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 118

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (63%), Gaps = 2/99 (2%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+LS+ILT IPF +VM+G F  K     +IV  AI QI VHL +FLH++
Sbjct: 20  SHGSVKTYLIGFVLSVILTAIPFYMVMEGDF-SKATTLWSIVTLAIVQIWVHLKYFLHLN 78

Query: 73  TKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              EDG  S  + +F+ +++ +    S+W++Y  N  MM
Sbjct: 79  FTTEDGRASTFSFLFSALIIVMVVGLSVWIIYESNAMMM 117


>gi|58040344|ref|YP_192308.1| cytochrome o ubiquinol oxidase subunit IV [Gluconobacter oxydans
           621H]
 gi|58002758|gb|AAW61652.1| Cytochrome o ubiquinol oxidase subunit IV [Gluconobacter oxydans
           621H]
          Length = 111

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M       M   S+G+    L+GF+L++ILT+  F  VM    L   +    + + A+ Q
Sbjct: 1   MTQAPTTTMTGDSHGSYPSYLIGFVLAVILTVASFAAVMT-HALSPGMTMAALTVLAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLVFFLHM+T  E  W++M  IF    V +   G++++M+    NMMS
Sbjct: 60  IVVHLVFFLHMNTSTEQSWNLMCFIFAAASVIVIIGGTIFIMHDTAINMMS 110


>gi|162147816|ref|YP_001602277.1| cytochrome o ubiquinol oxidase protein cyoD [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542439|ref|YP_002274668.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786393|emb|CAP55975.1| putative cytochrome o ubiquinol oxidase protein cyoD
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530116|gb|ACI50053.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 110

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 59/91 (64%), Gaps = 1/91 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           L GF++S++LT   FG+VM   F     +    +L A+ Q++VHLVFFLHM+T  E  W+
Sbjct: 20  LTGFVISVVLTAAAFGVVMAHSFSPSGTIAAIAILAAV-QVVVHLVFFLHMNTSSEQRWN 78

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +MA +FT+  V I  VG++++M+    NMMS
Sbjct: 79  VMAFVFTVTAVLILIVGTVFIMHDTAINMMS 109


>gi|70732357|ref|YP_262113.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens
           Pf-5]
 gi|68346656|gb|AAY94262.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           Pf-5]
          Length = 109

 Score = 71.6 bits (174), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           N H+ +   +G+ K   +GFILS+ILT+IPFG+VM    L K++    ++  A+ Q++VH
Sbjct: 3   NTHSHDEAGHGSVKSYAIGFILSVILTLIPFGLVMYPS-LPKDVTLWIVLAFAVIQVLVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLH+        +++A IF  +++ +    S+W+M+ ++  MM+
Sbjct: 62  LVYFLHLDRSEAQRNNVVAFIFAALVIVLLVGLSLWIMFSIHTVMMA 108


>gi|328675366|gb|AEB28041.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella cf. novicida
           3523]
          Length = 110

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 3/99 (3%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +YGT K  + GF+LS+++T I F +V  GF  L    +C+T+ + A+ Q+ V LVFFLH+
Sbjct: 14  AYGTHKSYIQGFVLSVVITTIAFALV--GFKLLSPVALCVTVAVLAVVQLFVQLVFFLHL 71

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 72  STDSKARWNLVSAIFAIIVVIIVVAGTMWIMFDLYDMMM 110


>gi|319778050|ref|YP_004134480.1| cytochrome o ubiquinol oxidase subunit iv [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171769|gb|ADV15306.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 136

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 61/92 (66%), Gaps = 1/92 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++G+ L+++LTI  F            ++   +VL A+AQ+ VHLVFFLH++T  ++  +
Sbjct: 37  VIGYGLAILLTIASFLAAQTDLIYQPAVISALVVL-AVAQMGVHLVFFLHLTTGPDNTNN 95

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+A+ F +++VA+  +GS+W+M HLN NM +M
Sbjct: 96  ILALAFGVLIVALVVLGSVWIMAHLNENMAAM 127


>gi|260459333|ref|ZP_05807588.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium
           opportunistum WSM2075]
 gi|259034887|gb|EEW36143.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium
           opportunistum WSM2075]
          Length = 136

 Score = 70.1 bits (170), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 61/92 (66%), Gaps = 1/92 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++G+ L+++LTI  F            ++   +VL A+AQ+ VHLVFFLH++T  ++  +
Sbjct: 37  VIGYGLAILLTIASFLAAQTDLIYQPAVISALVVL-AVAQMGVHLVFFLHLTTGPDNTNN 95

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+A+ F +++VA+  +GS+W+M HLN NM +M
Sbjct: 96  ILALAFGVLIVALVVLGSVWIMAHLNENMAAM 127


>gi|156976719|ref|YP_001447625.1| cytochrome o ubiquinol oxidase protein CyoD [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528313|gb|ABU73398.1| hypothetical protein VIBHAR_05494 [Vibrio harveyi ATCC BAA-1116]
          Length = 103

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG-WSI 81
           GFI SLILT+IPF  V      D     + +  CA+ QI VH  +FLHM  K  +G W+ 
Sbjct: 15  GFIASLILTVIPFYCVWAQLLPDTATYAV-LFGCALVQIFVHFKYFLHMEVKTPEGQWNF 73

Query: 82  MAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           ++++FT I+V I   GS+W++Y++N NM
Sbjct: 74  VSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|238795551|ref|ZP_04639066.1| hypothetical protein ymoll0001_11420 [Yersinia mollaretii ATCC
           43969]
 gi|238720670|gb|EEQ12471.1| hypothetical protein ymoll0001_11420 [Yersinia mollaretii ATCC
           43969]
          Length = 75

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 52/73 (71%), Gaps = 1/73 (1%)

Query: 38  VMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG 97
           VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT +++AI  VG
Sbjct: 2   VMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFTAMIIAIVVVG 60

Query: 98  SMWVMYHLNNNMM 110
           S+W+MY+LN NMM
Sbjct: 61  SLWIMYNLNINMM 73


>gi|30410824|ref|NP_660785.2| cytochrome O ubiquinol oxidase D [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008334|sp|Q8K996|CYOD_BUCAP RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
          Length = 108

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
             KK  +VGF+ SL LTIIPF   +   F  + I    I+LCA++QII+H ++FLH+   
Sbjct: 13  KEKKSYIVGFLFSLFLTIIPFFCTLNHLF-SRKINFFVILLCALSQIIIHFIYFLHLDFS 71

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            ++ W+I++++F +I+V I   GS+W+MY+LN++++
Sbjct: 72  KKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVI 107


>gi|153833176|ref|ZP_01985843.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio harveyi HY01]
 gi|148870606|gb|EDL69514.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio harveyi HY01]
          Length = 103

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG-WSI 81
           GFI SLILT+IPF  V      D     + +  CA+ QI VH  +FLHM  K  +G W+ 
Sbjct: 15  GFIASLILTVIPFYCVWAQVLPDTATYAV-LFGCALVQIFVHFKYFLHMEVKTPEGQWNF 73

Query: 82  MAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           ++++FT I+V I   GS+W++Y++N NM
Sbjct: 74  VSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|77361151|ref|YP_340726.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76876062|emb|CAI87284.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 119

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 62/99 (62%), Gaps = 2/99 (2%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L+GF+LS+ILT IPF +VM G F  K     +I+  A+ QI VHL +FLH++
Sbjct: 21  SHGSVKSYLIGFVLSVILTAIPFYMVMSGDF-SKATTLYSIITLAVVQIWVHLKYFLHLN 79

Query: 73  TKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              EDG  S  + +F+ +++ +    S+W++Y  N  MM
Sbjct: 80  FITEDGRASTFSFLFSALIIVMVVGLSVWIIYESNAMMM 118


>gi|152994134|ref|YP_001338969.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas sp. MWYL1]
 gi|150835058|gb|ABR69034.1| Cytochrome o ubiquinol oxidase subunit IV [Marinomonas sp. MWYL1]
          Length = 107

 Score = 69.3 bits (168), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+   +S+G+ K  + GF+LS+ILT IPF +VM   F DK    +TI+L AI QI VHL 
Sbjct: 4   HSSEANSHGSVKSYVTGFVLSVILTGIPFWMVMTEAF-DKGPTYVTIILLAIVQIFVHLK 62

Query: 67  FFLHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH++   E G     + +F ++++ +    S+W++Y  N  MM
Sbjct: 63  YFLHLNFTSEQGKLDAYSFLFALMIIVMVVALSVWIIYASNAMMM 107


>gi|57340142|gb|AAW50058.1| hypothetical protein FTT0284 [synthetic construct]
          Length = 145

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 3/99 (3%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +YGT K  + GF+LS+++T I F  V+ GF  L    +C+T+ + A+ Q+ V LVFFLH+
Sbjct: 40  AYGTHKSYIQGFVLSVVITTIAF--VLVGFKLLSPVALCVTVAVLAVVQLFVQLVFFLHL 97

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 98  STDSKARWNLVSAIFAIIVVVIVVAGTMWIMFDLYDMMM 136


>gi|332992078|gb|AEF02133.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Alteromonas sp. SN2]
          Length = 130

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 71/109 (65%), Gaps = 3/109 (2%)

Query: 4   DNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           DN +++N    +G+ K  L+GF+LS+ILT+IPF +VM+G F  K     +IV+ A+ QI 
Sbjct: 22  DNANSVNHAAEHGSVKTYLIGFVLSVILTLIPFVMVMEGDF-SKVTTLWSIVVFALVQIW 80

Query: 63  VHLVFFLHMSTKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VHL +FLH++   EDG  S ++ +F+ +++ +    S+W++Y  N  MM
Sbjct: 81  VHLKYFLHLNFVTEDGRASTISFLFSALIIFMVVGLSIWIIYESNAMMM 129


>gi|89255628|ref|YP_512989.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314132|ref|YP_762855.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica OSU18]
 gi|156501577|ref|YP_001427642.1| cytochrome C oxidase/ubiquinol oxidase subunit IV [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167009930|ref|ZP_02274861.1| cytOchrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica FSC200]
 gi|254367022|ref|ZP_04983058.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica 257]
 gi|290953473|ref|ZP_06558094.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313271|ref|ZP_06803908.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica URFT1]
 gi|89143459|emb|CAJ78635.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica LVS]
 gi|115129031|gb|ABI82218.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134252848|gb|EBA51942.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica 257]
 gi|156252180|gb|ABU60686.1| cytochrome C oxidase/ubiquinol oxidase subunit IV [Francisella
           tularensis subsp. holarctica FTNF002-00]
          Length = 110

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (66%), Gaps = 3/99 (3%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +YGT K  + GF+LS+++T I F  V+ GF  L    +C+T+ + A+ Q+ V LVFFLH+
Sbjct: 14  AYGTHKSYIQGFVLSVVITTIAF--VLVGFKLLSPVALCVTVAILAVVQLFVQLVFFLHL 71

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ST  +  W++++ IF I++V I   G+MW+M+ L + MM
Sbjct: 72  STDSKARWNLVSAIFAIVVVVIVVAGTMWIMFDLYDMMM 110


>gi|163800404|ref|ZP_02194305.1| hypothetical protein 1103602000595_AND4_06974 [Vibrio sp. AND4]
 gi|159175847|gb|EDP60641.1| hypothetical protein AND4_06974 [Vibrio sp. AND4]
          Length = 103

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 55/88 (62%), Gaps = 2/88 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG-WSI 81
           GFI SLILT+IPF  V      D     + +  CA+ QI VH  +FLHM  K  +G W+ 
Sbjct: 15  GFIASLILTVIPFYCVWAKVLPDAATY-VVLFGCALVQIFVHFKYFLHMEVKTPEGQWNF 73

Query: 82  MAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           ++++FT I+V I   GS+W++Y++N NM
Sbjct: 74  VSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|254368561|ref|ZP_04984577.1| hypothetical protein FTAG_01545 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157121464|gb|EDO65655.1| hypothetical protein FTAG_01545 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 110

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 66/99 (66%), Gaps = 3/99 (3%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +YGT K  + GF+LS+++T I F  V+ GF  L    +C+T+ + A+ Q+ V LVFFLH+
Sbjct: 14  AYGTHKSYIQGFVLSVVITTIAF--VLVGFKLLSPVALCVTVAVLAVVQLFVQLVFFLHL 71

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ST  +  W++++ IF I++V I   G+MW+M+ L + MM
Sbjct: 72  STDSKARWNLVSAIFAIVVVVIVVAGTMWIMFDLYDMMM 110


>gi|56707438|ref|YP_169334.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110669909|ref|YP_666466.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118496812|ref|YP_897862.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. novicida U112]
 gi|134302622|ref|YP_001122593.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|187932181|ref|YP_001892166.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194324507|ref|ZP_03058279.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida FTE]
 gi|208780573|ref|ZP_03247912.1| cytochrome o ubiquinol oxidase subunit IV [Francisella novicida
           FTG]
 gi|224456518|ref|ZP_03664991.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370869|ref|ZP_04986874.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254372176|ref|ZP_04987668.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida GA99-3549]
 gi|254373657|ref|ZP_04989141.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3548]
 gi|254874275|ref|ZP_05246985.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|54113735|gb|AAV29501.1| NT02FT0909 [synthetic construct]
 gi|56603930|emb|CAG44917.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320242|emb|CAL08300.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118422718|gb|ABK89108.1| cytochrome bo terminal oxidase subunit IV [Francisella novicida
           U112]
 gi|134050399|gb|ABO47470.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151569112|gb|EDN34766.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC033]
 gi|151569906|gb|EDN35560.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3549]
 gi|151571379|gb|EDN37033.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3548]
 gi|187713090|gb|ACD31387.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194321342|gb|EDX18828.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida FTE]
 gi|208743548|gb|EDZ89853.1| cytochrome o ubiquinol oxidase subunit IV [Francisella novicida
           FTG]
 gi|254840274|gb|EET18710.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282158580|gb|ADA77971.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis NE061598]
 gi|328676274|gb|AEB27144.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella cf. novicida
           Fx1]
          Length = 110

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 66/99 (66%), Gaps = 3/99 (3%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           +YGT K  + GF+LS+++T I F  V+ GF  L    +C+T+ + A+ Q+ V LVFFLH+
Sbjct: 14  AYGTHKSYIQGFVLSVVITTIAF--VLVGFKLLSPVALCVTVAVLAVVQLFVQLVFFLHL 71

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 72  STDSKARWNLVSAIFAIIVVVIVVAGTMWIMFDLYDMMM 110


>gi|21623361|gb|AAM67996.1| cytochrome o ubiquinol oxidase D [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 123

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 66/96 (68%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
             KK  +VGF+ SL LTIIPF   +   F  + I    I+LCA++QII+H ++FLH+   
Sbjct: 28  KEKKSYIVGFLFSLFLTIIPFFCTLNHLF-SRKINFFVILLCALSQIIIHFIYFLHLDFS 86

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            ++ W+I++++F +I+V I   GS+W+MY+LN++++
Sbjct: 87  KKNSWNIISLLFILIIVFIIVFGSIWIMYNLNHHVI 122


>gi|303246930|ref|ZP_07333206.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio
           fructosovorans JJ]
 gi|302491637|gb|EFL51520.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio
           fructosovorans JJ]
          Length = 110

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ +   +GF+LSL+LT+IPF +VM G  L        +   A+ QI+VHL +FLH+   
Sbjct: 17  GSFRTYTLGFVLSLVLTVIPFALVMTGA-LPHGATLACLYAAAVIQIVVHLHYFLHLDRS 75

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               W++++++FT  ++ +   GS+W+MY L++ M
Sbjct: 76  SGMYWNMLSLLFTFFIMFLFIGGSLWIMYSLHSRM 110


>gi|258541197|ref|YP_003186630.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632275|dbj|BAH98250.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635332|dbj|BAI01301.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638387|dbj|BAI04349.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256641441|dbj|BAI07396.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256644496|dbj|BAI10444.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256647551|dbj|BAI13492.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256650604|dbj|BAI16538.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256653595|dbj|BAI19522.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 137

 Score = 68.2 bits (165), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+    ++GF+L+++LT++ FG+VM         +     L A+ Q++VHL +FLHM 
Sbjct: 39  SHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAVSAL-ALVQVLVHLHYFLHMG 97

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
              E  W+ M  +FT+  VAI  VGS+++M +   +MMS
Sbjct: 98  GDSEQRWNNMCFVFTVAFVAILIVGSVFIMNNTALHMMS 136


>gi|329114807|ref|ZP_08243564.1| Ubiquinol oxidase subunit IV [Acetobacter pomorum DM001]
 gi|326695938|gb|EGE47622.1| Ubiquinol oxidase subunit IV [Acetobacter pomorum DM001]
          Length = 110

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+    ++GF+L+++LT++ FG+VM         +     L A+ Q++VHL +FLHM 
Sbjct: 12  SHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAVSAL-ALVQVLVHLHYFLHMG 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
              E  W+ M  +FT+  VAI  VGS+++M +   +MMS
Sbjct: 71  GDSEQRWNNMCFVFTVAFVAILIVGSVFIMNNTALHMMS 109


>gi|254500701|ref|ZP_05112852.1| cytochrome o ubiquinol oxidase subunit IV [Labrenzia alexandrii
           DFL-11]
 gi|222436772|gb|EEE43451.1| cytochrome o ubiquinol oxidase subunit IV [Labrenzia alexandrii
           DFL-11]
          Length = 104

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 62/107 (57%), Gaps = 4/107 (3%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D+  +    S GT    L GF L+++LT IPFG+V  G      +  + I   A+ Q++V
Sbjct: 2   DHTDHTEHRSLGTY---LTGFALAIVLTAIPFGLVWTGALTGPAVYGV-IAAAAVIQVLV 57

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLVFFLH++ K   G ++  + F  +++ I   GS+W+M+ L++ MM
Sbjct: 58  HLVFFLHLNFKSTPGENLFFLAFAAVLICIMVGGSLWIMFDLHHRMM 104


>gi|282891622|ref|ZP_06300111.1| hypothetical protein pah_c186o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498485|gb|EFB40815.1| hypothetical protein pah_c186o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 120

 Score = 67.8 bits (164), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 61/107 (57%), Gaps = 1/107 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           ++H++    +GT K   +GFI S+ILT+I F  +     L    +  T+V  A+ Q ++ 
Sbjct: 6   SLHDIQREWHGTLKSYAIGFIGSIILTVISF-FMTSAKILSGRFLAYTLVGLALIQAVIQ 64

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           L +FLH+  + +  W  +   F  +++ I  +GS+W+MY LN+ +MS
Sbjct: 65  LRYFLHLGQETKPRWETIIFYFMFLVLLIIALGSLWIMYDLNDRVMS 111


>gi|319403608|emb|CBI77193.1| Cytochrome o ubiquinol oxidase protein cyoD (modular protein)
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 167

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 63/114 (55%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--Q 60
           YD  H  ++ SY      LVGFIL+++ T+  F  VM G      I    I L  +A  Q
Sbjct: 4   YDKNHEPSIGSY------LVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           IIV +VFFLH+++  +  W++ A++FT + V I   G+ W + HLN NMM   G
Sbjct: 58  IIVQIVFFLHLNSGPDARWNLTALLFTAMCVFIIIGGTWWAISHLNYNMMGGSG 111


>gi|28868536|ref|NP_791155.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968330|ref|ZP_03396474.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato T1]
 gi|301383462|ref|ZP_07231880.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060281|ref|ZP_07251822.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato K40]
 gi|302129918|ref|ZP_07255908.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28851774|gb|AAO54850.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213926968|gb|EEB60519.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato T1]
 gi|330873013|gb|EGH07162.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330957415|gb|EGH57675.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330963121|gb|EGH63381.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331015175|gb|EGH95231.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 110

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+VHL 
Sbjct: 6   HSAEDNSHGSVKSYIIGFVLSVILTAIPFALVMSPM-LPKDMTIAIVLVFAIIQILVHLH 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMYHLNNNMMS 111
           +FLH+        ++MA  FT  MV +  VG S+W+++ ++  MM+
Sbjct: 65  YFLHLDFTSVQRNNVMAFAFT-TMVIVLLVGLSLWIIFSVHREMMA 109


>gi|71733637|ref|YP_273479.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|237799927|ref|ZP_04588388.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|257487314|ref|ZP_05641355.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289623938|ref|ZP_06456892.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646772|ref|ZP_06478115.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289678123|ref|ZP_06499013.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           syringae FF5]
 gi|298485880|ref|ZP_07003956.1| Cytochrome O ubiquinol oxidase subunit IV [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|302186053|ref|ZP_07262726.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           syringae 642]
 gi|71554190|gb|AAZ33401.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|298159569|gb|EFI00614.1| Cytochrome O ubiquinol oxidase subunit IV [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|320323022|gb|EFW79112.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329855|gb|EFW85843.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330870268|gb|EGH04977.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330874428|gb|EGH08577.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330890459|gb|EGH23120.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330895789|gb|EGH28078.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330939016|gb|EGH42488.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330975784|gb|EGH75850.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330988098|gb|EGH86201.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009080|gb|EGH89136.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331022782|gb|EGI02839.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 110

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+VHL 
Sbjct: 6   HSAEDNSHGSVKSYIIGFVLSIILTAIPFALVMSPS-LPKDMTIAIVLVFAIIQILVHLH 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMYHLNNNMMS 111
           +FLH+        ++MA  FT  MV +  VG S+W+++ ++  MM+
Sbjct: 65  YFLHLDFTSVQRNNVMAFAFT-TMVIVLLVGLSLWIIFSVHREMMA 109


>gi|66044395|ref|YP_234236.1| cytochrome C oxidase subunit IV [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255102|gb|AAY36198.1| Prokaryotic Cytochrome C oxidase subunit IV [Pseudomonas syringae
           pv. syringae B728a]
 gi|330969178|gb|EGH69244.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 110

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+VHL 
Sbjct: 6   HSAEDNSHGSVKSYVIGFVLSIILTAIPFALVMSPS-LPKDMTIAIVLVFAIIQILVHLH 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMYHLNNNMMS 111
           +FLH+        ++MA  FT  MV +  VG S+W+++ ++  MM+
Sbjct: 65  YFLHLDFTSVQRNNVMAFAFT-TMVIVLLVGLSLWIIFSVHREMMA 109


>gi|308070783|ref|YP_003872388.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Paenibacillus polymyxa E681]
 gi|305860062|gb|ADM71850.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Paenibacillus polymyxa E681]
          Length = 111

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 56/90 (62%), Gaps = 1/90 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS++LTIIP G+VM    L +    + I+  A+ Q +V L FF+H+ 
Sbjct: 16  SHGSVKSYVIGFILSIVLTIIPLGVVMN-HMLSRTSTMVVILAAAVLQFLVQLFFFMHIR 74

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
                 W++M +IF ++++     GS+W+M
Sbjct: 75  ESNGPRWNVMTLIFGVVILLTVVGGSVWIM 104


>gi|17546580|ref|NP_519982.1| transmembrane cytochrome O ubiquinol oxidase subunit IV [Ralstonia
           solanacearum GMI1000]
 gi|17428879|emb|CAD15563.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit iv)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 125

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 1/108 (0%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           +H      +G+ +   VG +LS+ LT+  F  VM G    +  +   + LC +AQ++V L
Sbjct: 9   VHAGETAPHGSLRGYTVGLLLSVALTLAAFATVMTGALPARLALAGMVGLC-VAQLLVQL 67

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           V+FLH+ T      +    + T +++AI   GS+WVM++ N NMM  +
Sbjct: 68  VYFLHLGTGPGQRGNTAIFVCTGLLIAIVVAGSLWVMHNANENMMPTD 115


>gi|224826961|ref|ZP_03700059.1| cytochrome o ubiquinol oxidase subunit IV [Lutiella nitroferrum
           2002]
 gi|224600794|gb|EEG06979.1| cytochrome o ubiquinol oxidase subunit IV [Lutiella nitroferrum
           2002]
          Length = 107

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 62/99 (62%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  L GF+LS+ILT+IPF +VM G  L+ +   LTI   A+ QI+VHL +FLH+ 
Sbjct: 10  SHGSVKSYLTGFVLSVILTVIPFWLVMNGN-LNPHDTLLTIAGFAVVQILVHLKYFLHLD 68

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
              E   + +A +FT +++ +    S+W+++  +  MM 
Sbjct: 69  FTTEGRVNTLAFLFTALVIVLLVGLSVWIIFSADALMMP 107


>gi|326793470|ref|YP_004311290.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas mediterranea
           MMB-1]
 gi|326544234|gb|ADZ89454.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas mediterranea
           MMB-1]
          Length = 108

 Score = 67.0 bits (162), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 36/98 (36%), Positives = 61/98 (62%), Gaps = 2/98 (2%)

Query: 7   HNMNMH-SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           H+ + H ++G+    +VGF+LS++LT+IPF  VM   F D+  +   IV+ A+ QI VHL
Sbjct: 4   HDHDSHDAHGSVSSYVVGFVLSVVLTVIPFWAVMTSAF-DRATLFAVIVVTAVVQIFVHL 62

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103
            +FLH++   E     ++ IFT I++ +    S+W++Y
Sbjct: 63  KYFLHLNFTKEGKLDTLSFIFTAIIIIMVVALSIWIIY 100


>gi|260430480|ref|ZP_05784453.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
 gi|260418509|gb|EEX11766.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
          Length = 99

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/92 (36%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           +  LVGF L+L LT++PF +V  G  +    + +TI + A+AQI VHL FFLH+    + 
Sbjct: 9   RMYLVGFGLALTLTLVPFALVHWGL-MQGRTLAITIAVLAVAQIAVHLRFFLHIDLSRQK 67

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
              +  ++FT++++AI   G++W+M +L   M
Sbjct: 68  REDLQLILFTVLLLAIMAFGTLWIMGNLATRM 99


>gi|293607262|ref|ZP_06689603.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter piechaudii
           ATCC 43553]
 gi|292814354|gb|EFF73494.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter piechaudii
           ATCC 43553]
          Length = 116

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V LV
Sbjct: 11  HDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMHGA-LSHTITIIGVVALCVLQLLVQLV 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +FLHM +  E   ++ A +FT++++AI   GS WV+Y++N NM
Sbjct: 70  YFLHMGSSKESRDNLSAFVFTVLIIAIIVGGSAWVLYNMNVNM 112


>gi|226310782|ref|YP_002770676.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
 gi|226093730|dbj|BAH42172.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
          Length = 105

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 58/91 (63%), Gaps = 1/91 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           HS+G+ K+ ++GFILS++LTIIP  +VM    L K    + I++ A+ Q ++ LVFF+H+
Sbjct: 11  HSHGSMKEYVIGFILSIVLTIIPLVLVMNSI-LSKTATMIAILVMAVLQFVIQLVFFMHI 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
               +  +++  +I  +++V     GS+W+M
Sbjct: 70  REGEKPRYNVQTLILGLVIVITIVAGSLWIM 100


>gi|21321322|dbj|BAB97176.1| ubiquinol oxidase subunit IV [Acetobacter pasteurianus]
          Length = 109

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+    ++GF+L+++LT++ FG+VM         +     L A+ Q++VHL +FLHM 
Sbjct: 12  SHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAVSAL-ALVQVLVHLHYFLHMG 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
              E  W+ M  +FT+  VAI  VGS+++M
Sbjct: 71  GDSEQRWNNMCFVFTVAFVAILIVGSVFIM 100


>gi|319406525|emb|CBI80167.1| Cytochrome o ubiquinol oxidase protein cyoD (modular protein)
           [Bartonella sp. 1-1C]
          Length = 158

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--Q 60
           YD  H  ++ SY      LVGFIL+++ T+  F  VM G      I    I L  +A  Q
Sbjct: 2   YDKNHEPSIGSY------LVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 55

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           IIV +VFFLH+++  +  W++ A++FT +   I   G+ W + HLN NMM   G
Sbjct: 56  IIVQIVFFLHLNSGPDARWNLTALLFTAMCAFIIIGGTWWAISHLNYNMMGGSG 109


>gi|126642214|ref|YP_001085198.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 17978]
          Length = 74

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 1/73 (1%)

Query: 38  VMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG 97
           VM G F  + ++   I + A+AQ++V LV+FLHM+T  E  W+++A I+TI+ +A+  +G
Sbjct: 2   VMAGGF-SRGLLVTVIAITAVAQVLVQLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIG 60

Query: 98  SMWVMYHLNNNMM 110
           S+W+M +L+ NMM
Sbjct: 61  SVWIMNYLHYNMM 73


>gi|193212540|ref|YP_001998493.1| cytochrome o ubiquinol oxidase subunit IV [Chlorobaculum parvum
           NCIB 8327]
 gi|193086017|gb|ACF11293.1| cytochrome o ubiquinol oxidase subunit IV [Chlorobaculum parvum
           NCIB 8327]
          Length = 108

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/93 (37%), Positives = 59/93 (63%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  + GFIL+++LTII F +V+ G  + K I  + +   A AQI VHL +FLH+ +    
Sbjct: 17  KNYITGFILAVVLTIISFSLVLTGV-VPKQIAVIGLFAAAAAQIAVHLYYFLHLDSSKSQ 75

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            W+++ + FT +++ I   G++WV++ LN+ MM
Sbjct: 76  RWNVITISFTALLLFIFIAGTIWVIHTLNSRMM 108


>gi|34499448|ref|NP_903663.1| cytochrome o ubiquinol oxidase subunit IV [Chromobacterium
           violaceum ATCC 12472]
 gi|34105300|gb|AAQ61655.1| cytochrome o ubiquinol oxidase subunit IV [Chromobacterium
           violaceum ATCC 12472]
          Length = 106

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H  +  S+GT K  +VGF+LS+ILT IPF +VM G F  K    + I+  A+ QI+V L 
Sbjct: 3   HAHDNASHGTVKSYMVGFVLSVILTAIPFWMVMGGAF-TKQATLIGILAMAVVQIVVQLK 61

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH+    E   +  + +FT +++ +  V S+W++Y  +  MM
Sbjct: 62  YFLHLDFSKEGKLNTFSFLFTGMVIVLLVVLSIWIIYTADALMM 105


>gi|170692897|ref|ZP_02884059.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia graminis
           C4D1M]
 gi|170142553|gb|EDT10719.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia graminis
           C4D1M]
          Length = 110

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 1/100 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
             +G+ +  L GF+LS++LT   F +VM G F  +  M    VL A  QI+VHLVFFLH+
Sbjct: 11  QGHGSLRGYLAGFVLSVVLTAAAFWLVMHGAFPAQTAMIALSVL-AFVQIVVHLVFFLHI 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                  W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 70  DMSAGQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|251794161|ref|YP_003008892.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus sp. JDR-2]
 gi|247541787|gb|ACS98805.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus sp. JDR-2]
          Length = 110

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 63/97 (64%), Gaps = 2/97 (2%)

Query: 7   HNMNMH-SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           H  + H S+G+ K  ++GF++S++LTI+P  +V+    +DK    + I++ A+ Q +V L
Sbjct: 9   HGHDEHESHGSMKSYVIGFVISIVLTILPLVVVLNDM-MDKTPTLIFILIMAVLQFVVQL 67

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
            FF+H+  + +  +++MA+IF ++++     GS+W+M
Sbjct: 68  FFFMHLREEKKPRYNVMALIFGLVILVTIIAGSIWIM 104


>gi|209808983|ref|YP_002264521.1| cytochrome o ubiquinol oxidase subunit CyoD [Aliivibrio salmonicida
           LFI1238]
 gi|208010545|emb|CAQ80914.1| cytochrome o ubiquinol oxidase subunit CyoD [Aliivibrio salmonicida
           LFI1238]
          Length = 109

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 59/89 (66%), Gaps = 1/89 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  + GFI SLILT+IPF     G  L + +  + ++L AIAQ++VHL +FLHM +  +
Sbjct: 16  AKGYITGFIASLILTMIPFYFAYTGV-LSREVTIVVLILSAIAQLVVHLFYFLHMDSTEK 74

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
             +++++ +FT ++V I   GS+W+M++L
Sbjct: 75  GRFNMLSFVFTAVIVFIVIAGSIWIMWNL 103


>gi|330993478|ref|ZP_08317413.1| Cytochrome o ubiquinol oxidase protein CyoD [Gluconacetobacter sp.
           SXCC-1]
 gi|329759508|gb|EGG76017.1| Cytochrome o ubiquinol oxidase protein CyoD [Gluconacetobacter sp.
           SXCC-1]
          Length = 84

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 28  LILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFT 87
           +ILT+  FG+VM    +  +     I L A+ QI+VHL++FLHM+   E  W++MA +FT
Sbjct: 1   MILTVAAFGLVMS-HAMSPSATGGAIALLAVVQIVVHLIYFLHMNGSSEQRWNVMAFVFT 59

Query: 88  IIMVAICFVGSMWVMYHLNNNMMS 111
           ++ V +   G+M++M+  + NMMS
Sbjct: 60  VLSVLVLVAGTMFIMHDTSINMMS 83


>gi|73538403|ref|YP_298770.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia eutropha
           JMP134]
 gi|72121740|gb|AAZ63926.1| cyoD2, RSc1861; probable transmembrane cytochrome O ubiquinol
           oxidase (subunit Iv) oxidoreductase protein [Ralstonia
           eutropha JMP134]
          Length = 131

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 61/103 (59%), Gaps = 5/103 (4%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ +   +GF LSL+LT   FG VM G       + + + LC +AQ++V L FFLH+ 
Sbjct: 22  SHGSPRSYAIGFALSLVLTFASFGAVMSGALPPGMGLPVIVGLC-VAQLLVQLSFFLHLG 80

Query: 73  -TKVEDGWS-IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
             K + G S I A  F +I++ I   GS+WVM++ + NMM  +
Sbjct: 81  IGKGQRGNSGIFACTFGLIVIVIA--GSLWVMHNADTNMMPTQ 121


>gi|315125955|ref|YP_004067958.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas sp. SM9913]
 gi|315014469|gb|ADT67807.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas sp. SM9913]
          Length = 118

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 61/103 (59%), Gaps = 8/103 (7%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
            S+G+ K  L+GF+LS+ILT IPF +VM+G F  K     +IV  AI QI VHL +FLH+
Sbjct: 19  QSHGSVKTYLIGFVLSVILTAIPFWMVMEGDF-SKVTTLWSIVTFAIVQIWVHLKYFLHL 77

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVG----SMWVMYHLNNNMM 110
           +   ++G    A  FT +  A+  V     S+W++Y  N  MM
Sbjct: 78  NFTTDEG---KANTFTFLFSALIIVMVVGLSVWIIYESNAMMM 117


>gi|299067541|emb|CBJ38741.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia solanacearum
           CMR15]
          Length = 125

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 58/108 (53%), Gaps = 1/108 (0%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           +H      +G+ +   VG +LS+ LT+  F  VM G    +  +   + LC +AQ++V L
Sbjct: 9   VHAGETAVHGSLRGYTVGLLLSVALTLAAFATVMTGALPARLALAGMVGLC-VAQLLVQL 67

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           VFFLH+        +    + T +++AI   GS+WVM++ N NMM  +
Sbjct: 68  VFFLHLGPGPGQRGNTAIFVCTGLLIAIVVAGSLWVMHNANANMMPTD 115


>gi|319898316|ref|YP_004158409.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella clarridgeiae
           73]
 gi|319402280|emb|CBI75819.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella clarridgeiae
           73]
          Length = 209

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 62/110 (56%), Gaps = 8/110 (7%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--QIIVH 64
           HN ++ SY      LVGFIL+++ T+  F  VM G      I    I L  +A  QIIV 
Sbjct: 9   HNPSIGSY------LVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQIIVQ 62

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VFFLH+++  +  W+I+ ++FT + V +   G+ W + HLN NMM   G
Sbjct: 63  IVFFLHLNSGPDAKWNIVTLLFTAMCVFVIIGGTWWAISHLNYNMMGGSG 112


>gi|433189|dbj|BAA02483.1| ubiquinol oxidase subunit IV precursor [Acetobacter aceti]
 gi|229365480|dbj|BAH57988.1| ubiquinol oxidase subunit IV [Acetobacter lovaniensis]
          Length = 109

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+    ++GF+L+++LT++ FG+VM         +   I   A+ Q++VHL +FLHM 
Sbjct: 12  SHGSVSSYIIGFVLAVVLTVLSFGVVMTPQPSPAGTLA-AISALALVQVLVHLHYFLHMG 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
              E  W+ M  +FT+  VAI  VG++++M
Sbjct: 71  GSSEQRWNNMCFVFTVAFVAILIVGTVFIM 100


>gi|323529725|ref|YP_004231877.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1001]
 gi|323386727|gb|ADX58817.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1001]
          Length = 110

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 60/99 (60%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           ++G+ +  + GF+LS+ LT   F +VM+G F  +  M    VL A  QI+VHL FFLH+ 
Sbjct: 12  NHGSVRGYVCGFVLSVALTAAAFWLVMRGAFPAQTAMIALSVL-AFVQIVVHLAFFLHVD 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 71  MSARQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|170745536|ref|YP_001766993.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659137|gb|ACB28191.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
          Length = 182

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           +  L+G  L+ +LT+  F +V   F     +    IV  AIAQ+ VHLVFFLH++T  ++
Sbjct: 67  RGYLIGLALATLLTVCSFAVVHAKFVWAPAVPVAVIVF-AIAQMGVHLVFFLHITTGPDN 125

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
             ++MA+ F ++ V +   GS+W+M ++N+NMM 
Sbjct: 126 INNVMALAFGVLFVVLLIGGSVWIMSNMNSNMMP 159


>gi|295701244|ref|YP_003610245.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
 gi|295441567|gb|ADG20734.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
          Length = 108

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/101 (33%), Positives = 60/101 (59%), Gaps = 5/101 (4%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFF--LDKNIMCLTIVLCAIAQIIVHLVFFLH 70
           S+G+  + L GF LS++LT   FG+   G +  +D     + I +    Q++VHLV FLH
Sbjct: 10  SHGSLTRYLAGFFLSVLLTAGAFGV---GLYDAIDATTAMIAIAVLGFLQVVVHLVCFLH 66

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++     GW+++++ +TI+  A   +G++WVM ++   MMS
Sbjct: 67  LTLSPGQGWNVLSLCYTILAAAFLILGTVWVMRNVEMLMMS 107


>gi|310644019|ref|YP_003948777.1| cytochrome o ubiquinol oxidase subunit iv [Paenibacillus polymyxa
           SC2]
 gi|309248969|gb|ADO58536.1| Cytochrome o ubiquinol oxidase subunit IV [Paenibacillus polymyxa
           SC2]
          Length = 111

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 55/90 (61%), Gaps = 1/90 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS++LTIIP  +VM    L +    + I+  A+ Q +V L FF+H+ 
Sbjct: 16  SHGSVKSYVIGFILSIVLTIIPLFVVMN-HMLSRTSTMVVILAAAVLQFLVQLFFFMHIR 74

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
                 W++M +IF ++++     GS+W+M
Sbjct: 75  ESNGPRWNVMTLIFGVVILLTVVGGSVWIM 104


>gi|219682374|ref|YP_002468758.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|219622107|gb|ACL30263.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|311086195|gb|ADP66277.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
 gi|311086771|gb|ADP66852.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087359|gb|ADP67439.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
 gi|311087857|gb|ADP67936.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 105

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 31  TIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIM 90
           T +PF + ++ FF  + +  +  +LCAI+QII+H V+FLH+S   E+ W+++ ++F II+
Sbjct: 27  TTLPFLLAIEKFFCSE-VNYIIFLLCAISQIIIHFVYFLHLSFDPEERWNLITLLFVIII 85

Query: 91  VAICFVGSMWVMYHLNNNMM 110
           + I   GS+W+M++LN+N M
Sbjct: 86  IFIVVFGSIWIMFNLNHNTM 105


>gi|15617067|ref|NP_240280.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219681819|ref|YP_002468205.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
 gi|257471521|ref|ZP_05635520.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|11386746|sp|P57541|CYOD_BUCAI RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
 gi|25331171|pir||F84984 cytochrome o ubiquinol oxidase subunit IV [imported] - Buchnera sp.
           (strain APS)
 gi|10039132|dbj|BAB13166.1| cytochrome o ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219624662|gb|ACL30817.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
          Length = 105

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 57/80 (71%), Gaps = 1/80 (1%)

Query: 31  TIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIM 90
           T +PF + ++ FF  + +  +  +LCAI+QII+H V+FLH+S   E+ W+++ ++F II+
Sbjct: 27  TTLPFLLAIEKFFCSE-VNYIIFLLCAISQIIIHFVYFLHLSFDPEERWNLITLLFVIII 85

Query: 91  VAICFVGSMWVMYHLNNNMM 110
           + I   GS+W+M++LN+N M
Sbjct: 86  IFIVVFGSIWIMFNLNHNTM 105


>gi|307725994|ref|YP_003909207.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1003]
 gi|307586519|gb|ADN59916.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1003]
          Length = 110

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 59/99 (59%), Gaps = 1/99 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+    + GF+LS++LT   F +VM+G    +  M    VL A  QI+VHLVFFLH+ 
Sbjct: 12  GHGSTGGYVCGFVLSVVLTAAAFWLVMRGALPAQTAMIALSVL-AFVQIVVHLVFFLHID 70

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                 W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 71  MSAGQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|148254209|ref|YP_001238794.1| cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. BTAi1]
 gi|146406382|gb|ABQ34888.1| cytochrome bb3 quinol oxidase subunit 4 [Bradyrhizobium sp. BTAi1]
          Length = 130

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/95 (38%), Positives = 60/95 (63%), Gaps = 1/95 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + G  L+++LT   F I         +I    IVL AIAQ+ VHLVFFLH++T  ++  +
Sbjct: 32  VAGLGLAVLLTAASFFIAGTNLVWQPSIPVALIVL-AIAQMGVHLVFFLHITTGPDNTNN 90

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           ++A+ F +I+V +   GS+W+M +LN+NMM M+ +
Sbjct: 91  VLALAFGLIIVFLVVGGSLWIMSNLNHNMMPMDPL 125


>gi|113867651|ref|YP_726140.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113526427|emb|CAJ92772.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 125

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 1/109 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           ++H     ++G+ +   +G +LS+ LT+  F  VM G    +  + L + LC +AQ++V 
Sbjct: 8   SVHADQPAAHGSVRSYTIGLLLSVALTMASFAAVMTGSLSTQAAIALVVGLC-VAQLLVQ 66

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           LV+FLH+ T      +      T  ++ I   GS+WVM++ + NMM  +
Sbjct: 67  LVYFLHLGTGPGQRGNTAIFACTGFLIVIVVAGSLWVMHNADINMMPTD 115


>gi|207744471|ref|YP_002260863.1| hypothetical ubiquinol oxidase subunit ( partial sequence) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595877|emb|CAQ62804.1| hypothetical ubiquinol oxidase subunit ( partial sequence) protein
           [Ralstonia solanacearum IPO1609]
          Length = 56

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 43/55 (78%)

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           A+ QI+VHL++FLH+       W++MA +FT++++AI  VGS+WVM+++N NMM+
Sbjct: 1   AVVQIVVHLIYFLHLDGSSAQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMMT 55


>gi|317403853|gb|EFV84327.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter
           xylosoxidans C54]
          Length = 116

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V LV
Sbjct: 11  HDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMSGA-LSHTITIIGVVALCVLQLLVQLV 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +FLHM        ++   +FT++++AI   GS WV+Y++N NM
Sbjct: 70  YFLHMGASKSARDNLATFVFTVMIIAIIVGGSAWVLYNMNVNM 112


>gi|170724797|ref|YP_001758823.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella woodyi ATCC
           51908]
 gi|169810144|gb|ACA84728.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella woodyi ATCC
           51908]
          Length = 111

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ K  L+GF+LS++LT IPF  V+   F DK +    +++ A+ QI+VHL +FLH+   
Sbjct: 17  GSVKSYLMGFMLSVVLTAIPFWAVITHHF-DKPVTLGLVLVTAVVQIVVHLKYFLHLDFS 75

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   +  + +FT +++ +    S+W++Y  N+ MM
Sbjct: 76  KEGKLNTFSFLFTALIIVMVVGLSVWIIYAANDLMM 111


>gi|149189685|ref|ZP_01867967.1| hypothetical protein VSAK1_06650 [Vibrio shilonii AK1]
 gi|148836497|gb|EDL53452.1| hypothetical protein VSAK1_06650 [Vibrio shilonii AK1]
          Length = 103

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 2/84 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG-WSI 81
           GF  +L+LT++PF +V     L  +     +  CAI Q+ VH  +FLHM  K  DG W++
Sbjct: 15  GFCAALVLTVVPFYLVWAQS-LPASTTYFVLFACAIVQVFVHFKYFLHMEAKTSDGQWNL 73

Query: 82  MAMIFTIIMVAICFVGSMWVMYHL 105
           ++++FTI++V I   GS+W+MY++
Sbjct: 74  VSLLFTIVVVFILIAGSLWIMYNM 97


>gi|186470621|ref|YP_001861939.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184196930|gb|ACC74893.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 125

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 57/101 (56%), Gaps = 1/101 (0%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++G +LSL LT   FG+VM         +   + LC + Q++V L +FLH+ 
Sbjct: 16  SHGSVKHYVIGMLLSLALTFASFGVVMTHVVPRAMGLTAVVALCVV-QLLVQLRYFLHLG 74

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +  +   +    + T +++AI   GS+WV+++ N NMM  +
Sbjct: 75  SSADQRSNTGIFVCTALLIAIIVAGSLWVIHNANVNMMPTQ 115


>gi|319424516|gb|ADV52590.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella putrefaciens
           200]
          Length = 113

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 60/107 (56%), Gaps = 7/107 (6%)

Query: 10  NMHSYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           + HS+GT       K  L+GF+LS++LT IPF  VM   F     + L +V+ AI QI+V
Sbjct: 8   DKHSHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHFEKATTLSLVLVM-AIVQIVV 66

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 67  HLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|304407875|ref|ZP_07389526.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus
           curdlanolyticus YK9]
 gi|304343358|gb|EFM09201.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus
           curdlanolyticus YK9]
          Length = 109

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  ++GFI+S++LTIIP  +VM    + KN   + I++ A+ Q  V L FF+H+      
Sbjct: 19  KSYVIGFIMSIVLTIIPLVVVMNDM-MSKNGTIVLILILAVLQFAVQLWFFMHLKEGENA 77

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYH 104
            W+I A++F I+++ +   GS+W+M +
Sbjct: 78  KWNIAALLFAILILVVVVAGSIWIMAY 104


>gi|146294942|ref|YP_001185366.1| cytochrome C oxidase subunit IV [Shewanella putrefaciens CN-32]
 gi|145566632|gb|ABP77567.1| cytochrome C oxidase subunit IV [Shewanella putrefaciens CN-32]
          Length = 113

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 7/109 (6%)

Query: 8   NMNMHSYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           + + HS+GT       K  L+GF+LS++LT IPF  VM   F     + L +V+ AI QI
Sbjct: 6   HTDKHSHGTDSLAASIKSYLMGFVLSVVLTAIPFWAVMTHHFEKATTLSLVLVM-AIVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 65  VVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|297620726|ref|YP_003708863.1| putative cytochrome o ubiquinol oxidase, subunit IV [Waddlia
           chondrophila WSU 86-1044]
 gi|297376027|gb|ADI37857.1| putative cytochrome o ubiquinol oxidase, subunit IV [Waddlia
           chondrophila WSU 86-1044]
          Length = 121

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/106 (33%), Positives = 55/106 (51%), Gaps = 1/106 (0%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +GT     +GF +SL+ T I F +V    F   +++  TI   A  Q +V L+FFLH+  
Sbjct: 15  HGTYLSYGIGFFVSLVFTSISFLLVAYDAFPPVSLIY-TIATLAFLQAVVQLIFFLHLGQ 73

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           + +  W      F ++++ I  VGS+WVM  LN  MM    M + H
Sbjct: 74  EGKPHWETFIFFFMLLILLIIVVGSLWVMNDLNERMMPKHNMTAAH 119


>gi|254234442|ref|ZP_04927765.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           C3719]
 gi|126166373|gb|EAZ51884.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           C3719]
          Length = 111

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++VHL+
Sbjct: 6   HDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVVHLI 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            FLHM+   E  W++MA IFT+I++ +    S+W+++  +  MM M 
Sbjct: 65  CFLHMNKSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|319405035|emb|CBI78645.1| cytochrome o ubiquinol oxidase subunit IV (fragment) [Bartonella
           sp. AR 15-3]
          Length = 135

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--Q 60
           YD  H+  + SY      LVGFILS++ T+  F  VM G      I    I L  +A  Q
Sbjct: 4   YDKNHDPGIGSY------LVGFILSVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           II+ +VFFLH+S+  +  W++ A++F  + V I   G+ W + HLN NMM   G
Sbjct: 58  IIIQIVFFLHLSSGPDAKWNLAALLFAAMCVFIIIGGTWWAISHLNYNMMGSSG 111


>gi|239995160|ref|ZP_04715684.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii ATCC 27126]
 gi|332143297|ref|YP_004429035.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553319|gb|AEB00038.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 123

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 64/107 (59%), Gaps = 3/107 (2%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + HN +  ++G  K  ++GFILS++LT IPF +VM G  L K     ++V   + QI VH
Sbjct: 18  STHNSD-DAHGDVKSYIIGFILSVVLTAIPFTLVMNG-DLSKVTTIWSVVTLGLVQIWVH 75

Query: 65  LVFFLHMSTKVEDGWS-IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           L +FLH++   E+G +   + +F+ +++ +    S+W++Y  N  MM
Sbjct: 76  LKYFLHLNFVTEEGRANTFSFLFSALIIFMVVGLSVWIIYESNAMMM 122


>gi|15596517|ref|NP_250011.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAO1]
 gi|107100771|ref|ZP_01364689.1| hypothetical protein PaerPA_01001799 [Pseudomonas aeruginosa PACS2]
 gi|116049272|ref|YP_791925.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152984607|ref|YP_001349424.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PA7]
 gi|218892575|ref|YP_002441444.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           LESB58]
 gi|254239692|ref|ZP_04933014.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           2192]
 gi|296390303|ref|ZP_06879778.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAb1]
 gi|81541485|sp|Q9I424|CYOD_PSEAE RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit IV
 gi|9947258|gb|AAG04709.1|AE004561_5 cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAO1]
 gi|115584493|gb|ABJ10508.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126193070|gb|EAZ57133.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           2192]
 gi|150959765|gb|ABR81790.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PA7]
 gi|218772803|emb|CAW28588.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           LESB58]
          Length = 111

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%), Gaps = 1/107 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++VHL+
Sbjct: 6   HDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVVHLI 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            FLHM+   E  W++MA IFT+I++ +    S+W+++  +  MM M 
Sbjct: 65  CFLHMNMSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|311108452|ref|YP_003981305.1| cytochrome O ubiquinol oxidase subunit IV 1 [Achromobacter
           xylosoxidans A8]
 gi|310763141|gb|ADP18590.1| cytochrome O ubiquinol oxidase subunit IV 1 [Achromobacter
           xylosoxidans A8]
          Length = 116

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V LV
Sbjct: 11  HDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMNGG-LSHTITIIGVVALCVLQLLVQLV 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +FLHM        ++   +FT+++++I   GS WV+Y++N NM
Sbjct: 70  YFLHMGASKSARDNLATFVFTLMIISIIVGGSAWVLYNMNVNM 112


>gi|187477294|ref|YP_785318.1| cytochrome O ubiquinol oxidase subunit IV [Bordetella avium 197N]
 gi|115421880|emb|CAJ48399.1| cytochrome O ubiquinol oxidase subunit IV [Bordetella avium 197N]
          Length = 113

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 67/98 (68%), Gaps = 1/98 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+ K  ++GFILS+ILT+  F +VM G F  + ++   I++  + Q++V LVFF+HM 
Sbjct: 13  GHGSLKSYIIGFILSIILTLGSFWLVMNGTF-SRPLVLGGILVLCVVQLLVQLVFFMHMG 71

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           T   +  ++ A +FT++++AI   GS+WV++++N NM+
Sbjct: 72  TAKSEQDNLSAFLFTVMIIAIIVGGSIWVLHNMNANML 109


>gi|146339413|ref|YP_001204461.1| cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. ORS278]
 gi|146192219|emb|CAL76224.1| Cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. ORS278]
          Length = 135

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 49/67 (73%)

Query: 46  KNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           +  + + +++ AIAQ+ VHLVFFLH++T  ++  +++A+ F +I+V +   GS+W+M +L
Sbjct: 61  RPSIPVALIVLAIAQMGVHLVFFLHITTGPDNTNNVLALAFGLIIVVLVVGGSLWIMANL 120

Query: 106 NNNMMSM 112
           N+NMM M
Sbjct: 121 NHNMMPM 127


>gi|319407993|emb|CBI81647.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella
           schoenbuchensis R1]
          Length = 190

 Score = 59.3 bits (142), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--Q 60
           +D  HN +  SY      LVGFIL++  T+  F  VM G      +    I L  +A  Q
Sbjct: 2   HDKAHNPSTISY------LVGFILAVFFTLGSFIPVMYGMLDSWAVSTKVIYLIGMALIQ 55

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           I+V +VFFLH+++  +  W+ + + F  + V I   G+ W + HLN NMM   G
Sbjct: 56  IVVQIVFFLHLNSGPDAKWNWITLWFAAMCVFIIIGGTWWAISHLNYNMMGGSG 109


>gi|212634274|ref|YP_002310799.1| Quinol oxidase subunit V [Shewanella piezotolerans WP3]
 gi|212555758|gb|ACJ28212.1| Quinol oxidase subunit V [Shewanella piezotolerans WP3]
          Length = 111

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  LVGF+LS++LT IPF  VM   F +K +    ++  A+ QI+VHL +FLH+    E 
Sbjct: 20  KSYLVGFMLSVVLTAIPFWAVMSHHF-EKPLTIALVLGSAVVQIVVHLKYFLHLDFSKEG 78

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 79  KLNTFSFLFTALIIVMVVGLSVWIIYAANALMM 111


>gi|117922465|ref|YP_871657.1| cytochrome C oxidase subunit IV [Shewanella sp. ANA-3]
 gi|117614797|gb|ABK50251.1| cytochrome C oxidase subunit IV [Shewanella sp. ANA-3]
          Length = 113

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 7/105 (6%)

Query: 12  HSYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           HS+G        K  LVGF+LS++LT IPF  VM   F     + + IV  A+ QI+VHL
Sbjct: 10  HSHGADDLAASIKSYLVGFVLSVVLTAIPFWAVMTHHFEQSTTLAIVIV-TALVQILVHL 68

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 69  KYFLHLDFSKEGKINTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|163867422|ref|YP_001608619.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella tribocorum
           CIP 105476]
 gi|161017066|emb|CAK00624.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella tribocorum
           CIP 105476]
          Length = 242

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 60/113 (53%), Gaps = 8/113 (7%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA--QI 61
           +  H+ ++ SY      L+GFIL++  T+  F  VM G      I    + L  +A  QI
Sbjct: 5   NETHSPSIGSY------LIGFILAVFFTLGSFIPVMYGMMESWAISTKVVYLIGMALIQI 58

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           IV +VFFLH+++  +  W++ A+ F  I V I   G+ W + HLN NMM   G
Sbjct: 59  IVQIVFFLHLNSGPDAKWNLSALWFAAICVFIIVGGTWWAISHLNYNMMGGSG 111


>gi|294143095|ref|YP_003559073.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella violacea
           DSS12]
 gi|7657998|dbj|BAA94867.1| quinol oxidase subunit V [Shewanella violacea]
 gi|293329564|dbj|BAJ04295.1| cytochrome o ubiquinol oxidase, subunit IV [Shewanella violacea
           DSS12]
          Length = 111

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
            + K  LVGF+LS+ILT IPF  VM   F +K I    +++ A+ QI+VHL +FLH+   
Sbjct: 17  ASVKSYLVGFLLSVILTGIPFWAVMTHHF-EKPITLGLVLVMAVVQIVVHLKYFLHLDFS 75

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 76  KEGKINTFSFLFTALIMVMVMGLSVWIIYAANALMM 111


>gi|114561409|ref|YP_748922.1| cytochrome C oxidase subunit IV [Shewanella frigidimarina NCIMB
           400]
 gi|114332702|gb|ABI70084.1| cytochrome C oxidase subunit IV [Shewanella frigidimarina NCIMB
           400]
          Length = 109

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 55/96 (57%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
            + K  LVGF+LS++LT IPF  VM   F D       +V+ A+ QI+VHL +FLH+   
Sbjct: 15  ASVKSYLVGFVLSVVLTGIPFWSVMTHQF-DHMTTLWVVVITALVQIVVHLKYFLHLDFS 73

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 74  KEGRINTFSFLFTALIIVMVVGLSVWIIYAANELMM 109


>gi|239906128|ref|YP_002952867.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio magneticus
           RS-1]
 gi|239795992|dbj|BAH74981.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio magneticus
           RS-1]
          Length = 107

 Score = 57.8 bits (138), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           GT K   +GF  S++LT++ FG+VM G  L +  + L +   A+ Q+ V L +FLH+   
Sbjct: 14  GTVKSYALGFAASVVLTLVSFGLVMGGA-LPRLPLILALFALAVIQLFVQLRYFLHVDRS 72

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               W++MA++FT  ++ +   GS+W+MY L+  M
Sbjct: 73  SAMYWNLMALLFTFFLMFLFIGGSIWIMYGLHERM 107


>gi|153002719|ref|YP_001368400.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS185]
 gi|151367337|gb|ABS10337.1| Cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS185]
          Length = 113

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 58/104 (55%), Gaps = 7/104 (6%)

Query: 13  SYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           S+GT       K  L+GF+LS++LT IPF  VM   F     + L +V+ AI QI+VHL 
Sbjct: 11  SHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHFEKATTLSLVLVM-AIVQIVVHLK 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 70  YFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|120596925|ref|YP_961499.1| cytochrome C oxidase subunit IV [Shewanella sp. W3-18-1]
 gi|160877455|ref|YP_001556771.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS195]
 gi|217975292|ref|YP_002360043.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS223]
 gi|120557018|gb|ABM22945.1| cytochrome C oxidase subunit IV [Shewanella sp. W3-18-1]
 gi|160862977|gb|ABX51511.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS195]
 gi|217500427|gb|ACK48620.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS223]
 gi|315269657|gb|ADT96510.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS678]
          Length = 113

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 58/104 (55%), Gaps = 7/104 (6%)

Query: 13  SYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           S+GT       K  L+GF+LS++LT IPF  VM   F     + L +V+ AI QI+VHL 
Sbjct: 11  SHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHFEKATTLSLVLVM-AIVQIVVHLK 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 70  YFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|304412072|ref|ZP_07393682.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS183]
 gi|307305967|ref|ZP_07585713.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           BA175]
 gi|304349622|gb|EFM14030.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS183]
 gi|306911460|gb|EFN41886.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           BA175]
          Length = 113

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 58/104 (55%), Gaps = 7/104 (6%)

Query: 13  SYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           S+GT       K  L+GF+LS++LT IPF  VM   F     + L +V+ AI QI+VHL 
Sbjct: 11  SHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHFEKATTLSLVLVM-AIVQIVVHLK 69

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 70  YFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|27377828|ref|NP_769357.1| cytochrome O ubiquinol oxidase protein [Bradyrhizobium japonicum
           USDA 110]
 gi|7451519|pir||JC5902 ubiquinol oxidase (EC 1.-.-.-) IV - Bradyrhizobium japonicum
 gi|27350973|dbj|BAC47982.1| cytochrome O ubiquinol oxidase protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 129

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 47/65 (72%)

Query: 49  MCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
           + + +++ AIAQ+ VHLVFFLH++T  ++  +++A+ F +++V +   G++W+M HLN N
Sbjct: 58  IPVALIVLAIAQMGVHLVFFLHITTGPDNTNNVLALAFGLLVVFLVVGGTVWIMSHLNGN 117

Query: 109 MMSME 113
           M  M+
Sbjct: 118 MPPMD 122


>gi|218514775|ref|ZP_03511615.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
          etli 8C-3]
          Length = 91

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 13 SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           +GT K  + GF+LS+ILT IPF +VM G      +  + ++     QI+VH++FFLHM+
Sbjct: 25 GHGTFKSYMAGFVLSVILTAIPFWLVMSGVIASPALTAVLVMGLGAVQIVVHMIFFLHMN 84

Query: 73 TKVEDG 78
          T+ E G
Sbjct: 85 TR-ERG 89


>gi|226314759|ref|YP_002774655.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
 gi|226097709|dbj|BAH46151.1| probable quinol oxidase polypeptide IV [Brevibacillus brevis NBRC
           100599]
          Length = 105

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 57/90 (63%), Gaps = 1/90 (1%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +G+ K  ++GF+LSLI TIIP  + ++  +LD +   +  +  A+ Q IV L FF+H+ 
Sbjct: 10  GHGSLKSYVIGFVLSLIFTIIPI-LALENGWLDSDKRLIIYLGAALFQFIVQLFFFMHLK 68

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
            + +  +++M+++  + +V +  +GS+W+M
Sbjct: 69  EEDKPRYNLMSLLLGLFIVFLIVIGSIWIM 98


>gi|313106309|ref|ZP_07792553.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           39016]
 gi|310879055|gb|EFQ37649.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           39016]
          Length = 111

 Score = 57.0 bits (136), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++VHL+
Sbjct: 6   HDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVVHLI 64

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            FLHM+   E  W++MA IF +I++ +    S+W+++  +  MM M 
Sbjct: 65  CFLHMNMSSEGRWNVMAFIFMVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|114049401|ref|YP_739951.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-7]
 gi|113890843|gb|ABI44894.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-7]
          Length = 113

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  LVGF+LS++LT IPF  VM   F     + + +V+ A+ QI+VHL +FLH+    E 
Sbjct: 22  KSYLVGFVLSVVLTAIPFWAVMTHHFEQSTTLAI-VVVTALVQILVHLKYFLHLDFSKEG 80

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             +  + +FT +++ +    S+W++   N  MM
Sbjct: 81  KINTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|113972153|ref|YP_735946.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-4]
 gi|113886837|gb|ABI40889.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-4]
          Length = 113

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 7/105 (6%)

Query: 12  HSYGTK------KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           HS+G        K  LVGF LS++LT IPF  VM   F     + + +V+ A+ QI+VHL
Sbjct: 10  HSHGADDLAASIKSYLVGFGLSVVLTAIPFWAVMTHHFEQSTTLAI-VVVTALVQILVHL 68

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 69  KYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|332187380|ref|ZP_08389118.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
 gi|332012541|gb|EGI54608.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
          Length = 127

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 42/54 (77%)

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I Q+ VHLVFFLH++T  ++  +++A++F +++V +  +GS+W+M HLN+N+M 
Sbjct: 69  IGQMGVHLVFFLHITTGPDNSNNVLALLFGVLIVTLVLLGSIWIMGHLNHNLMG 122


>gi|127511303|ref|YP_001092500.1| cytochrome C oxidase subunit IV [Shewanella loihica PV-4]
 gi|126636598|gb|ABO22241.1| cytochrome C oxidase subunit IV [Shewanella loihica PV-4]
          Length = 108

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 55/93 (59%), Gaps = 1/93 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  L GF+LS++LT IPF  VM         + + +VL A+ QI+VHL +FLH+    E 
Sbjct: 17  KSYLTGFLLSVVLTGIPFWAVMTHSLETSTTLAIVLVL-AVVQILVHLKYFLHLDFSKEG 75

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             + ++ +FT +++ +    S+W++Y  N+ MM
Sbjct: 76  KVNTLSFMFTALVIVMVVGLSVWIIYAANDLMM 108


>gi|209363942|ref|YP_002268300.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212212544|ref|YP_002303480.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuG_Q212]
 gi|212218407|ref|YP_002305194.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuK_Q154]
 gi|215919090|ref|YP_002332979.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii RSA 493]
 gi|206583975|gb|ACI15270.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii RSA 493]
 gi|207081875|gb|ACI23138.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212010954|gb|ACJ18335.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuG_Q212]
 gi|212012669|gb|ACJ20049.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuK_Q154]
          Length = 111

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 64/107 (59%), Gaps = 6/107 (5%)

Query: 9   MNMHSYGTKKQCL----VGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           ++  SYGT K+ L    VG IL +ILT++ F  VM   F    ++ + I + A+ Q IV 
Sbjct: 5   LSEESYGTGKKKLSIYIVGMILCVILTLVSFMTVMYSAFPPTTLVAI-IFVSALIQFIVQ 63

Query: 65  LVFFLHMSTKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +V FL ++ K E    ++M+ IFTI+++ +   GS+W+M+ L+  MM
Sbjct: 64  VVCFLRLNAKNEQSRMNLMSFIFTIVILFVLIGGSLWIMWSLHYRMM 110


>gi|92118914|ref|YP_578643.1| cytochrome C oxidase subunit IV [Nitrobacter hamburgensis X14]
 gi|91801808|gb|ABE64183.1| cytochrome bo3 quinol oxidase subunit 4 [Nitrobacter hamburgensis
           X14]
          Length = 113

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 53/95 (55%), Gaps = 3/95 (3%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIV-LCAIAQIIVHLVFFLHMSTK 74
           T K  L+G +L+L LT IPFG+V         I    I+ + AIAQ++VHL +FLH+  K
Sbjct: 20  TIKSYLIGVVLALALTAIPFGLVAAHTL--PPIQTFVIIGVAAIAQVVVHLRYFLHLDFK 77

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
                 ++A+ F  +++ I   G++W+M+     M
Sbjct: 78  PSSQNKLVALCFAAVVLLILVGGTLWIMFDRYYRM 112


>gi|32490899|ref|NP_871153.1| hypothetical protein WGLp150 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166105|dbj|BAC24296.1| cyoD [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 109

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 57/95 (60%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
             K   +G+ILS   T IPF +++  + L   ++   I++CA +Q I+   FFL++    
Sbjct: 15  NNKSYFIGYILSFFFTCIPFLLIINKWNLYNELIYNLIIICAFSQAIIQFTFFLNIFDNS 74

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W ++++ FTI+++ I   GS+W+M HL++N+M
Sbjct: 75  RINWKLISLTFTILIIFILIFGSIWIMNHLHHNLM 109


>gi|121602245|ref|YP_989521.1| cytochrome o ubiquinol oxidase, subunit IV [Bartonella
           bacilliformis KC583]
 gi|120614422|gb|ABM45023.1| cytochrome o ubiquinol oxidase, subunit IV [Bartonella
           bacilliformis KC583]
          Length = 123

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           +++  H+ ++ SY      LVGF+L++I T   F  VM G      I    I L  +A I
Sbjct: 3   EHNETHDPSIRSY------LVGFVLAVIFTFCSFIPVMYGMLEGWAISTKVIYLIGMAII 56

Query: 62  IVHL--VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
            + +  +FFLH+++  +  W+ +A+ F +  V I   G+ W + HLN NMM   G
Sbjct: 57  QIIVQIIFFLHLNSGPDAKWNFVALWFAVTCVTIIIGGTWWAISHLNYNMMGGSG 111


>gi|27904893|ref|NP_778019.1| cytochrome O ubiquinol oxidase protein CyoD [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|46395812|sp|Q89AA6|CYOD_BUCBP RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
 gi|27904291|gb|AAO27124.1| cytochrome O ubiquinol oxidase protein CyoD [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 100

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 49/75 (65%), Gaps = 2/75 (2%)

Query: 35  FGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAIC 94
           F I+ + F   +N +   I++C   QI+ H+ FFL++   +E  W ++++IF++++  I 
Sbjct: 25  FAIIYRIF--SRNYLYAFIIVCLFFQILAHIKFFLNLDFSLEQRWKLISVIFSLVVGLII 82

Query: 95  FVGSMWVMYHLNNNM 109
            +GS+WV+ +LNNN+
Sbjct: 83  LLGSIWVIKNLNNNL 97


>gi|110635861|ref|YP_676069.1| cytochrome C oxidase subunit IV [Mesorhizobium sp. BNC1]
 gi|110286845|gb|ABG64904.1| cytochrome bo3 quinol oxidase subunit 4 [Chelativorans sp. BNC1]
          Length = 103

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
           Q L GF+L+L+LT IPF IV  G    +      + + A+ Q+ VHL +FLHM+      
Sbjct: 13  QYLTGFVLALVLTAIPFAIVATGA-APRAQSLAVVTVAAVVQVFVHLWYFLHMNFSTTPR 71

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
            +I+A  F  I++ I   GS W+M+ L++ M
Sbjct: 72  ENILAFAFAAILILIMLGGSFWIMFDLHSRM 102


>gi|54296268|ref|YP_122637.1| cytochrome o ubiquinol oxidase subunit IV [Legionella pneumophila
           str. Paris]
 gi|53750053|emb|CAH11445.1| Cytochrome o ubiquinol oxidase subunit IV [Legionella pneumophila
           str. Paris]
          Length = 112

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 6/109 (5%)

Query: 7   HNMNMHSYGTKKQ----CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           H +    YGT ++     LVGFI    LT+  F +VM   F    ++ L I   A  Q +
Sbjct: 4   HGIKEPDYGTGQKKLGLYLVGFISCTFLTLFSFWVVMSHIFSKTEVLTL-IFSSACIQFL 62

Query: 63  VHLVFFLHMSTKVEDGWS-IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           V ++ FL +ST+ + G + +M  +FT +++    +GS+W+M++LN  M+
Sbjct: 63  VQVICFLRLSTQTQQGRTNVMTFLFTGVILTSIILGSLWIMWNLNYYMV 111


>gi|254472570|ref|ZP_05085969.1| cytochrome o ubiquinol oxidase subunit IV [Pseudovibrio sp. JE062]
 gi|211958034|gb|EEA93235.1| cytochrome o ubiquinol oxidase subunit IV [Pseudovibrio sp. JE062]
          Length = 99

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 56/97 (57%), Gaps = 6/97 (6%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS--T 73
           + K+ + GFIL+L LT+IPF  V    F    +    I LCA+ Q+ VHL +FL +   T
Sbjct: 7   SAKRLITGFILALALTLIPFAAVWTMAF-PVELTFGIIALCALVQVGVHLHYFLGIDSRT 65

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +E+   ++AM F  +++ +   G++W+M+ L   MM
Sbjct: 66  PIEN---VLAMSFAGVLIFLMVGGTLWIMFDLYERMM 99


>gi|118591209|ref|ZP_01548608.1| Prokaryotic Cytochrome C oxidase subunit IV [Stappia aggregata IAM
           12614]
 gi|118436285|gb|EAV42927.1| Prokaryotic Cytochrome C oxidase subunit IV [Stappia aggregata IAM
           12614]
          Length = 101

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           MN  +  +    L GF+L+++LT IPF +V  G  L  + +   I + A+ Q+IVHLVFF
Sbjct: 1   MNHSAERSLSTYLTGFVLAVLLTAIPFALVWGGL-LAGSAVYAVIAVAAVLQVIVHLVFF 59

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LH+  K     ++  + F  +++ I   GS+W+M  L++ M
Sbjct: 60  LHIDLKSTPAENLFFLAFAAVLIFIMVGGSLWIMMDLHHRM 100


>gi|330819565|ref|YP_004348427.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia gladioli
           BSR3]
 gi|327371560|gb|AEA62915.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia gladioli
           BSR3]
          Length = 126

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 54/97 (55%), Gaps = 1/97 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           GT K  ++G ILS++LT + FG VM    + +      IV+  +AQ+IV L +FLH+ T 
Sbjct: 19  GTLKGYVIGMILSVLLTFVSFGAVMTDI-VPRGWGLAAIVVACVAQLIVQLFYFLHIGTA 77

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
                +    + T  ++A+    S+WV+++ N NMM 
Sbjct: 78  RSQRANTGIFLCTGFLIAVIVGLSLWVIHNANVNMMP 114


>gi|254512695|ref|ZP_05124761.1| Prokaryotic Cytochrome C oxidase subunit IV superfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221532694|gb|EEE35689.1| Prokaryotic Cytochrome C oxidase subunit IV superfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 102

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 57/93 (61%), Gaps = 1/93 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           +++ ++G+  SL+LT + FGI  + F ++   + +TI L  +AQ++V LV+FLH+  +  
Sbjct: 6   RRRYVIGYGGSLLLTFVVFGIAYQ-FGIETPGVYMTIGLLGLAQLVVQLVYFLHIDRRRS 64

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               +  ++F+ +++ I   G++WV+ +L   M
Sbjct: 65  SREDLDLILFSTLVLLIIIGGTIWVLGNLAMRM 97


>gi|49474943|ref|YP_032984.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella henselae str.
           Houston-1]
 gi|49237748|emb|CAF26940.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella henselae str.
           Houston-1]
          Length = 228

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 58/114 (50%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           ++  HN +  SY      LVGFIL++  T+  F  VM G      I    + L  +A I 
Sbjct: 4   HNETHNPSTSSY------LVGFILAVFFTLGSFIPVMYGMMDSWAISTKVVYLIGMAIIQ 57

Query: 63  VHL--VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           + +  +FFLH+++  +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 58  IIVQIIFFLHLNSGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGGSG 111


>gi|294498633|ref|YP_003562333.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|295703992|ref|YP_003597067.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
 gi|294348570|gb|ADE68899.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|294801651|gb|ADF38717.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
          Length = 98

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
           M ++G+ K   +GFI S+ILT+IP  +V+   F  KNI+  +I+  A+ Q  + L FF+H
Sbjct: 1   MENHGSLKAYTIGFIFSIILTVIPLMLVLNHVF-AKNILLASILGMAVLQFFIQLFFFMH 59

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +    +  +++MA+I  I+ V     GS+W+M
Sbjct: 60  IKDGEKPRYNVMALILGIVFVITIVAGSIWIM 91


>gi|114330709|ref|YP_746931.1| cytochrome C oxidase subunit IV [Nitrosomonas eutropha C91]
 gi|114307723|gb|ABI58966.1| cytochrome bo3 quinol oxidase subunit 4 [Nitrosomonas eutropha C91]
          Length = 116

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 53/87 (60%), Gaps = 2/87 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GF L+L LT++PF +V +   + ++ + +TI + A+ Q +VH  +FLH+  K +    ++
Sbjct: 29  GFGLALGLTLVPFALV-QWQAMARDPLLITIAVLALVQTVVHFRYFLHLDRKRKRE-DLL 86

Query: 83  AMIFTIIMVAICFVGSMWVMYHLNNNM 109
            ++F+  ++ I   G++W+M +L   M
Sbjct: 87  LVLFSTSLLIIMVAGTIWIMANLAERM 113


>gi|315646201|ref|ZP_07899321.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus vortex
           V453]
 gi|315278400|gb|EFU41716.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus vortex
           V453]
          Length = 107

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 58/93 (62%), Gaps = 1/93 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
             +G+ K   +GF  S+ILT+IP  +VM  + L+     + ++  A+ Q++V L+FF+H+
Sbjct: 11  EGHGSFKSYTIGFFCSIILTLIPITVVMNDW-LEGTWNSVVLMTAAVLQLMVQLLFFMHL 69

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYH 104
             + +  +++++++  ++++ +   GSMW+M +
Sbjct: 70  REENKPRYNLISLVLGLVILLVIVAGSMWIMLY 102


>gi|254488164|ref|ZP_05101369.1| cytochrome o ubiquinol oxidase subunit IV [Roseobacter sp. GAI101]
 gi|214045033|gb|EEB85671.1| cytochrome o ubiquinol oxidase subunit IV [Roseobacter sp. GAI101]
          Length = 103

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 56/117 (47%), Gaps = 25/117 (21%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTII--------PFGIVMKGFFLDKNIMCLTI 53
           K    H++ M+          GF L++ LT +        PFG V  G F        T+
Sbjct: 4   KNQRAHDLRMY--------FTGFGLAVTLTALSFLTAILQPFGPV--GLFA-------TL 46

Query: 54  VLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            + AIAQ++VH  FFLH+    +    +  ++FT +++AI   G++W++  L   MM
Sbjct: 47  AVLAIAQVVVHFRFFLHIDLSRQAREDLQLILFTGLLIAIMVAGTIWILGDLMTRMM 103


>gi|289807956|ref|ZP_06538585.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 41

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 31/39 (79%)

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             K ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 1   EPKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 39


>gi|218671103|ref|ZP_03520774.1| hypothetical protein RetlG_05283 [Rhizobium etli GR56]
          Length = 41

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/34 (61%), Positives = 27/34 (79%)

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +MA+IFT+I+VAI   GS+WVM+HLN NMM M  
Sbjct: 1   MMALIFTLIIVAIALSGSLWVMHHLNTNMMPMSP 34


>gi|167463408|ref|ZP_02328497.1| hypothetical protein Plarl_12766 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382243|ref|ZP_08056155.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153791|gb|EFX46160.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 106

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 50/99 (50%), Gaps = 1/99 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            N H+ +    G   + +VG+++S++LT++   +  K  F   N++   I + A  Q  +
Sbjct: 2   SNSHDTSAEHKGFPWKHVVGYLVSIVLTLLALWVAFKSGF-SINVLMTFIYILAFLQAAL 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
            L+ F+HM+      +    M++ + +  +   GS+WVM
Sbjct: 61  QLLMFMHMTESSNGKYQTGTMLYAVFIAIVIAAGSVWVM 99


>gi|330950891|gb|EGH51151.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae Cit
           7]
          Length = 78

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 3/79 (3%)

Query: 34  PFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAI 93
           PF +VM    L K++    +++ AI QI+VHL +FLH+        ++MA  FT  MV +
Sbjct: 1   PFALVMSPS-LPKDMTIAIVLVFAIIQILVHLHYFLHLDFTSVQRNNVMAFAFT-TMVIV 58

Query: 94  CFVG-SMWVMYHLNNNMMS 111
             VG S+W+++ ++  MM+
Sbjct: 59  LLVGLSLWIIFSVHREMMA 77


>gi|299820826|ref|ZP_07052715.1| quinol oxidase subunit IV [Listeria grayi DSM 20601]
 gi|299817847|gb|EFI85082.1| quinol oxidase subunit IV [Listeria grayi DSM 20601]
          Length = 109

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 56/108 (51%), Gaps = 3/108 (2%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N ++   H      Q ++GF LS+ILT++   + +    LD ++  + I + A  Q ++
Sbjct: 3   ENKNSTQTHKAHGPWQHIIGFALSIILTLLAVWVALYST-LDHSVKVVIIFIFAFIQAML 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNNNM 109
            L  F+HM+   +   +   ++F + +  I  +GS WVM   H+N+ M
Sbjct: 62  QLFMFMHMTEGKDGKVNTSGILFALFIAIIVVIGSYWVMEIGHMNHLM 109


>gi|260430762|ref|ZP_05784734.1| cytochrome C oxidase subunit IV [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418203|gb|EEX11461.1| cytochrome C oxidase subunit IV [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 93

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++G+  SL+LT+  F  V   F ++   + LTI L  +AQ+IV LV+FLH+  +      
Sbjct: 1   MIGYGSSLLLTLAMFATV-HWFGIETRGVYLTIGLLGLAQLIVQLVYFLHIDRRRSSRED 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +  ++F+ +++ I   G++W++ +L   M
Sbjct: 60  LDLVLFSTLVLLIIIGGTVWILGNLAMRM 88


>gi|319652991|ref|ZP_08007096.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. 2_A_57_CT2]
 gi|317395340|gb|EFV76073.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. 2_A_57_CT2]
          Length = 101

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 48/82 (58%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF++SL+LT    GIV+K     K IM + I   A+ Q  + L  F+H+    +   +
Sbjct: 14  VIGFVVSLVLTFAAAGIVLKTNLSFKVIMWI-IGSLAVIQAGMQLFMFMHLREGEDGKTN 72

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
           ++ MI+ + MV +  VGS+WV+
Sbjct: 73  LVNMIYAVFMVIVIVVGSIWVL 94


>gi|240849796|ref|YP_002971184.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella grahamii
           as4aup]
 gi|240266919|gb|ACS50507.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella grahamii
           as4aup]
          Length = 182

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 55/113 (48%), Gaps = 8/113 (7%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +  H  +  SY      LVGFIL++  T+  F  VM G      +      L  +A I +
Sbjct: 5   NETHGPSTGSY------LVGFILAVFFTLGSFVPVMYGMMESWAVSTKVAYLLGMAIIQI 58

Query: 64  HL--VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
            +  VFFLH+++  +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 59  IVQIVFFLHLNSGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGGSG 111


>gi|251799267|ref|YP_003013998.1| cytochrome C oxidase subunit IV [Paenibacillus sp. JDR-2]
 gi|247546893|gb|ACT03912.1| cytochrome C oxidase subunit IV [Paenibacillus sp. JDR-2]
          Length = 105

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 48/83 (57%), Gaps = 2/83 (2%)

Query: 12 HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
          H     K+ +V FI S++LT+I F  V  G  ++ + + + ++ CAI Q+ V + F++HM
Sbjct: 15 HKVEGPKKHIVAFIFSILLTLIAFAAVAGGE-INTDFIYIILIGCAILQVFVQMAFWMHM 73

Query: 72 STKVEDGWSIMAMIFTIIMVAIC 94
            +    ++I+ ++F + +V  C
Sbjct: 74 KDRGHT-FAIIGILFGVFVVFTC 95


>gi|289433389|ref|YP_003463261.1| quinol oxidase AA3, subunit IV [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289169633|emb|CBH26167.1| quinol oxidase AA3, subunit IV [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 110

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +    L  N+  + I + A  Q
Sbjct: 1   MAQNNKSNAAHAESGIPWKHIVGFALSIILTLLAVWVALYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNNNM 109
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+ M
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNHLM 110


>gi|313640101|gb|EFS04727.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria seeligeri FSL
           S4-171]
          Length = 110

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +    L  N+  + I + A  Q
Sbjct: 1   MAQNNKSNTAHAEGGIPWKHIVGFALSIILTLLAVWVALYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNNNM 109
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+ M
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNHLM 110


>gi|254992950|ref|ZP_05275140.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes FSL J2-064]
          Length = 110

 Score = 40.4 bits (93), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +    L  N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNN 107
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+
Sbjct: 60  AALQLLMFMHMTEGRDGKIQISNILFAAFIAIVVVIGSYWVMEIGHMNH 108


>gi|294499883|ref|YP_003563583.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|295705268|ref|YP_003598343.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
 gi|294349820|gb|ADE70149.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus megaterium QM
           B1551]
 gi|294802927|gb|ADF39993.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus megaterium DSM
           319]
          Length = 102

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 4/87 (4%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           G ILSL LT    G+V+    L ++I    I++ A+ Q  + LV F+HM T+ E+G   +
Sbjct: 18  GLILSLALTFAALGLVVLAD-LSRSITMTLIMILALLQAAMQLVMFMHM-TESENGKVQV 75

Query: 83  AMIFTIIMVAICF-VGSMWVM-YHLNN 107
           A I     +A+C  VG++W++  H N+
Sbjct: 76  ANILYSFFIALCIVVGTLWILAAHFNH 102


>gi|295698392|ref|YP_003603047.1| hypothetical protein RIEPE_0169 [Candidatus Riesia pediculicola
           USDA]
 gi|291157309|gb|ADD79754.1| hypothetical protein RIEPE_0169 [Candidatus Riesia pediculicola
           USDA]
          Length = 70

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 53  IVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           I + +IA+I +H + FL++    E  + I  ++F II+  I   GS+W+M+HL  NM
Sbjct: 3   IFISSIARISIHFLVFLNLKLFKEKIYKISFLMFFIIISFILSSGSLWIMHHLRTNM 59


>gi|46906242|ref|YP_012631.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47093031|ref|ZP_00230810.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 4b
           H7858]
 gi|116871439|ref|YP_848220.1| quinol oxidase AA3, subunit IV [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217965918|ref|YP_002351596.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria monocytogenes
           HCC23]
 gi|226222656|ref|YP_002756763.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes Clip81459]
 gi|254824761|ref|ZP_05229762.1| quinol oxidase AA3 [Listeria monocytogenes FSL J1-194]
 gi|254851825|ref|ZP_05241173.1| quinol oxidase AA3 [Listeria monocytogenes FSL R2-503]
 gi|254930850|ref|ZP_05264209.1| quinol oxidase AA3 [Listeria monocytogenes HPB2262]
 gi|255519797|ref|ZP_05387034.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes FSL J1-175]
 gi|290892054|ref|ZP_06555051.1| quinol oxidase AA3 [Listeria monocytogenes FSL J2-071]
 gi|300763371|ref|ZP_07073369.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes FSL N1-017]
 gi|315273206|ref|ZP_07869233.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria marthii FSL
           S4-120]
 gi|46879506|gb|AAT02808.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018599|gb|EAL09353.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 4b
           H7858]
 gi|116740317|emb|CAK19435.1| quinol oxidase AA3, subunit IV [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335188|gb|ACK40982.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria monocytogenes
           HCC23]
 gi|225875118|emb|CAS03808.1| Putative quinol oxidase aa3-600 chain IV [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605117|gb|EEW17725.1| quinol oxidase AA3 [Listeria monocytogenes FSL R2-503]
 gi|290558648|gb|EFD92165.1| quinol oxidase AA3 [Listeria monocytogenes FSL J2-071]
 gi|293582394|gb|EFF94426.1| quinol oxidase AA3 [Listeria monocytogenes HPB2262]
 gi|293594000|gb|EFG01761.1| quinol oxidase AA3 [Listeria monocytogenes FSL J1-194]
 gi|300515648|gb|EFK42697.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes FSL N1-017]
 gi|307569539|emb|CAR82718.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes L99]
 gi|313616168|gb|EFR89266.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria marthii FSL
           S4-120]
 gi|313621617|gb|EFR92434.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria innocua FSL
           S4-378]
 gi|328468340|gb|EGF39346.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes 1816]
 gi|328476159|gb|EGF46865.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes 220]
 gi|332310354|gb|EGJ23449.1| Quinol oxidase subunit 4 [Listeria monocytogenes str. Scott A]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +    L  N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNN 107
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNH 108


>gi|16799095|ref|NP_469363.1| hypothetical protein lin0016 [Listeria innocua Clip11262]
 gi|16412437|emb|CAC95249.1| qoxD [Listeria innocua Clip11262]
          Length = 110

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +    L  N+  + I + A  Q
Sbjct: 1   MAQNNKSNAAHAEGGIPWKHIVGFALSIILTLLAVWVAIYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNN 107
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNH 108


>gi|49473795|ref|YP_031837.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella quintana str.
           Toulouse]
 gi|49239298|emb|CAF25624.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella quintana str.
           Toulouse]
          Length = 168

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 9   MNMHSY---GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           M+MH+     +     VGFIL++  T+  F  VM G      I      L  +A I + +
Sbjct: 1   MSMHNETHIPSTSSYFVGFILAVFFTLGSFIPVMYGMMESWAISTKVAYLIGMAIIQIIV 60

Query: 66  --VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
             VFFLH++   +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 61  QIVFFLHLNAGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGSSG 111


>gi|16802064|ref|NP_463549.1| hypothetical protein lmo0016 [Listeria monocytogenes EGD-e]
 gi|47095077|ref|ZP_00232689.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498292|ref|ZP_03666641.1| hypothetical protein LmonF1_00795 [Listeria monocytogenes Finland
           1988]
 gi|224503060|ref|ZP_03671367.1| hypothetical protein LmonFR_11156 [Listeria monocytogenes FSL
           R2-561]
 gi|254827441|ref|ZP_05232128.1| quinol oxidase AA3 [Listeria monocytogenes FSL N3-165]
 gi|254830691|ref|ZP_05235346.1| hypothetical protein Lmon1_05004 [Listeria monocytogenes 10403S]
 gi|254899669|ref|ZP_05259593.1| hypothetical protein LmonJ_07646 [Listeria monocytogenes J0161]
 gi|254913128|ref|ZP_05263140.1| qoxD [Listeria monocytogenes J2818]
 gi|254937509|ref|ZP_05269206.1| quinol oxidase AA3 [Listeria monocytogenes F6900]
 gi|284803249|ref|YP_003415114.1| hypothetical protein LM5578_3006 [Listeria monocytogenes 08-5578]
 gi|284996390|ref|YP_003418158.1| hypothetical protein LM5923_2955 [Listeria monocytogenes 08-5923]
 gi|16409375|emb|CAC98231.1| qoxD [Listeria monocytogenes EGD-e]
 gi|47016422|gb|EAL07343.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258599818|gb|EEW13143.1| quinol oxidase AA3 [Listeria monocytogenes FSL N3-165]
 gi|258610110|gb|EEW22718.1| quinol oxidase AA3 [Listeria monocytogenes F6900]
 gi|284058811|gb|ADB69752.1| hypothetical protein LM5578_3006 [Listeria monocytogenes 08-5578]
 gi|284061857|gb|ADB72796.1| hypothetical protein LM5923_2955 [Listeria monocytogenes 08-5923]
 gi|293591130|gb|EFF99464.1| qoxD [Listeria monocytogenes J2818]
          Length = 110

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS++LT++   + +    L  N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVVLTLLAVWVALYST-LTTNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY--HLNN 107
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNH 108


>gi|296284679|ref|ZP_06862677.1| hypothetical protein CbatJ_13713 [Citromicrobium bathyomarinum
           JL354]
          Length = 132

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 51/106 (48%), Gaps = 9/106 (8%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
            + SY T      GF++SL+LT+  F  ++        I    I   A+ QI+ HL  FL
Sbjct: 18  EIRSYAT------GFVISLLLTVGAFAALLSDLPTTWKIAL--ICGAALIQIVAHLRNFL 69

Query: 70  HMS-TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           H+S    +    ++ ++F++ ++AI   G+ ++M  L   M    G
Sbjct: 70  HLSLADAQSEEDLLLVLFSVCLLAIMAGGTWYIMSDLGGRMHQASG 115


>gi|167461104|ref|ZP_02326193.1| hypothetical protein Plarl_00788 [Paenibacillus larvae subsp.
          larvae BRL-230010]
          Length = 104

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 10 NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
            H +   +  ++ +I+SL+LT++ F  V+ G  LDK  + L ++L  + Q+I  LV+++
Sbjct: 12 RRHKHEGPRNHIISYIISLLLTMLAFAAVLYGG-LDKTFLYLFLLLLGVVQVIFQLVYWM 70

Query: 70 HMSTK 74
          HM  K
Sbjct: 71 HMKEK 75


>gi|152974414|ref|YP_001373931.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023166|gb|ABS20936.1| Cytochrome aa3 quinol oxidase subunit IV [Bacillus cytotoxicus NVH
           391-98]
          Length = 98

 Score = 37.7 bits (86), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
            N   HS G     + GFILSL LT +   + +    L  + +  +I+  A+AQ  + LV
Sbjct: 3   QNNQAHS-GFPWSHVFGFILSLALTFLALYVALYTS-LPLSTVLTSIIAMAVAQAALQLV 60

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            F+HM  + E     +AM+F+  +  +   G++W+ + +
Sbjct: 61  MFMHMK-EGEGIAQTIAMLFSFFIAVVTVAGTVWIFFSM 98


>gi|56421991|ref|YP_149309.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus kaustophilus
           HTA426]
 gi|56381833|dbj|BAD77741.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus kaustophilus
           HTA426]
          Length = 99

 Score = 37.7 bits (86), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H      + ++GF+LSL+LT     + +      K ++ + IVL AI Q  + L  F+
Sbjct: 4   NSHRESFPWKHIIGFLLSLVLTFAALWVALSSGLPLKAVIVI-IVLFAIIQASLQLFLFM 62

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           H++           M+++  +  +   GS+WVM
Sbjct: 63  HVNESDSGKVQTFNMVYSFFIAVVVVAGSIWVM 95


>gi|85717119|ref|ZP_01048079.1| Cytochrome C oxidase subunit IV [Nitrobacter sp. Nb-311A]
 gi|85696079|gb|EAQ33977.1| Cytochrome C oxidase subunit IV [Nitrobacter sp. Nb-311A]
          Length = 102

 Score = 37.4 bits (85), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 1/87 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  LVG +L+ +LT IPFG V     L      + I + A+AQ++VHL +FL +  K   
Sbjct: 3   KSYLVGVLLASVLTAIPFGFVATRT-LPPGQTLIVIGVAAVAQVVVHLRYFLRLDLKSRS 61

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYH 104
               +A+ F   ++ I   G++W+M+ 
Sbjct: 62  QDKFIALCFAATVLFILVGGTLWIMFD 88


>gi|228989831|ref|ZP_04149811.1| Quinol oxidase, subunit IV [Bacillus pseudomycoides DSM 12442]
 gi|228996022|ref|ZP_04155677.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|229003638|ref|ZP_04161453.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228757604|gb|EEM06834.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228763718|gb|EEM12610.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|228769978|gb|EEM18561.1| Quinol oxidase, subunit IV [Bacillus pseudomycoides DSM 12442]
          Length = 101

 Score = 37.0 bits (84), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 50/100 (50%), Gaps = 3/100 (3%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            N    N HS G     + GFILSL LT +   + +    L  + +   I++ A+AQ  +
Sbjct: 3   QNNTQANAHS-GFPWSHVFGFILSLALTFLAVYVTLYTS-LPLSTILTAILVMAVAQAAL 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103
             V F+HM T+ E     + ++F   + A+  VG++W+ +
Sbjct: 61  QFVMFMHM-TEGEGVIQTITIVFHFFIAAVTVVGTVWIFF 99


>gi|228963800|ref|ZP_04124940.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228795871|gb|EEM43339.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar sotto
           str. T04001]
          Length = 103

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +    L  + +  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTT-LPLSTVLTTIIITAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYS-FFVATATVGLTVWIFF 101


>gi|229165640|ref|ZP_04293412.1| Quinol oxidase, subunit IV [Bacillus cereus AH621]
 gi|228617814|gb|EEK74867.1| Quinol oxidase, subunit IV [Bacillus cereus AH621]
          Length = 103

 Score = 37.0 bits (84), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103
            L+ F+H+  + E    I+ MI++  + A     ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRIQILTMIYSFFVAAATVGLTVWIFF 101


>gi|229541706|ref|ZP_04430766.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus coagulans 36D1]
 gi|229326126|gb|EEN91801.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus coagulans 36D1]
          Length = 94

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 45/83 (54%), Gaps = 1/83 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LS++LT++   + +    L K  +  TI   A  Q  V L  F+H+        +
Sbjct: 12  IIGFLLSIVLTLVALYVALYTN-LSKTAIIWTIGFFAFLQAGVQLFMFMHVKEGESGKIN 70

Query: 81  IMAMIFTIIMVAICFVGSMWVMY 103
           +  MI++II+  +   G++WVM+
Sbjct: 71  VGNMIYSIIIAIVVVYGTIWVMH 93


>gi|299535601|ref|ZP_07048922.1| cytochrome aa3 quinol oxidase, subunit IV [Lysinibacillus
           fusiformis ZC1]
 gi|298728801|gb|EFI69355.1| cytochrome aa3 quinol oxidase, subunit IV [Lysinibacillus
           fusiformis ZC1]
          Length = 94

 Score = 36.2 bits (82), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 47/86 (54%), Gaps = 2/86 (2%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            KQ ++GF  SL+LTI+   +V   F +  N+    +++ A+AQ  V LV F+H+    +
Sbjct: 6   PKQHVMGFGFSLLLTIVALAVV--KFDMSLNMAFGILLVTALAQATVQLVLFMHIGESED 63

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVM 102
                  +++++ +  +  +G+++ M
Sbjct: 64  KKTLYTTILYSVFVGVVTIIGTLFAM 89


>gi|94495037|ref|ZP_01301618.1| cytochrome o ubiquinol oxidase, subunit IV [Sphingomonas sp. SKA58]
 gi|94425303|gb|EAT10323.1| cytochrome o ubiquinol oxidase, subunit IV [Sphingomonas sp. SKA58]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           N N       +  LVG+  ++++T + F IV       K      + L A  QI++    
Sbjct: 2   NGNDERRAEVRSYLVGYAGAIVMTGVAFAIVQWPIASPKLTFAAVLTL-AFTQIVLQFRC 60

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLH+S +      +  ++F+ ++VA+   G++ ++ +L   MM
Sbjct: 61  FLHISLRRSARDDLQLILFSTLVVALMVGGTLVILLNLRERMM 103


>gi|42779847|ref|NP_977094.1| quinol oxidase, subunit IV [Bacillus cereus ATCC 10987]
 gi|42735764|gb|AAS39702.1| quinol oxidase, subunit IV [Bacillus cereus ATCC 10987]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|229056467|ref|ZP_04195879.1| Quinol oxidase, subunit IV [Bacillus cereus AH603]
 gi|228720864|gb|EEL72414.1| Quinol oxidase, subunit IV [Bacillus cereus AH603]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHGHS-GFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103
            L+ F+H+  + E    I+ MI++  + A     ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRIQILTMIYSFFVAAATVGLTVWIFF 101


>gi|30018877|ref|NP_830508.1| cytochrome aa3 quinol oxidase polypeptide IV [Bacillus cereus ATCC
           14579]
 gi|75762631|ref|ZP_00742476.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218233610|ref|YP_002365494.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus B4264]
 gi|218895753|ref|YP_002444164.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus G9842]
 gi|228899383|ref|ZP_04063644.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 4222]
 gi|228906453|ref|ZP_04070334.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228942998|ref|ZP_04105503.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228951198|ref|ZP_04113313.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228957118|ref|ZP_04118888.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228975946|ref|ZP_04136467.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977447|ref|ZP_04137841.1| Quinol oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|229042561|ref|ZP_04190304.1| Quinol oxidase, subunit IV [Bacillus cereus AH676]
 gi|229068384|ref|ZP_04201687.1| Quinol oxidase, subunit IV [Bacillus cereus F65185]
 gi|229078011|ref|ZP_04210620.1| Quinol oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|229108307|ref|ZP_04237926.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|229126126|ref|ZP_04255147.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|229143424|ref|ZP_04271853.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|229149038|ref|ZP_04277282.1| Quinol oxidase, subunit IV [Bacillus cereus m1550]
 gi|229177228|ref|ZP_04304615.1| Quinol oxidase, subunit IV [Bacillus cereus 172560W]
 gi|29894419|gb|AAP07709.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus cereus ATCC
           14579]
 gi|74489878|gb|EAO53249.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218161567|gb|ACK61559.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus B4264]
 gi|218545032|gb|ACK97426.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus G9842]
 gi|228606234|gb|EEK63668.1| Quinol oxidase, subunit IV [Bacillus cereus 172560W]
 gi|228634420|gb|EEK91005.1| Quinol oxidase, subunit IV [Bacillus cereus m1550]
 gi|228640052|gb|EEK96453.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|228657333|gb|EEL13150.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|228675144|gb|EEL30369.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|228705349|gb|EEL57726.1| Quinol oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|228714845|gb|EEL66717.1| Quinol oxidase, subunit IV [Bacillus cereus F65185]
 gi|228726780|gb|EEL77994.1| Quinol oxidase, subunit IV [Bacillus cereus AH676]
 gi|228782271|gb|EEM30455.1| Quinol oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|228783782|gb|EEM31840.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228802565|gb|EEM49412.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228808495|gb|EEM54999.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228816662|gb|EEM62782.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228853180|gb|EEM97956.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228860237|gb|EEN04636.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 4222]
 gi|326938472|gb|AEA14368.1| cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +    L  + +  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTT-LPLSTVLTTIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|206967909|ref|ZP_03228865.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH1134]
 gi|229095349|ref|ZP_04226341.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-29]
 gi|229101460|ref|ZP_04232201.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-28]
 gi|229114299|ref|ZP_04243719.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|229188906|ref|ZP_04315939.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|206736829|gb|EDZ53976.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH1134]
 gi|228594611|gb|EEK52397.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|228669137|gb|EEL24559.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|228681948|gb|EEL36084.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-28]
 gi|228688208|gb|EEL42094.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-29]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +    L  + +  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTT-LPLSTVLTTIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|229171483|ref|ZP_04299067.1| Quinol oxidase, subunit IV [Bacillus cereus MM3]
 gi|228612021|gb|EEK69259.1| Quinol oxidase, subunit IV [Bacillus cereus MM3]
          Length = 103

 Score = 36.2 bits (82), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +    L  + +  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTT-LPLSTVLTTIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|229159779|ref|ZP_04287787.1| Quinol oxidase, subunit IV [Bacillus cereus R309803]
 gi|228623716|gb|EEK80534.1| Quinol oxidase, subunit IV [Bacillus cereus R309803]
          Length = 103

 Score = 35.8 bits (81), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +    L  + +  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTS-LPLSTVLTTIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|47568830|ref|ZP_00239524.1| quinol oxidase, subunit IV [Bacillus cereus G9241]
 gi|47554506|gb|EAL12863.1| quinol oxidase, subunit IV [Bacillus cereus G9241]
          Length = 103

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|196047111|ref|ZP_03114329.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB108]
 gi|225862678|ref|YP_002748056.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB102]
 gi|196022092|gb|EDX60781.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB108]
 gi|225788629|gb|ACO28846.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB102]
          Length = 103

 Score = 35.8 bits (81), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|222094455|ref|YP_002528514.1| quinol oxidase, subunit iv (cytochrome c oxidase, subunit iv)
           [Bacillus cereus Q1]
 gi|221238512|gb|ACM11222.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus Q1]
          Length = 103

 Score = 35.8 bits (81), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYSDLPLSTILT-TIIVMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    ++ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQVLTMIYSFF-VATATVGLTVWIFF 101


>gi|49480257|ref|YP_034956.1| quinol oxidase subunit IV (cytochrome C oxidase subunit IV)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|165872915|ref|ZP_02217539.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0488]
 gi|167635163|ref|ZP_02393479.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0442]
 gi|167641836|ref|ZP_02400076.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0193]
 gi|170689434|ref|ZP_02880625.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0465]
 gi|177652861|ref|ZP_02935234.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0174]
 gi|190568522|ref|ZP_03021428.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035699|ref|ZP_03103102.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus W]
 gi|227816429|ref|YP_002816438.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CDC 684]
 gi|254684223|ref|ZP_05148083.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725885|ref|ZP_05187667.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A1055]
 gi|254734415|ref|ZP_05192128.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742101|ref|ZP_05199788.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Kruger B]
 gi|254755777|ref|ZP_05207810.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Vollum]
 gi|49331813|gb|AAT62459.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|164711328|gb|EDR16881.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0488]
 gi|167510184|gb|EDR85590.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0193]
 gi|167529422|gb|EDR92173.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0442]
 gi|170666596|gb|EDT17368.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0465]
 gi|172081895|gb|EDT66964.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0174]
 gi|190560316|gb|EDV14295.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991666|gb|EDX55631.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus W]
 gi|227006937|gb|ACP16680.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CDC 684]
          Length = 103

 Score = 35.4 bits (80), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIVMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|229028499|ref|ZP_04184619.1| Quinol oxidase, subunit IV [Bacillus cereus AH1271]
 gi|228732812|gb|EEL83674.1| Quinol oxidase, subunit IV [Bacillus cereus AH1271]
          Length = 103

 Score = 35.4 bits (80), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIVMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|307708749|ref|ZP_07645211.1| ABC transporter membrane-spanning permease - macrolide efflux
           [Streptococcus mitis NCTC 12261]
 gi|307615115|gb|EFN94326.1| ABC transporter membrane-spanning permease - macrolide efflux
           [Streptococcus mitis NCTC 12261]
          Length = 392

 Score = 35.4 bits (80), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 51/102 (50%), Gaps = 12/102 (11%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGF--ILSLILTII--PFGIVMKGFFLDKNIMCLTIVLC 56
           M YD  +++ + S GT  Q ++G   I  L+ +I+  PFG V+   F  + I+ +T ++C
Sbjct: 20  MLYDYGNSVWLASMGTIGQTVLGMYQISELVTSILVNPFGGVISDRFSRRRILMVTDLVC 79

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGS 98
            I  + +  +          D W I A+IF  I+ AI F  S
Sbjct: 80  GILCLAISFI--------RNDSWMIGALIFANIVQAIAFAFS 113


>gi|52144611|ref|YP_082217.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus E33L]
 gi|206977797|ref|ZP_03238687.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           H3081.97]
 gi|217958284|ref|YP_002336830.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH187]
 gi|229154400|ref|ZP_04282519.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|301052349|ref|YP_003790560.1| quinol oxidase subunit IV [Bacillus anthracis CI]
 gi|51978080|gb|AAU19630.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus E33L]
 gi|206743994|gb|EDZ55411.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           H3081.97]
 gi|217064048|gb|ACJ78298.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH187]
 gi|228629048|gb|EEK85756.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|300374518|gb|ADK03422.1| quinol oxidase, subunit IV [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324741|gb|ADY20001.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 103

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    ++ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQVLTMIYSFF-VATATVGLTVWIFF 101


>gi|309253181|gb|ADO60577.1| cytochrome c oxidase subunit II [Cerylon histeroides]
          Length = 234

 Score = 35.0 bits (79), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 48/81 (59%), Gaps = 7/81 (8%)

Query: 41  GFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG------WSIMAMIFTIIMVAIC 94
            FF D  +M LTI+   ++Q++++L F  ++   + +G      W+IM  I T+I +A+ 
Sbjct: 21  SFFHDHTLMILTIITILVSQMMLNLFFNKYIHRLLLEGQLIELIWTIMPAI-TLIFIALP 79

Query: 95  FVGSMWVMYHLNNNMMSMEGM 115
            +  ++++  +NN ++S++ M
Sbjct: 80  SLQLLYILDEINNPLVSIKSM 100


>gi|229016029|ref|ZP_04172985.1| Quinol oxidase, subunit IV [Bacillus cereus AH1273]
 gi|229022248|ref|ZP_04178793.1| Quinol oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228739051|gb|EEL89502.1| Quinol oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228745262|gb|EEL95308.1| Quinol oxidase, subunit IV [Bacillus cereus AH1273]
          Length = 103

 Score = 35.0 bits (79), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIVMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    ++ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRIQVLTMIYSFF-VATATVGLTVWIFF 101


>gi|138897017|ref|YP_001127470.1| cytochrome aa3 quinol oxidase polypeptide IV [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268530|gb|ABO68725.1| Cytochrome aa3 quinol oxidase polypeptide IV [Geobacillus
           thermodenitrificans NG80-2]
          Length = 99

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H      + L+GF+LSL+LT     + +      K ++ + IVL A+ Q  + L  F+
Sbjct: 4   NGHHESFPWKHLIGFVLSLLLTFAALWVALSSGLPLKAVIVV-IVLFAMIQASLQLFMFM 62

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           H+            M+++  +  I   GS+WVM
Sbjct: 63  HVVESDSGKVQTFNMVYSFFIAVIVVAGSVWVM 95


>gi|109140764|gb|ABG26139.1| cytochrome oxidase subunit II [Cephaloleia apicata]
          Length = 181

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 46/81 (56%), Gaps = 7/81 (8%)

Query: 41  GFFLDKNIMCLTIVLCAIAQIIVHLVF------FLHMSTKVEDGWSIMAMIFTIIMVAIC 94
            FF D  +M LTI+   ++Q++++L F      FL     +E  W+I+  I T+I +AI 
Sbjct: 21  SFFHDHTLMILTIITILVSQLLINLFFNKFINRFLLEGQMIEMIWTILPAI-TLIFIAIP 79

Query: 95  FVGSMWVMYHLNNNMMSMEGM 115
            +  ++++  +NN  +S++ +
Sbjct: 80  SLRLIYIIDEINNPTISIKSI 100


>gi|30260850|ref|NP_843227.1| quinol oxidase, subunit IV [Bacillus anthracis str. Ames]
 gi|47525981|ref|YP_017330.1| quinol oxidase subunit IV [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183691|ref|YP_026943.1| quinol oxidase subunit IV [Bacillus anthracis str. Sterne]
 gi|65318128|ref|ZP_00391087.1| COG3125: Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Bacillus anthracis str. A2012]
 gi|170709009|ref|ZP_02899440.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0389]
 gi|229601937|ref|YP_002865295.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0248]
 gi|254762357|ref|ZP_05214201.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Australia 94]
 gi|30254299|gb|AAP24713.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Ames]
 gi|47501129|gb|AAT29805.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49177618|gb|AAT52994.1| quinol oxidase, subunit IV [Bacillus anthracis str. Sterne]
 gi|170126111|gb|EDS95007.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0389]
 gi|229266345|gb|ACQ47982.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0248]
          Length = 103

 Score = 35.0 bits (79), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI+  A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIAMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    I+ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQILTMIYSFF-VATATVGLTVWIFF 101


>gi|229195023|ref|ZP_04321800.1| Quinol oxidase, subunit IV [Bacillus cereus m1293]
 gi|228588458|gb|EEK46499.1| Quinol oxidase, subunit IV [Bacillus cereus m1293]
          Length = 103

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHAHS-GFPWSHVFGFILSLALTFLALYVALYTDLPLSTILT-TIIVMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    ++ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRVQVLTMIYSFF-VATATVGLTVWIFF 101


>gi|194016546|ref|ZP_03055160.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus pumilus ATCC
           7061]
 gi|194012019|gb|EDW21587.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus pumilus ATCC
           7061]
          Length = 126

 Score = 35.0 bits (79), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 50/96 (52%), Gaps = 4/96 (4%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           +VGFILS++LTI+ F I + G  +  +     I   A  Q  + L  F+HM T+ E+G  
Sbjct: 19  VVGFILSIVLTILAFWIAI-GAEIGSSAKLWIIFGFAFIQAFLQLFMFMHM-TESENGTV 76

Query: 81  IMAMIFTIIMVAICFV-GSMWVM-YHLNNNMMSMEG 114
            +      +  AI FV GS+W+   H ++   S +G
Sbjct: 77  QVGNTLFGLFCAIIFVIGSVWIFAAHYSHGENSKDG 112


>gi|157694209|ref|YP_001488671.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus pumilus
           SAFR-032]
 gi|157682967|gb|ABV64111.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus pumilus
           SAFR-032]
          Length = 126

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
             H+   H +   K  +VGFILS++LT++ F I + G  +  +     I   A  Q  + 
Sbjct: 4   KTHSSAEHEHFPWKH-VVGFILSIVLTVLAFWIAI-GAEIGSSAKLWIIFGFAFIQAFLQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFV-GSMWVM-YHLNNNMMSMEG 114
           L  F+HM T+ E+G   +      +  AI FV GS+W+   H ++   S +G
Sbjct: 62  LFMFMHM-TESENGTVQVGNTLFGLFCAIIFVIGSVWIFAAHYSHGENSKDG 112


>gi|229541232|ref|ZP_04430292.1| cytochrome c oxidase, subunit IV [Bacillus coagulans 36D1]
 gi|229325652|gb|EEN91327.1| cytochrome c oxidase, subunit IV [Bacillus coagulans 36D1]
          Length = 109

 Score = 34.7 bits (78), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 18 KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
          K  +V FIL + LTII F  V     L K      I+L A  Q++  L +F+HM+ K  +
Sbjct: 26 KYQVVSFILMMFLTIIAFWAVHAH--LSKWFTIPVILLLAAIQVVFQLFYFMHMNHKHHE 83

Query: 78 G 78
          G
Sbjct: 84 G 84


>gi|73663042|ref|YP_301823.1| quinol oxidase polypeptide IV [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123642234|sp|Q49WI1|QOX4_STAS1 RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|72495557|dbj|BAE18878.1| quinol oxidase polypeptide IV [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 96

 Score = 34.7 bits (78), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 43/83 (51%), Gaps = 5/83 (6%)

Query: 22  VGFILSLILTIIP-FGIVMKGFFLDKNIMCLTIVLC-AIAQIIVHLVFFLHMSTKVEDGW 79
           VGFI S++LTI+  F  +     L+  I   TI+   A  Q  V L+ F+H++   +   
Sbjct: 9   VGFIASIVLTILAVFVTLYTSMALNAKI---TIIFGFAFIQAAVQLLMFMHLTESKDGNL 65

Query: 80  SIMAMIFTIIMVAICFVGSMWVM 102
               ++F II+  I  +G+ WVM
Sbjct: 66  QTFKVLFAIIITLITVIGTYWVM 88


>gi|109140767|gb|ABG26141.1| cytochrome oxidase subunit II [Cephaloleia cf. championi
           McKenna-033]
          Length = 181

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 48/81 (59%), Gaps = 7/81 (8%)

Query: 41  GFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG------WSIMAMIFTIIMVAIC 94
            FF D  +M LTI+   ++Q++V+L+F  ++   + +G      W+I+  I T+I +A+ 
Sbjct: 21  SFFHDHALMILTIITILVSQLLVNLIFNKYLYRYLLEGQFIEMIWTILPAI-TLIFIALP 79

Query: 95  FVGSMWVMYHLNNNMMSMEGM 115
            +  ++++  +NN  +S++ +
Sbjct: 80  SLRLIYIIDEINNPSISIKAI 100


>gi|163938624|ref|YP_001643508.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus
           weihenstephanensis KBAB4]
 gi|229131647|ref|ZP_04260528.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST196]
 gi|163860821|gb|ABY41880.1| Cytochrome aa3 quinol oxidase subunit IV [Bacillus
           weihenstephanensis KBAB4]
 gi|228651795|gb|EEL07751.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST196]
          Length = 103

 Score = 34.3 bits (77), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 54/101 (53%), Gaps = 5/101 (4%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +N  N + HS G     + GFILSL LT +   + +        I+  TI++ A+AQ ++
Sbjct: 5   NNQANGHGHS-GFPWSHVFGFILSLALTFLALYVALYTNLPLSTILT-TIIIMAVAQALL 62

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVG-SMWVMY 103
            L+ F+H+  + E    ++ MI++   VA   VG ++W+ +
Sbjct: 63  QLIMFMHLK-EGEGRIQVLTMIYSFF-VATATVGLTVWIFF 101


>gi|322376749|ref|ZP_08051242.1| major facilitator family transporter [Streptococcus sp. M334]
 gi|321282556|gb|EFX59563.1| major facilitator family transporter [Streptococcus sp. M334]
          Length = 392

 Score = 34.3 bits (77), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 12/102 (11%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGF--ILSLILTII--PFGIVMKGFFLDKNIMCLTIVLC 56
           M YD  +++ + S GT  Q ++G   I  L+ +I+  PFG V+   F  + I+  T ++C
Sbjct: 20  MLYDYGNSVWLASMGTIGQTVLGMYQISELVTSILVNPFGGVISDRFSRRKILMTTDLVC 79

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGS 98
            I  + +  +          D W I A+IF  I+ A+ F  S
Sbjct: 80  GILCLTISFI--------RNDSWMIGALIFANIVQAVAFAFS 113


>gi|295402443|ref|ZP_06812396.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112704|ref|YP_003991020.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus sp. Y4.1MC1]
 gi|294975534|gb|EFG51159.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217805|gb|ADP76409.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp. Y4.1MC1]
          Length = 99

 Score = 34.3 bits (77), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 43/93 (46%), Gaps = 1/93 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           N H      + +VGFI SL+LT     + +        I+ + IV+ A+ Q  + L  F+
Sbjct: 4   NHHHETFPWKHIVGFIFSLLLTFAALWVALSSGLSTGAIIGI-IVILAVIQASLQLFMFM 62

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           HM+         + M ++  +  +  VGS+W M
Sbjct: 63  HMTESDSGKIQTINMAYSFFIAVVVVVGSIWTM 95


>gi|197302740|ref|ZP_03167793.1| hypothetical protein RUMLAC_01469 [Ruminococcus lactaris ATCC
           29176]
 gi|197298138|gb|EDY32685.1| hypothetical protein RUMLAC_01469 [Ruminococcus lactaris ATCC
           29176]
          Length = 760

 Score = 34.3 bits (77), Expect = 6.0,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 54/110 (49%), Gaps = 12/110 (10%)

Query: 1   MKYDNIHNMNMHSYGTKK---QCLVGFILSLILTIIPFGIV---MKGFFLD--KNIMCLT 52
           +K + + N+ +  Y   K   Q L+G I S+ILT++   +V    KG F    +  M  T
Sbjct: 570 LKREYMSNLKLPCYMMSKFVLQALLGLIQSIILTLVFLSLVGNSKKGIFFSDFRPEMLFT 629

Query: 53  IVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           + L  IA + +  +    +S+ V+ G   MA    +++V + F G ++ +
Sbjct: 630 VWLTVIASVAMGFI----ISSVVQSGDKAMAAAPFVLIVQLLFSGILFTL 675


>gi|258510524|ref|YP_003183958.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477250|gb|ACV57569.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 107

 Score = 34.3 bits (77), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 47/90 (52%), Gaps = 5/90 (5%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G   + ++G+ LSLI T I F + +      + ++ L  VL A+ QI V L FF+H++  
Sbjct: 13  GGLAKYIIGYGLSLIFTAIAFWLALSHAMSIRPLIILLFVLAAL-QIGVQLFFFMHVTEG 71

Query: 75  VEDGWSIMAMIFTIIMVAICFVG--SMWVM 102
             DG    A++  + M+    V   SMW+M
Sbjct: 72  --DGPPYHALLLLLGMIFTFAVAMMSMWIM 99


>gi|7270301|emb|CAB80070.1| putative potassium transporter AtKT5p (AtKT5) [Arabidopsis
           thaliana]
          Length = 839

 Score = 33.9 bits (76), Expect = 6.7,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 32  IIPFGIVMKGFFLDKNIMCL-------TIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM 84
           I   GI+M    L   IM L        + + AI  +IV LVFF  + + V DG S + +
Sbjct: 488 IAELGIMMTTTILVTLIMLLIWQTNIIVVSMFAIVSLIVELVFFSSVCSSVADG-SWIIL 546

Query: 85  IFTIIMVAICFV 96
           +F  IM  I FV
Sbjct: 547 VFATIMFLIMFV 558


>gi|218289388|ref|ZP_03493622.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius LAA1]
 gi|258510664|ref|YP_003184098.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218240494|gb|EED07675.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius LAA1]
 gi|257477390|gb|ACV57709.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 106

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 53  IVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           IV+  + Q++V L  F+H +   +  W + A+ F + +V     GS+W+M
Sbjct: 50  IVILGVGQLLVQLYMFMHFTESDDRAWQVPAIYFGLFIVFCVVGGSIWIM 99


>gi|126730195|ref|ZP_01746007.1| cytochrome O ubiquinol oxidase subunit IV [Sagittula stellata E-37]
 gi|126709575|gb|EBA08629.1| cytochrome O ubiquinol oxidase subunit IV [Sagittula stellata E-37]
          Length = 103

 Score = 33.9 bits (76), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 11  MHSYGTKKQCL----VGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           M+    + Q L     GF  +++LT + F   +   F    I   ++ + A  Q++VH  
Sbjct: 1   MNDRDERAQDLRMYFTGFAAAIVLTALSFATAILQPFGPMGIFA-SLAVLAAVQVVVHFR 59

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FFLH+    +    +  ++FT +++AI   G++WV+ +L   MM
Sbjct: 60  FFLHIDFSRQKREDLQLILFTGLIIAIMVAGTVWVLGNLMARMM 103


>gi|255019614|ref|ZP_05291695.1| hypothetical protein ACA_2321 [Acidithiobacillus caldus ATCC 51756]
 gi|254970958|gb|EET28439.1| hypothetical protein ACA_2321 [Acidithiobacillus caldus ATCC 51756]
          Length = 121

 Score = 33.9 bits (76), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 49/106 (46%), Gaps = 2/106 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
            +++  L GFIL+ +L  +   +V     L    + L I+ CA   +I  + F LH+   
Sbjct: 17  ASRRGYLTGFILASVLMALATFLV-SSHALPPFALLLAIMACAGFAVIAQVYFLLHIDIS 75

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLN-NNMMSMEGMRSIH 119
             + W+ +A++  + +  I    + W+   L    M S+ GM  +H
Sbjct: 76  EHNIWNTVALVAFVPLFVITIGLTWWMFSQLYLRTMPSIPGMPGMH 121


>gi|109140770|gb|ABG26143.1| cytochrome oxidase subunit II [Cephaloleia cf. championi
           McKenna-034]
          Length = 181

 Score = 33.9 bits (76), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 41  GFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG------WSIMAMIFTIIMVAIC 94
            FF D  +M LTI+   + Q++V+L+F  ++   + +G      W+I+  I T+I +A+ 
Sbjct: 21  SFFHDHALMILTIITILVGQLLVNLIFNKYLYRYLLEGQFIEMIWTILPAI-TLIFIALP 79

Query: 95  FVGSMWVMYHLNNNMMSMEGM 115
            +  ++++  +NN  +S++ +
Sbjct: 80  SLRLIYIIDEINNPSISIKAI 100


>gi|289811051|ref|ZP_06541680.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
          subsp. enterica serovar Typhi str. AG3]
          Length = 40

 Score = 33.9 bits (76), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 15 GTKKQCLVGFILSLILTIIPFGIVMKG 41
          G+ K  + GFILS+ILT+IPF +VM G
Sbjct: 1  GSVKTYMTGFILSVILTVIPFWMVMTG 27


>gi|226360492|ref|YP_002778270.1| sugar transporter [Rhodococcus opacus B4]
 gi|226238977|dbj|BAH49325.1| sugar transporter [Rhodococcus opacus B4]
          Length = 489

 Score = 33.9 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 43/79 (54%), Gaps = 5/79 (6%)

Query: 25  ILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM 84
           + S+++TI+  GIV+ GF   + ++    +  A +Q  + LVF L  ST     + I+A 
Sbjct: 318 VTSVVMTIL--GIVLLGFVNRRKMLLTGFIGVATSQAALSLVFLLPSSTG--RSYIILAA 373

Query: 85  IFTIIMVAICFVGS-MWVM 102
           +   +    CF+G+ +W++
Sbjct: 374 MMVFVAFVQCFIGTCVWLL 392


>gi|161318375|gb|ABX60491.1| cytochrome oxidase subunit II [Corticarina sp. 3 NPL-2007]
          Length = 203

 Score = 33.5 bits (75), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 41  GFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG------WSIMAMIFTIIMVAIC 94
            FF D  I+ L I+   ++Q++++L F   ++  + DG      W+IM  I T+I +A+ 
Sbjct: 2   NFFHDHAILVLVIITILVSQLMINLFFNKFINRYLLDGQMIELIWTIMPAI-TLIFIALP 60

Query: 95  FVGSMWVMYHLNNNMMSMEGM 115
            +  ++++  +NN +++++ M
Sbjct: 61  SLRLIYILDEVNNPLITIKSM 81


>gi|304396822|ref|ZP_07378702.1| diguanylate cyclase/phosphodiesterase with MHYT sensor [Pantoea sp.
           aB]
 gi|304355618|gb|EFM19985.1| diguanylate cyclase/phosphodiesterase with MHYT sensor [Pantoea sp.
           aB]
          Length = 694

 Score = 33.5 bits (75), Expect = 8.9,   Method: Composition-based stats.
 Identities = 19/101 (18%), Positives = 53/101 (52%), Gaps = 7/101 (6%)

Query: 25  ILSLILTIIP----FGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ILSL++ I+P    FG  + G  L +  +    ++ +   +++H +    +  +    W+
Sbjct: 80  ILSLLVAIMPSMFAFGQTVGGLHLTRYRLLRGTLILSSGIVVMHYLGMYALLIEPRPEWN 139

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHL---NNNMMSMEGMRSI 118
           ++ +  ++I+  +    ++W+ +HL   +++++ M G+ S+
Sbjct: 140 VLRVALSVIIAFVASGVALWLAFHLRQGDHHLLLMRGLASL 180


>gi|22329125|ref|NP_195079.2| KUP5; potassium ion transmembrane transporter [Arabidopsis
           thaliana]
 gi|38503045|sp|Q8LPL8|POT13_ARATH RecName: Full=Potassium transporter 13; Short=AtKT5; Short=AtPOT13
 gi|20466181|gb|AAM20408.1| putative potassium transporter AtKT5p [Arabidopsis thaliana]
 gi|34098835|gb|AAQ56800.1| At4g33530 [Arabidopsis thaliana]
 gi|332660842|gb|AEE86242.1| Potassium transporter 13 [Arabidopsis thaliana]
          Length = 855

 Score = 33.5 bits (75), Expect = 8.9,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 32  IIPFGIVMKGFFLDKNIMCL-------TIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM 84
           I   GI+M    L   IM L        + + AI  +IV LVFF  + + V DG S + +
Sbjct: 504 IAELGIMMTTTILVTLIMLLIWQTNIIVVSMFAIVSLIVELVFFSSVCSSVADG-SWIIL 562

Query: 85  IFTIIMVAICFV 96
           +F  IM  I FV
Sbjct: 563 VFATIMFLIMFV 574


>gi|3859659|emb|CAA20566.1| putative potassium transporter AtKT5p (AtKT5) [Arabidopsis
           thaliana]
          Length = 846

 Score = 33.5 bits (75), Expect = 10.0,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 8/72 (11%)

Query: 32  IIPFGIVMKGFFLDKNIMCL-------TIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM 84
           I   GI+M    L   IM L        + + AI  +IV LVFF  + + V DG S + +
Sbjct: 495 IAELGIMMTTTILVTLIMLLIWQTNIIVVSMFAIVSLIVELVFFSSVCSSVADG-SWIIL 553

Query: 85  IFTIIMVAICFV 96
           +F  IM  I FV
Sbjct: 554 VFATIMFLIMFV 565


Searching..................................................done


Results from round 2




>gi|114707979|ref|ZP_01440871.1| Prokaryotic Cytochrome C oxidase subunit IV [Fulvimarina pelagi
           HTCC2506]
 gi|114536608|gb|EAU39740.1| Prokaryotic Cytochrome C oxidase subunit IV [Fulvimarina pelagi
           HTCC2506]
          Length = 223

 Score =  156 bits (396), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 51/111 (45%), Positives = 69/111 (62%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
            H     ++ T    L GF LS++LT +PF +VM     D     L +V  A+AQI VH+
Sbjct: 19  SHGEGGEAHATLSGYLTGFGLSVVLTAVPFWLVMARPIEDGVTTALLVVSLAVAQIFVHM 78

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           ++FLHM  K E GW+IMA+IFT ++V I   GS+WVM+HLN NMM M  M+
Sbjct: 79  IYFLHMDAKSEGGWTIMALIFTAVLVIITISGSLWVMFHLNRNMMPMGDMQ 129


>gi|218532589|ref|YP_002423405.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           chloromethanicum CM4]
 gi|218524892|gb|ACK85477.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           chloromethanicum CM4]
          Length = 126

 Score =  141 bits (357), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 75/118 (63%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
             D+ H  + H +G+ K  + GF+LS+ILT IPF +VM     DK I  + I+     QI
Sbjct: 7   ADDHGHGQDAHGHGSFKDYVTGFVLSVILTAIPFWLVMGDVLGDKLITGVVILGLGAVQI 66

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           +VH+++FLHM+TK E GW+ MA+IFTI +V I   GS+WVM+HLN NMM +      H
Sbjct: 67  VVHMIYFLHMNTKSEGGWTFMALIFTITLVVITLCGSIWVMHHLNTNMMPISPEEIRH 124


>gi|33593692|ref|NP_881336.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis
           Tohama I]
 gi|33595767|ref|NP_883410.1| cytochrome ubiquinol oxidase subunit IV [Bordetella parapertussis
           12822]
 gi|33600293|ref|NP_887853.1| cytochrome ubiquinol oxidase subunit IV [Bordetella bronchiseptica
           RB50]
 gi|33563765|emb|CAE43005.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis
           Tohama I]
 gi|33565846|emb|CAE36392.1| cytochrome ubiquinol oxidase subunit IV [Bordetella parapertussis]
 gi|33567892|emb|CAE31805.1| cytochrome ubiquinol oxidase subunit IV [Bordetella bronchiseptica
           RB50]
 gi|332383096|gb|AEE67943.1| cytochrome ubiquinol oxidase subunit IV [Bordetella pertussis CS]
          Length = 135

 Score =  141 bits (357), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 52/109 (47%), Positives = 72/109 (66%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H  +   +GT    L GF+L+ ILT IPF +VM G F       L I+  A+ QI+VH
Sbjct: 19  HHHEDDDGPHGTLASYLTGFVLAAILTAIPFWLVMDGVFASSRTTALVILAFAVVQIVVH 78

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           LV+FLHM  K E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M 
Sbjct: 79  LVYFLHMDAKSESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMS 127


>gi|163853731|ref|YP_001641774.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens PA1]
 gi|240141156|ref|YP_002965636.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens AM1]
 gi|254563668|ref|YP_003070763.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens DM4]
 gi|163665336|gb|ABY32703.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           extorquens PA1]
 gi|240011133|gb|ACS42359.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens AM1]
 gi|254270946|emb|CAX26951.1| cytochrome o ubiquinol oxidase, subunit IV [Methylobacterium
           extorquens DM4]
          Length = 126

 Score =  141 bits (356), Expect = 3e-32,   Method: Composition-based stats.
 Identities = 54/118 (45%), Positives = 75/118 (63%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
             D+ H  + H +G+ K  + GF+LS+ILT IPF +VM     DK I  + I+     QI
Sbjct: 7   ADDHGHGQDAHGHGSFKDYVTGFVLSVILTAIPFWLVMGDVLGDKLITGVVILGLGAVQI 66

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           +VH+++FLHM+TK E GW+ MA+IFTI +V I   GS+WVM+HLN NMM +      H
Sbjct: 67  VVHMIYFLHMNTKSEGGWTFMALIFTITLVVITLCGSIWVMHHLNTNMMPISPEEMRH 124


>gi|170743800|ref|YP_001772455.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium sp.
           4-46]
 gi|168198074|gb|ACA20021.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium sp.
           4-46]
          Length = 140

 Score =  138 bits (348), Expect = 2e-31,   Method: Composition-based stats.
 Identities = 47/118 (39%), Positives = 76/118 (64%), Gaps = 1/118 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            + + H+    ++G+ +  + GF+LS+ILT IPF +VM     D  +  + I+  A  QI
Sbjct: 22  AHGSAHHPGG-AHGSFRGYVTGFVLSVILTAIPFWLVMANTLDDTLVTSIVIMALAAVQI 80

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           +VH+++FLHM+TK E GW+ MA++FT+ +V I   GS+WVMYH++ NMM M    ++ 
Sbjct: 81  VVHMIYFLHMNTKSEGGWTFMALVFTLTLVVITLAGSIWVMYHMDQNMMPMSPHEALQ 138


>gi|329915608|ref|ZP_08276292.1| Cytochrome O ubiquinol oxidase subunit IV [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327544869|gb|EGF30239.1| Cytochrome O ubiquinol oxidase subunit IV [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 180

 Score =  137 bits (346), Expect = 4e-31,   Method: Composition-based stats.
 Identities = 54/111 (48%), Positives = 76/111 (68%), Gaps = 1/111 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           ++D  H+ +   +G+ K  L GFIL++ILT IPF +V+   F   +   L ++  A  QI
Sbjct: 17  EHDESHHTHA-DHGSVKSYLTGFILAVILTAIPFWVVLGKVFEKSSTTALVVLGFAAVQI 75

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           +VH+V+FLHM+TK E GWSI+A+IFT I+V I   GS+WVMYHLN+NMM  
Sbjct: 76  VVHMVYFLHMNTKSEGGWSILALIFTTILVVIMLSGSIWVMYHLNHNMMPG 126


>gi|116694973|ref|YP_729184.1| bo3-type chinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113529472|emb|CAJ95819.1| bo3-type chinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 141

 Score =  134 bits (339), Expect = 3e-30,   Method: Composition-based stats.
 Identities = 43/110 (39%), Positives = 73/110 (66%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + + H+ ++  + T    L GF+LS+ LT IPF +VM   F   +   + I+L    QI+
Sbjct: 13  HSHGHDEDVGPHATLGGYLTGFVLSVFLTAIPFWLVMGKVFDKSSTTAIVILLIGAVQIV 72

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VH+++FLHM+ + E GW++++++FT+++V I   GS+WVM+HLN+NMM  
Sbjct: 73  VHMIYFLHMNARSEGGWNMLSLMFTLVLVVITLTGSLWVMFHLNSNMMPT 122


>gi|239817019|ref|YP_002945929.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           S110]
 gi|239803596|gb|ACS20663.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           S110]
          Length = 129

 Score =  133 bits (336), Expect = 6e-30,   Method: Composition-based stats.
 Identities = 49/112 (43%), Positives = 73/112 (65%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ H+    S+ T K  + GF+L+++LT IPF +VM       +   L I+  A  QI
Sbjct: 10  AHDDHHDDGPVSHSTFKGYMTGFVLAVVLTAIPFWLVMGNVLGKPSTTSLVILGFAAVQI 69

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +VH+++FLHM  K E GW+++A+IFTI++V I   GS+WVMYH+N NMM M 
Sbjct: 70  VVHMIYFLHMDAKSESGWNMLALIFTIVLVVITLAGSLWVMYHMNANMMPMS 121


>gi|16126014|ref|NP_420578.1| ubiquinol oxidase subunit IV [Caulobacter crescentus CB15]
 gi|221234785|ref|YP_002517221.1| quinol cytochrome oxidase polypeptide IV [Caulobacter crescentus
           NA1000]
 gi|13423196|gb|AAK23746.1| ubiquinol oxidase subunit IV [Caulobacter crescentus CB15]
 gi|220963957|gb|ACL95313.1| quinol cytochrome oxidase polypeptide IV [Caulobacter crescentus
           NA1000]
          Length = 129

 Score =  133 bits (335), Expect = 8e-30,   Method: Composition-based stats.
 Identities = 46/119 (38%), Positives = 79/119 (66%), Gaps = 2/119 (1%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D   + +  ++GT K  ++GF+L++ILT IPF +VM        +  + ++  A+ Q+
Sbjct: 10  PHDEHGDAHEAAHGTLKDYVIGFVLAVILTAIPFWLVMGDVLPSAQMTAVAVMGLAVIQV 69

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS--MEGMRSI 118
           +VH+++FLHM+T+ E GW+++A+IFT+I+V I   GS+WVM++LN +MM   M  MR  
Sbjct: 70  VVHMIYFLHMNTRSEGGWTMLALIFTLILVVITLAGSLWVMHNLNTHMMPEMMPDMRQA 128


>gi|124266931|ref|YP_001020935.1| cytochrome ubiquinol oxidase subunit IV [Methylibium petroleiphilum
           PM1]
 gi|124259706|gb|ABM94700.1| cytochrome ubiquinol oxidase subunit IV [Methylibium petroleiphilum
           PM1]
          Length = 127

 Score =  133 bits (335), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 52/118 (44%), Positives = 79/118 (66%), Gaps = 2/118 (1%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + + H  +   +G+ K  ++GF+LSL+LT IPF +VM        +  L I+  A  QI+
Sbjct: 9   HHDGHEGDEAGHGSLKGYVIGFMLSLVLTAIPFWLVMGKVIASSGLTALVILGFAAVQIV 68

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS--MEGMRSI 118
           VH+V+FLHM+ K E GW+I+A+IFT+++V I   GS+WVMYHLN+NMM   M  +R++
Sbjct: 69  VHMVYFLHMNAKSEGGWTILALIFTLVLVVITLSGSLWVMYHLNHNMMPASMHEVRNM 126


>gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040148|gb|ACT56944.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 119

 Score =  132 bits (334), Expect = 1e-29,   Method: Composition-based stats.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ
Sbjct: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
Sbjct: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119


>gi|319786908|ref|YP_004146383.1| cytochrome o ubiquinol oxidase subunit IV [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317465420|gb|ADV27152.1| cytochrome o ubiquinol oxidase subunit IV [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 139

 Score =  132 bits (333), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 73/107 (68%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
             H  +  ++G+ +  ++GF+LS+ILT IPF +VM     D+    L I+  A+ QI+V 
Sbjct: 22  EHHAHDEGAHGSMRDYVIGFVLSVILTAIPFWLVMGNVIQDQGTTALVILGFAVVQIVVQ 81

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +V+FLHM+ + E GW+++A++FT+++V I   GS+WVM+H+N NMM 
Sbjct: 82  MVYFLHMNARSEGGWNMLALMFTVVLVVIVLAGSLWVMHHMNANMMP 128


>gi|260221199|emb|CBA29525.1| Cytochrome o ubiquinol oxidase protein cyoD [Curvibacter putative
           symbiont of Hydra magnipapillata]
          Length = 148

 Score =  132 bits (332), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 71/110 (64%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D+ H+     + T    + GF+LS+ILT IPF +VM     D+    L +   A+ QI+V
Sbjct: 18  DDGHHAANEPHSTFSGYMTGFVLSIILTAIPFWLVMAKVITDRPTAVLVLGGFAVVQILV 77

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           H+V+FLHM+ K+E GW++++ IFT++ VAI   G++WVM+H+N NMM   
Sbjct: 78  HMVYFLHMNGKIEGGWTLLSTIFTVVFVAIAITGTLWVMFHMNANMMPTH 127


>gi|331640947|ref|ZP_08342082.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H736]
 gi|331651365|ref|ZP_08352390.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M718]
 gi|331671975|ref|ZP_08372771.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA280]
 gi|331676100|ref|ZP_08376812.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H591]
 gi|332281579|ref|ZP_08393992.1| cytochrome o ubiquinol oxidase C subunit [Shigella sp. D9]
 gi|1773113|gb|AAB40185.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|331037745|gb|EGI09965.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H736]
 gi|331051106|gb|EGI23158.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M718]
 gi|331070964|gb|EGI42323.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA280]
 gi|331076158|gb|EGI47440.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H591]
 gi|332103931|gb|EGJ07277.1| cytochrome o ubiquinol oxidase C subunit [Shigella sp. D9]
          Length = 136

 Score =  131 bits (330), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 28  MSHSTDHS--GASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 84

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 85  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|117622689|ref|YP_851602.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli APEC
           O1]
 gi|331645603|ref|ZP_08346707.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M605]
 gi|115511813|gb|ABI99887.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli APEC
           O1]
 gi|331045765|gb|EGI17891.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli M605]
          Length = 136

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N    +  S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 28  MSHSNA--SSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 84

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 85  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|158423725|ref|YP_001525017.1| cytochrome o ubiquinol oxidase subunit IV [Azorhizobium caulinodans
           ORS 571]
 gi|158330614|dbj|BAF88099.1| cytochrome o ubiquinol oxidase subunit IV [Azorhizobium caulinodans
           ORS 571]
          Length = 132

 Score =  131 bits (329), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 76/112 (67%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           +  +   H +G+ K  + GFILS+ILT IPF +VM     +  +  + I+  A+ QI+VH
Sbjct: 18  HGAHGEDHGHGSFKSYMTGFILSVILTAIPFWLVMTNALGNNQLTAIVIMAFAVVQIVVH 77

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           +++FLHM+ KVE GWS++A+IFT+I+V I   GS+WVMYHLN NMM    MR
Sbjct: 78  MIYFLHMTGKVEGGWSMLALIFTVIVVVIALSGSLWVMYHLNANMMPSHDMR 129


>gi|241667024|ref|YP_002985108.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM1325]
 gi|240862481|gb|ACS60146.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM1325]
          Length = 133

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 75/113 (66%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT +  + GF+LS+ILT IPF +VM G F    +  + ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFRSYMTGFVLSIILTAIPFWLVMSGVFESPAVTAVLVMGLGAIQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH+VFFLHM+T+ E GW+IMA+IFT+I+VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMVFFLHMNTRSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|110834895|ref|YP_693754.1| cytochrome o ubiquinol oxidase, protein CyoD [Alcanivorax
           borkumensis SK2]
 gi|110648006|emb|CAL17482.1| cytochrome o ubiquinol oxidase, protein CyoD [Alcanivorax
           borkumensis SK2]
          Length = 131

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 74/111 (66%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ HN     + + K+   GF+L++ILT+IPF +VM G F       + I+  A+ QI
Sbjct: 5   THDHDHNDADIPHVSLKEYATGFVLAVILTVIPFWLVMGGVFESSATTVMVILGFALVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           +VH+VFFLHM+   E GW+++A++FT+I+V I   GS+WVM++LN NMM  
Sbjct: 65  VVHMVFFLHMNFHSEGGWNMLALMFTLILVFITLAGSLWVMHNLNVNMMPG 115


>gi|237730406|ref|ZP_04560887.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter sp. 30_2]
 gi|226905945|gb|EEH91863.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter sp. 30_2]
          Length = 136

 Score =  130 bits (328), Expect = 5e-29,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N       S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 28  MSHSN--ESGGASHGSVKTYMTGFILSIILTVIPFWMVMTGSA-SPAVILGTILAMAVVQ 84

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM++K ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 85  ILVHLVCFLHMNSKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 134


>gi|187928955|ref|YP_001899442.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|187725845|gb|ACD27010.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
          Length = 142

 Score =  129 bits (325), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 68/102 (66%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
            +  + T    L GF+LS+ LT IPF +VM   F   +   +TI+L    QI+VH+++FL
Sbjct: 23  EIGPHATLGGYLTGFVLSVFLTAIPFWLVMANVFDRSSTTAVTILLIGAVQIVVHMIYFL 82

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HM+ K E GW++++++FT+++V I   GS+WVMYHLN NMM 
Sbjct: 83  HMNAKSEGGWNMLSLMFTLVLVVITLSGSLWVMYHLNTNMMP 124


>gi|153007396|ref|YP_001368611.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum anthropi
           ATCC 49188]
 gi|151559284|gb|ABS12782.1| Cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum anthropi
           ATCC 49188]
          Length = 122

 Score =  129 bits (324), Expect = 1e-28,   Method: Composition-based stats.
 Identities = 48/112 (42%), Positives = 77/112 (68%), Gaps = 1/112 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   +  + +  S+G+ K  L+GF+L+++LT++PF + M G+F         ++  A+ Q
Sbjct: 1   MSSAHETHDHGASHGSLKTYLIGFVLAVVLTVVPFMLAMNGYFTP-GTTAAIVLGIAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+VHLV+FLH+  K E GW+I+A+IFT+I++AI   GS+WVM+HL+ NMM M
Sbjct: 60  ILVHLVYFLHLDPKSEGGWNILALIFTVIILAIVLAGSIWVMHHLDTNMMPM 111


>gi|315122073|ref|YP_004062562.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495475|gb|ADR52074.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 119

 Score =  129 bits (324), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 85/118 (72%), Positives = 101/118 (85%), Gaps = 2/118 (1%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGF-FLDKNIMCLTIVLCAIAQII 62
           D  HN   HS+GT+++ L+GFILSLILT IPFG+VM+G  FLDKN+  L IVLCAIAQII
Sbjct: 2   DYNHNKRTHSHGTRRESLIGFILSLILTSIPFGMVMQGSSFLDKNMTYLVIVLCAIAQII 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG-MRSIH 119
           VHLV+FLHM+ KVEDGW++MAM+FTII++AICFVGSMWVMYHLN NMM M+  MRSIH
Sbjct: 62  VHLVYFLHMNVKVEDGWNVMAMVFTIIIIAICFVGSMWVMYHLNYNMMPMDESMRSIH 119


>gi|116255239|ref|YP_771072.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259887|emb|CAK02981.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 133

 Score =  128 bits (323), Expect = 2e-28,   Method: Composition-based stats.
 Identities = 52/113 (46%), Positives = 75/113 (66%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT +  + GF+LS+ILT IPF +VM G F    +  + ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFRSYMTGFVLSVILTAIPFWLVMSGVFASPVLTAVLVMGLGAIQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH+VFFLHM+T+ E GW+IMA+IFT+I+VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMVFFLHMNTRSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|17988181|ref|NP_540815.1| cytochrome O ubiquinol oxidase operon protein CYOD [Brucella
           melitensis bv. 1 str. 16M]
 gi|17983942|gb|AAL53079.1| cytochrome o ubiquinol oxidase operon protein cyod [Brucella
           melitensis bv. 1 str. 16M]
          Length = 148

 Score =  128 bits (322), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 29  SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 87

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FL++  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 88  VHLIYFLYLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 137


>gi|319898316|ref|YP_004158409.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella clarridgeiae
           73]
 gi|319402280|emb|CBI75819.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella clarridgeiae
           73]
          Length = 209

 Score =  127 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 9/117 (7%)

Query: 1   MKYDN-IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCA 57
           M  D   HN       +    LVGFIL+++ T+  F  VM G      I    I  +  A
Sbjct: 2   MSTDKKTHNP------SIGSYLVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMA 55

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           + QIIV +VFFLH+++  +  W+I+ ++FT + V +   G+ W + HLN NMM   G
Sbjct: 56  LIQIIVQIVFFLHLNSGPDAKWNIVTLLFTAMCVFVIIGGTWWAISHLNYNMMGGSG 112


>gi|91975078|ref|YP_567737.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris BisB5]
 gi|91681534|gb|ABE37836.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris BisB5]
          Length = 130

 Score =  127 bits (321), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 54/115 (46%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 3   YDNIHNMN--MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           +D+ H  +   H++GT K  L+GF LS++LT IPF +VM     +K    L I+  A  Q
Sbjct: 13  HDHGHEAHVAAHNHGTLKSYLIGFGLSVVLTAIPFWLVMGDVLGNKQATGLVIMAFAAVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           I+VH+++FLHM+T  E+GW++MA+IFTI+MV I   GS+WVM+HL  NMM    M
Sbjct: 73  IVVHMIYFLHMTTAAEEGWTMMALIFTIVMVVIALAGSLWVMHHLTTNMMPAHDM 127


>gi|195970075|ref|YP_002122335.1| cytochrome o ubiquinol oxidase protein CyoD [Sinorhizobium meliloti
           1021]
 gi|307320582|ref|ZP_07599996.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           AK83]
 gi|186929524|emb|CAQ51297.1| Cytochrome o ubiquinol oxidase protein cyoD [Sinorhizobium meliloti
           1021]
 gi|306893732|gb|EFN24504.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           AK83]
          Length = 133

 Score =  127 bits (321), Expect = 4e-28,   Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 71/113 (62%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT K    GF+LS+ILT IPF +VM        +    I+     QI
Sbjct: 14  AHHGHSHGHDAGHGTLKSYATGFVLSVILTAIPFWLVMADILDSAVLTAAIIMALGAVQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH++FFLHM+T+ E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMIFFLHMNTRSEGGWTMMALIFTILLVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|190895344|ref|YP_001985636.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CIAT 652]
 gi|218514327|ref|ZP_03511167.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           8C-3]
 gi|190699289|gb|ACE93373.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CIAT 652]
 gi|327188656|gb|EGE55862.1| cytochrome O ubiquinol oxidase protein, subunit IV [Rhizobium etli
           CNPAF512]
          Length = 133

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 73/113 (64%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT +  + GF LS++LT IPF +VM G F    +  + ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFRSYMTGFALSIVLTAIPFWLVMSGVFESPAVTAVLVMAIGAIQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH+VFFLHM+ + E GW++MA+IFTII+VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMVFFLHMNPRSEGGWTMMALIFTIIIVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|226329082|ref|ZP_03804600.1| hypothetical protein PROPEN_02985 [Proteus penneri ATCC 35198]
 gi|225202268|gb|EEG84622.1| hypothetical protein PROPEN_02985 [Proteus penneri ATCC 35198]
          Length = 110

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 79/110 (71%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N  + +  S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ Q
Sbjct: 1   MSHPNT-SPSGASHGSMKSYLIGFILSVILTVIPFWMVMEGTATPATIL-WTVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  E+ W+++A +FT++++ I  VGS+W+MY+LN NMM
Sbjct: 59  IVVHLVCFLHMNTSSEERWNVVAFLFTLLIIGIVVVGSLWIMYNLNINMM 108


>gi|159184177|ref|NP_353175.2| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           tumefaciens str. C58]
 gi|159139510|gb|AAK85960.2| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           tumefaciens str. C58]
          Length = 130

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 47/101 (46%), Positives = 73/101 (72%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+GT K  ++GF+LS+ILT IPF +VM G   +K ++ + I+   + QI VH+++FLHM 
Sbjct: 22  SHGTFKSYMIGFVLSVILTAIPFWLVMGGVLENKTLLVIAIMGLGVIQIFVHMIYFLHMD 81

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           T+ E GW+ MA+IFT++++ I   GS+WVMY++N NMM + 
Sbjct: 82  TRSEGGWTFMALIFTVVVLLITLSGSLWVMYNMNKNMMPLH 122


>gi|307309510|ref|ZP_07589166.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           BL225C]
 gi|306900095|gb|EFN30715.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium meliloti
           BL225C]
          Length = 133

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 50/113 (44%), Positives = 72/113 (63%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT K  + GF+LS+ILT IPF +VM        +    I+     QI
Sbjct: 14  AHHGHSHGHDAGHGTLKSYMTGFVLSVILTAIPFWLVMADVLDSAVLTAAIIMALGALQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH++FFLHM+T+ E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMIFFLHMNTRSEGGWTMMALIFTILLVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|254420203|ref|ZP_05033927.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas sp. BAL3]
 gi|196186380|gb|EDX81356.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas sp. BAL3]
          Length = 131

 Score =  127 bits (320), Expect = 5e-28,   Method: Composition-based stats.
 Identities = 51/119 (42%), Positives = 79/119 (66%), Gaps = 3/119 (2%)

Query: 2   KYDNIH-NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
            ++  H     H++G+ +  ++GF+LS+ILT IPF +VM G    +    L ++  A+ Q
Sbjct: 12  SHEVDHLGHEAHNHGSFRSYMIGFVLSVILTAIPFALVMTGALPPQA-TALIVMAFAVVQ 70

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS-MEGMRSI 118
           I+VH+++FLHM++K E GW+++A+IFTII+V I   GS+WVMYHLN NMM     M  +
Sbjct: 71  IVVHMIYFLHMNSKSEGGWTMLALIFTIIVVVIALSGSLWVMYHLNTNMMPATHEMSQM 129


>gi|86360305|ref|YP_472193.1| cytochrome O ubiquinol oxidase, subunit IV protein [Rhizobium etli
           CFN 42]
 gi|86284407|gb|ABC93466.1| cytochrome O ubiquinol oxidase, subunit IV protein [Rhizobium etli
           CFN 42]
          Length = 133

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 73/113 (64%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT +  + GF LS++LT IPF +VM G F    +  + ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFRSYMAGFALSVVLTAIPFWLVMAGVFASPAVTAVLVMAIGAVQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH+VFFLHM+ + E GW++MA+IFT+I+VAI   GS+WVM+HLN NMM M  
Sbjct: 74  VVHMVFFLHMNPRSEGGWTMMALIFTLIIVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|300715583|ref|YP_003740386.1| cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Erwinia billingiae Eb661]
 gi|299061419|emb|CAX58531.1| Cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Erwinia billingiae Eb661]
          Length = 109

 Score =  127 bits (319), Expect = 6e-28,   Method: Composition-based stats.
 Identities = 47/108 (43%), Positives = 78/108 (72%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +  N +  S+G+ K  ++GFILS+ILT IPF +VM G    K  +   +++CAI Q++V
Sbjct: 2   SHSTNEHGASHGSVKSYMIGFILSIILTAIPFWMVMDGGA-SKATILGVVIVCAIVQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH++T  E+ W+++A++F+ I++ I  VGS+W+M++LN NMM+
Sbjct: 61  HLVYFLHLNTSSEERWNLVAIVFSAIIILIVVVGSLWIMWNLNYNMMA 108


>gi|170748152|ref|YP_001754412.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
 gi|170654674|gb|ACB23729.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
          Length = 134

 Score =  126 bits (318), Expect = 7e-28,   Method: Composition-based stats.
 Identities = 51/109 (46%), Positives = 74/109 (67%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H  +   +GT +  + GF+LS+ILT+IPF +VM     +  +  L I+     Q++VH
Sbjct: 17  DAHAHSEGGHGTFQSYMTGFVLSVILTVIPFWLVMGNVLDNSLVTTLVILALGGVQMVVH 76

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +++FLHMSTK E GW+ MA+IFTI +V I   GS+WVMYHLN+NMM M+
Sbjct: 77  VIYFLHMSTKSEGGWTFMALIFTITLVVIMLAGSVWVMYHLNHNMMPMD 125


>gi|239830890|ref|ZP_04679219.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum intermedium
           LMG 3301]
 gi|239823157|gb|EEQ94725.1| cytochrome o ubiquinol oxidase subunit IV [Ochrobactrum intermedium
           LMG 3301]
          Length = 122

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 75/112 (66%), Gaps = 1/112 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M        +  ++G+ K  L+GF+L+++LT++PF + M G+F         ++  A+ Q
Sbjct: 1   MMSSAHETHDHAAHGSLKSYLIGFVLAVVLTVVPFMLAMNGYFTP-ATTAAIVLGLAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+VHLV+FLH+  K E GW+I+A+IFT+I++AI   GS+WVM+HL+ NMM M
Sbjct: 60  ILVHLVYFLHLDPKSEGGWNILALIFTVIILAIVLAGSIWVMHHLDTNMMPM 111


>gi|209546368|ref|YP_002278258.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM2304]
 gi|209539225|gb|ACI59158.1| cytochrome o ubiquinol oxidase subunit IV [Rhizobium leguminosarum
           bv. trifolii WSM2304]
          Length = 133

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 51/113 (45%), Positives = 74/113 (65%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT +  + GF LS++LT IPF +VM G F    +  L ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFRSYMTGFALSVVLTAIPFWLVMAGVFASPLVTALLVMGIGAIQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH+VFFLHM+ + E GW++MA+IFTII+VAI   GS+WVM+HLN+NMM M  
Sbjct: 74  VVHMVFFLHMNPRSEGGWTMMALIFTIIIVAIALSGSLWVMHHLNSNMMPMSP 126


>gi|284006411|emb|CBA71647.1| cytochrome O ubiquinol oxidase protein [Arsenophonus nasoniae]
          Length = 132

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M Y N    +  S+G+ K  L+GFILS+ILT++PF +VM        I+   ++  AIAQ
Sbjct: 23  MSYTNT-PHSGASHGSMKTYLIGFILSIILTVVPFWMVMNSTASHDTIL-WIVIGTAIAQ 80

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  +D W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 81  ILVHLVCFLHMNTSSDDRWNLVAFLFTMLIIGIVVIGSLWIMYNLNINMM 130


>gi|227820112|ref|YP_002824083.1| cytochrome O ubiquinol oxidase subunit IV [Sinorhizobium fredii
           NGR234]
 gi|227339111|gb|ACP23330.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium fredii
           NGR234]
          Length = 133

 Score =  126 bits (317), Expect = 1e-27,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (62%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT K  L GF+LS+ILT IPF +VM        +  + I+     QI
Sbjct: 14  AHHGHSHGHEAGHGTLKSYLTGFVLSVILTAIPFWLVMAEVLDSPVLTAVIIMALGAIQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VH++FFLHM+T+ E GW++MA+IFTI++V I   GS+WVM+HL  NMM M  
Sbjct: 74  VVHMIFFLHMNTRSEGGWTMMALIFTIVLVVIALSGSLWVMHHLEENMMPMSP 126


>gi|262375302|ref|ZP_06068535.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter lwoffii
           SH145]
 gi|262309556|gb|EEY90686.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter lwoffii
           SH145]
          Length = 123

 Score =  126 bits (316), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  VGFILS+ILT+IPFG+VM G F  + I+   I + A+AQ
Sbjct: 16  MSHD--HNAAGESHGNVKQYTVGFILSVILTVIPFGMVMAGGF-GRGILITVIAITAVAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+V L++FLHM++  E  W+++A ++TI+ +AI  VGS+W+M +L+ NMM
Sbjct: 73  ILVQLIYFLHMNSSSEQRWNVIAFVYTILTIAILLVGSVWIMNYLHYNMM 122


>gi|300311776|ref|YP_003775868.1| ubiquinol oxidase subunit IV protein [Herbaspirillum seropedicae
           SmR1]
 gi|300074561|gb|ADJ63960.1| ubiquinol oxidase subunit IV protein [Herbaspirillum seropedicae
           SmR1]
          Length = 158

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 47/97 (48%), Positives = 66/97 (68%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L++ILT IPF +VM         M + ++  A  QI+VH+ +FLHM+ K 
Sbjct: 33  TMKDYVTGFVLAVILTAIPFWLVMNKSISSSATMGIVLLALAAVQIVVHIKYFLHMNGKS 92

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           E GW+++AMIFTI++V I   GS+WVMYHLN+NMM  
Sbjct: 93  EGGWNMLAMIFTIVIVVITLAGSLWVMYHLNHNMMPT 129


>gi|189010631|ref|ZP_03006400.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4076]
 gi|189403117|ref|ZP_03006965.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4486]
 gi|189404836|ref|ZP_03007598.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC869]
 gi|193068714|ref|ZP_03049675.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E110019]
 gi|194428823|ref|ZP_03061358.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B171]
 gi|194432628|ref|ZP_03064914.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella dysenteriae
           1012]
 gi|194438861|ref|ZP_03070946.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 101-1]
 gi|208807081|ref|ZP_03249418.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4206]
 gi|208822824|ref|ZP_03263142.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4042]
 gi|217326573|ref|ZP_03442657.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. TW14588]
 gi|188999375|gb|EDU68361.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4076]
 gi|189362449|gb|EDU80868.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4486]
 gi|189373698|gb|EDU92114.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC869]
 gi|192958077|gb|EDV88519.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E110019]
 gi|194413126|gb|EDX29413.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B171]
 gi|194419189|gb|EDX35272.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella dysenteriae
           1012]
 gi|194422155|gb|EDX38157.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 101-1]
 gi|208726882|gb|EDZ76483.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4206]
 gi|208737017|gb|EDZ84701.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4042]
 gi|217322794|gb|EEC31218.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. TW14588]
          Length = 124

 Score =  125 bits (315), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 16  MSHSTDHS--GASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 73  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 122


>gi|62289032|ref|YP_220825.1| ubiquinol oxidase subunit IV [Brucella abortus bv. 1 str. 9-941]
 gi|82698969|ref|YP_413543.1| cytochrome C oxidase subunit IV [Brucella melitensis biovar Abortus
           2308]
 gi|148560321|ref|YP_001258092.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ovis ATCC
           25840]
 gi|161618035|ref|YP_001591922.1| cytochrome o ubiquinol oxidase subunit IV [Brucella canis ATCC
           23365]
 gi|163842321|ref|YP_001626725.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis ATCC
           23445]
 gi|189023307|ref|YP_001934075.1| cytochrome C oxidase subunit IV [Brucella abortus S19]
 gi|254694846|ref|ZP_05156674.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|254696475|ref|ZP_05158303.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|254705226|ref|ZP_05167054.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 3
           str. 686]
 gi|254707255|ref|ZP_05169083.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|254709204|ref|ZP_05171015.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|254713371|ref|ZP_05175182.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M644/93/1]
 gi|254716271|ref|ZP_05178082.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M13/05/1]
 gi|254718265|ref|ZP_05180076.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. 83/13]
 gi|254731387|ref|ZP_05189965.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|256030728|ref|ZP_05444342.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|256158735|ref|ZP_05456610.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti
           M490/95/1]
 gi|256254132|ref|ZP_05459668.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella ceti B1/94]
 gi|256258611|ref|ZP_05464147.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|256368511|ref|YP_003106017.1| cytochrome o ubiquinol oxidase subunit IV [Brucella microti CCM
           4915]
 gi|260169631|ref|ZP_05756442.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. F5/99]
 gi|260546326|ref|ZP_05822066.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus NCTC
           8038]
 gi|260567307|ref|ZP_05837777.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 4
           str. 40]
 gi|260759125|ref|ZP_05871473.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|260760850|ref|ZP_05873193.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260884925|ref|ZP_05896539.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|261215176|ref|ZP_05929457.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|261218048|ref|ZP_05932329.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M13/05/1]
 gi|261221275|ref|ZP_05935556.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti B1/94]
 gi|261314737|ref|ZP_05953934.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|261316705|ref|ZP_05955902.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|261321102|ref|ZP_05960299.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M644/93/1]
 gi|261755935|ref|ZP_05999644.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 3 str.
           686]
 gi|261759161|ref|ZP_06002870.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. F5/99]
 gi|265983226|ref|ZP_06095961.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. 83/13]
 gi|265987775|ref|ZP_06100332.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|265997236|ref|ZP_06109793.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M490/95/1]
 gi|297247450|ref|ZP_06931168.1| cytochrome o ubiquinol oxidase operon protein cyoD [Brucella
           abortus bv. 5 str. B3196]
 gi|306840008|ref|ZP_07472802.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. NF 2653]
 gi|306842662|ref|ZP_07475307.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO2]
 gi|306843645|ref|ZP_07476246.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO1]
 gi|62195164|gb|AAX73464.1| QoxD, ubiquinol oxidase subunit IV [Brucella abortus bv. 1 str.
           9-941]
 gi|82615070|emb|CAJ09998.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           biovar Abortus 2308]
 gi|148371578|gb|ABQ61557.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ovis ATCC
           25840]
 gi|161334846|gb|ABX61151.1| cytochrome o ubiquinol oxidase subunit IV [Brucella canis ATCC
           23365]
 gi|163673044|gb|ABY37155.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis ATCC
           23445]
 gi|189018879|gb|ACD71601.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus S19]
 gi|255998669|gb|ACU47068.1| cytochrome o ubiquinol oxidase subunit IV [Brucella microti CCM
           4915]
 gi|260096433|gb|EEW80309.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus NCTC
           8038]
 gi|260156825|gb|EEW91905.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 4
           str. 40]
 gi|260669443|gb|EEX56383.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 4
           str. 292]
 gi|260671282|gb|EEX58103.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 2
           str. 86/8/59]
 gi|260874453|gb|EEX81522.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 9
           str. C68]
 gi|260916783|gb|EEX83644.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 3
           str. Tulya]
 gi|260919859|gb|EEX86512.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti B1/94]
 gi|260923137|gb|EEX89705.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M13/05/1]
 gi|261293792|gb|EEX97288.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M644/93/1]
 gi|261295928|gb|EEX99424.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           B2/94]
 gi|261303763|gb|EEY07260.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M163/99/10]
 gi|261739145|gb|EEY27141.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella sp. F5/99]
 gi|261745688|gb|EEY33614.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 3 str.
           686]
 gi|262551704|gb|EEZ07694.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti M490/95/1]
 gi|264659972|gb|EEZ30233.1| cytochrome o ubiquinol oxidase subunit IV [Brucella pinnipedialis
           M292/94/1]
 gi|264661818|gb|EEZ32079.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. 83/13]
 gi|297174619|gb|EFH33966.1| cytochrome o ubiquinol oxidase operon protein cyoD [Brucella
           abortus bv. 5 str. B3196]
 gi|306276336|gb|EFM58036.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO1]
 gi|306287197|gb|EFM58694.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. BO2]
 gi|306404972|gb|EFM61257.1| cytochrome o ubiquinol oxidase subunit IV [Brucella sp. NF 2653]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|254690357|ref|ZP_05153611.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
 gi|260755901|ref|ZP_05868249.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
 gi|260676009|gb|EEX62830.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus bv. 6
           str. 870]
          Length = 121

 Score =  125 bits (314), Expect = 2e-27,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSVKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|86747365|ref|YP_483861.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris HaA2]
 gi|86570393|gb|ABD04950.1| cytochrome C oxidase subunit IV [Rhodopseudomonas palustris HaA2]
          Length = 130

 Score =  125 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 77/115 (66%), Gaps = 2/115 (1%)

Query: 3   YDNIHNMNMHS--YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           +D+ H  ++ +  +GT K  L+GF LS++LT IPF +VM     +K    L I+  A  Q
Sbjct: 13  HDHGHEAHVAAQTHGTLKSYLIGFGLSVVLTAIPFWLVMGDVLGNKQATGLVIMAFAAVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           I+VH+++FLHM+T  E+GW++MA+IFTI+MV I   GS+WVM+HL  NMM    M
Sbjct: 73  IVVHMIYFLHMTTAAEEGWTMMALIFTIVMVVIALAGSLWVMHHLTTNMMPAHDM 127


>gi|191173515|ref|ZP_03035042.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli F11]
 gi|190906224|gb|EDV65836.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli F11]
          Length = 124

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N    +  S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 16  MSHSNA--SSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 73  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 122


>gi|262372200|ref|ZP_06065479.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter junii
           SH205]
 gi|262312225|gb|EEY93310.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter junii
           SH205]
          Length = 124

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 52/106 (49%), Positives = 76/106 (71%), Gaps = 1/106 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + HN    S+G  KQ  VGFILS++LTIIPFG+VM G F  + I+   I + A+AQ++V 
Sbjct: 19  HDHNAAGASHGNFKQYTVGFILSVVLTIIPFGMVMAGGF-SRGILMTVIAITAVAQVLVQ 77

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LV+FLHM+T  E  W+++A I+TI+ +A+  VGS+W+M +L+ NMM
Sbjct: 78  LVYFLHMNTSSEQRWNLIAFIYTILCIAVLLVGSVWIMNYLHYNMM 123


>gi|225626592|ref|ZP_03784631.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti str. Cudo]
 gi|237814519|ref|ZP_04593517.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus str.
           2308 A]
 gi|225618249|gb|EEH15292.1| cytochrome o ubiquinol oxidase subunit IV [Brucella ceti str. Cudo]
 gi|237789356|gb|EEP63566.1| cytochrome o ubiquinol oxidase subunit IV [Brucella abortus str.
           2308 A]
          Length = 122

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 75/112 (66%), Gaps = 1/112 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M        +  ++G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  Q
Sbjct: 1   MMSSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 60  ILVHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 111


>gi|197284017|ref|YP_002149889.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis HI4320]
 gi|227358113|ref|ZP_03842454.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis ATCC
           29906]
 gi|194681504|emb|CAR40376.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis HI4320]
 gi|227161449|gb|EEI46486.1| cytochrome O ubiquinol oxidase protein [Proteus mirabilis ATCC
           29906]
          Length = 110

 Score =  124 bits (313), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 79/110 (71%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N  + +  S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ Q
Sbjct: 1   MSHPNT-SPSGASHGSMKSYLIGFILSVILTVIPFWMVMEGTATTSTIL-WTVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  E+ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 59  IVVHLVCFLHMNTSSEERWNVIAFLFTLLIIGIVVIGSLWIMYNLNINMM 108


>gi|256060188|ref|ZP_05450368.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella neotomae
           5K33]
 gi|261324165|ref|ZP_05963362.1| cytochrome o ubiquinol oxidase subunit IV [Brucella neotomae 5K33]
 gi|261300145|gb|EEY03642.1| cytochrome o ubiquinol oxidase subunit IV [Brucella neotomae 5K33]
          Length = 121

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|194292955|ref|YP_002008862.1| transmembrane cytochrome o ubiquinol oxidase subunit iv
           [Cupriavidus taiwanensis LMG 19424]
 gi|193226859|emb|CAQ72810.1| TRANSMEMBRANE CYTOCHROME O UBIQUINOL OXIDASE (SUBUNIT IV)
           OXIDOREDUCTASE PROTEIN [Cupriavidus taiwanensis LMG
           19424]
          Length = 135

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D+ H      + +    + GF+LS+ILT IPF +VM   F   +   + ++     QI+
Sbjct: 19  HDHGHG-ESEIHISLGGYVTGFVLSVILTAIPFWLVMGRVFEQSSTTAMVLLALGAVQIV 77

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VH+++FLH++ + E GW+++A+IFT+++V I   G++WVM+HLN+NMM  
Sbjct: 78  VHMIYFLHLNARSEGGWNMLALIFTLVLVVITLTGTLWVMFHLNSNMMPG 127


>gi|169633240|ref|YP_001706976.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           SDF]
 gi|169795506|ref|YP_001713299.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AYE]
 gi|260549406|ref|ZP_05823625.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp.
           RUH2624]
 gi|260554568|ref|ZP_05826789.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 19606]
 gi|169148433|emb|CAM86299.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AYE]
 gi|169152032|emb|CAP00912.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii]
 gi|260407515|gb|EEX00989.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp.
           RUH2624]
 gi|260411110|gb|EEX04407.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 19606]
          Length = 124

 Score =  124 bits (312), Expect = 4e-27,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + ++   I + A+AQ++V
Sbjct: 18  SHEHNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGLLVTVIAITAVAQVLV 76

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            LV+FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 77  QLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 123


>gi|120610894|ref|YP_970572.1| cytochrome C oxidase subunit IV [Acidovorax citrulli AAC00-1]
 gi|120589358|gb|ABM32798.1| cytochrome bo3 quinol oxidase subunit 4 [Acidovorax citrulli
           AAC00-1]
          Length = 142

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 48/105 (45%), Positives = 70/105 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    +VGF+LS+ILT IPF +VM     D+N   L +   A+ QI+VH+V FLHM+
Sbjct: 25  PHSTFSGYMVGFVLSVILTAIPFWLVMAKVISDRNTAVLVLGAFAVVQILVHMVCFLHMN 84

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            KVE GW++++ IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 85  GKVEGGWTMLSTIFTVVFVAIAIAGTLWVMFHMNTNMMPEHTMPA 129


>gi|37527738|ref|NP_931083.1| cytochrome o ubiquinol oxidase subunit IV [Photorhabdus luminescens
           subsp. laumondii TTO1]
 gi|36787174|emb|CAE16250.1| cytochrome O ubiquinol oxidase protein cyoD (ubiquinol oxidase
           chain D) [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 110

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +       S+G+ K  L+GF+LS+ILT+IPF +VM G      I+  T+V  A+ Q
Sbjct: 1   MSHSDT-AHTGASHGSLKSYLIGFVLSVILTVIPFWMVMDGSASHTTILT-TVVALAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           IIVH ++FLHM+T  E+ W+++A++FTI+++ I  VGS+W+MY+LN NMM
Sbjct: 59  IIVHFIYFLHMNTSSEERWNLVALLFTILIIGIVVVGSLWIMYNLNINMM 108


>gi|262369760|ref|ZP_06063088.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter johnsonii
           SH046]
 gi|262315828|gb|EEY96867.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter johnsonii
           SH046]
          Length = 123

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  +GFILS+ILT+IPFG+VM G F  + I+   I + A+AQ
Sbjct: 16  MSHD--HNSAGASHGNTKQYTIGFILSVILTVIPFGMVMAGGF-GRGIVMAVIAITAVAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LV+FLHM++  E  W+++A I+T++ +A+  VGS+W+M +L+ NMM
Sbjct: 73  VLVQLVYFLHMNSSSEQRWNVIAFIYTVLCIAVLLVGSVWIMNYLHYNMM 122


>gi|262279560|ref|ZP_06057345.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus RUH2202]
 gi|262259911|gb|EEY78644.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus RUH2202]
          Length = 124

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 52/107 (48%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V
Sbjct: 18  SHDHNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAITAVAQVLV 76

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            LV+FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 77  QLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 123


>gi|261346373|ref|ZP_05974017.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rustigianii
           DSM 4541]
 gi|282565690|gb|EFB71225.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rustigianii
           DSM 4541]
          Length = 110

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M ++        S+G+ K  L+GFILS+ILT+IPF +VM G    + ++  T+V  A+ Q
Sbjct: 1   MSHERD-AHTGASHGSVKTYLIGFILSVILTVIPFWMVMNGTA-SQGVILATVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  ++ W+++A +FT+++V I  +GS+W+MY+LN NMM
Sbjct: 59  ILVHLVCFLHMNTSSDERWNLVAFLFTMLIVGIVVIGSLWIMYNLNINMM 108


>gi|253990904|ref|YP_003042260.1| cytochrome o ubiquinol oxidase subunit IV [Photorhabdus asymbiotica
           subsp. asymbiotica ATCC 43949]
 gi|253782354|emb|CAQ85518.1| cyoD; Cytochrome O ubiquinol oxidase protein cyoD (Ubiquinol
           oxidase chain D) [Photorhabdus asymbiotica]
          Length = 110

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N       S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V  A+ Q
Sbjct: 1   MSHSNT-AHTGASHGSLKSYVIGFVLSVILTVIPFWMVMDGSASHTTILT-TVVALAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VH ++FLHM+T  E+ W+++A++FTI+++ I  VGS+W+MY+LN NMM
Sbjct: 59  ILVHFIYFLHMNTSSEERWNLVALLFTILIIGIVVVGSLWIMYNLNINMM 108


>gi|94314530|ref|YP_587739.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|93358382|gb|ABF12470.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|222831883|gb|EEE70360.1| predicted protein [Populus trichocarpa]
          Length = 142

 Score =  124 bits (311), Expect = 5e-27,   Method: Composition-based stats.
 Identities = 42/99 (42%), Positives = 66/99 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    L GF+LS+ LT +PF +VM   F   +   + I+L    QI+VH+++FLHM+
Sbjct: 23  PHATLGGYLTGFVLSVFLTAVPFWLVMGKVFEKSSTTAIAILLIGAVQIVVHMIYFLHMN 82

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            K E GW++++++FT+ +V I   GS+WVM+HLN+NMM 
Sbjct: 83  AKSEGGWNMLSLMFTLTLVVITLTGSLWVMFHLNSNMMP 121


>gi|317492923|ref|ZP_07951347.1| cytochrome o ubiquinol oxidase subunit IV protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316919045|gb|EFV40380.1| cytochrome o ubiquinol oxidase subunit IV protein
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 116

 Score =  124 bits (311), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 51/106 (48%), Positives = 79/106 (74%), Gaps = 1/106 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           +  + N  S+G+ K  ++GFILS+ILT+IPF +VM+G    + I+ +T+V  A+ QI VH
Sbjct: 10  HSTDNNGASHGSAKSYMIGFILSVILTVIPFWMVMEGTASHQTIL-ITVVAMAVIQIFVH 68

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LV+FLHM+T  E+ W+++A+ FT +++AI  VGS+W+MY+LN NMM
Sbjct: 69  LVYFLHMNTSSEERWNLIALAFTALIIAIVVVGSLWIMYNLNINMM 114


>gi|326317721|ref|YP_004235393.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323374557|gb|ADX46826.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 144

 Score =  123 bits (310), Expect = 6e-27,   Method: Composition-based stats.
 Identities = 47/105 (44%), Positives = 70/105 (66%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    +VGF+LS+ILT IPF +VM     D++   L +   A+ QI+VH+V FLHM+
Sbjct: 27  PHSTFSGYMVGFVLSIILTAIPFWLVMAKVISDRSTAVLVLGAFAVVQILVHMVCFLHMN 86

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            KVE GW++++ IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 87  GKVEGGWTMLSTIFTVVFVAIAIAGTLWVMFHMNTNMMPEHNMPA 131


>gi|319407993|emb|CBI81647.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella
           schoenbuchensis R1]
          Length = 190

 Score =  123 bits (310), Expect = 7e-27,   Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIAQ 60
           +D  HN       +    LVGFIL++  T+  F  VM G      +    I  +  A+ Q
Sbjct: 2   HDKAHNP------STISYLVGFILAVFFTLGSFIPVMYGMLDSWAVSTKVIYLIGMALIQ 55

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           I+V +VFFLH+++  +  W+ + + F  + V I   G+ W + HLN NMM   G
Sbjct: 56  IVVQIVFFLHLNSGPDAKWNWITLWFAAMCVFIIIGGTWWAISHLNYNMMGGSG 109


>gi|296444724|ref|ZP_06886687.1| cytochrome o ubiquinol oxidase subunit IV [Methylosinus
           trichosporium OB3b]
 gi|296257672|gb|EFH04736.1| cytochrome o ubiquinol oxidase subunit IV [Methylosinus
           trichosporium OB3b]
          Length = 378

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 38/113 (33%), Positives = 64/113 (56%), Gaps = 4/113 (3%)

Query: 9   MNMHSYG---TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           M+   +G         +GF+L+++LT   F +V   F     I+   +V  AIAQI VHL
Sbjct: 17  MDAPGHGLREGLLTYSIGFVLAVLLTAASFYLVRTTFIWGPGIIMA-LVALAIAQIGVHL 75

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           VFFLH++T  ++  + +A+ F +++V +   GS+W+M HL +N+M    M  +
Sbjct: 76  VFFLHLTTAPDNTNNALALAFGVLIVTLVVGGSLWIMSHLAHNVMPDRMMARM 128


>gi|290510102|ref|ZP_06549472.1| cytochrome o ubiquinol oxidase operon protein cyoD [Klebsiella sp.
           1_1_55]
 gi|289776818|gb|EFD84816.1| cytochrome o ubiquinol oxidase operon protein cyoD [Klebsiella sp.
           1_1_55]
          Length = 136

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+     +G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ Q
Sbjct: 28  MSHSTDHS--GAPHGSVKSYMTGFILSIILTVIPFAMVMSGSA-SHAVILGTILVTAVVQ 84

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLHM++K ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 85  IVVHLVYFLHMNSKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNYNMM 134


>gi|319403608|emb|CBI77193.1| Cytochrome o ubiquinol oxidase protein cyoD (modular protein)
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 167

 Score =  123 bits (309), Expect = 8e-27,   Method: Composition-based stats.
 Identities = 41/114 (35%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIAQ 60
           YD  H        +    LVGFIL+++ T+  F  VM G      I    I  +  A+ Q
Sbjct: 4   YDKNHEP------SIGSYLVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           IIV +VFFLH+++  +  W++ A++FT + V I   G+ W + HLN NMM   G
Sbjct: 58  IIVQIVFFLHLNSGPDARWNLTALLFTAMCVFIIIGGTWWAISHLNYNMMGGSG 111


>gi|319783410|ref|YP_004142886.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317169298|gb|ADV12836.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 126

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 76/115 (66%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           ++ H  +  ++G+    L GF LS++LT +PF +VM     ++    + I+  A+ QIIV
Sbjct: 11  NHSHAHHGVNHGSLAGYLTGFGLSVVLTAVPFWLVMTNALGNQMASAIAIMAFAVVQIIV 70

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           H+VFFLHM+T+ E GW++MA+IFT+I+V I   GS+WVMYHLN NMM    M  I
Sbjct: 71  HMVFFLHMNTRSESGWTMMALIFTLILVMIALTGSLWVMYHLNVNMMPGHDMSQI 125


>gi|237808828|ref|YP_002893268.1| cytochrome o ubiquinol oxidase subunit IV [Tolumonas auensis DSM
           9187]
 gi|237501089|gb|ACQ93682.1| cytochrome o ubiquinol oxidase subunit IV [Tolumonas auensis DSM
           9187]
          Length = 109

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 50/111 (45%), Positives = 77/111 (69%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M ++  H     S+G+ K  + GFILS++LT+IPF IVM+       ++   I   A+AQ
Sbjct: 1   MSHNTSHG--GASHGSVKSYITGFILSVVLTVIPFWIVMESALPPSTVIL-VIAAFAVAQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+V L++FLHM TK E GW+++A +FT++++AI  VGS+W+M+HLN+NMM 
Sbjct: 58  ILVQLIYFLHMDTKSEGGWNMIAFVFTVLIIAIIVVGSLWIMFHLNHNMMG 108


>gi|255319502|ref|ZP_05360716.1| cytOchrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SK82]
 gi|262378474|ref|ZP_06071631.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SH164]
 gi|255303442|gb|EET82645.1| cytOchrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SK82]
 gi|262299759|gb|EEY87671.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           radioresistens SH164]
          Length = 123

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    ++G  KQ  +GFILS+ILTIIPFG+VM G F ++ ++   I + A AQ
Sbjct: 16  MSHD--HNSAGAAHGNFKQYTIGFILSVILTIIPFGMVMSGGF-ERGLLVTVIAITAAAQ 72

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LVFFLHM+   E  W+++A I+T++ +AI  VGS+W+M +L+ NMM
Sbjct: 73  VLVQLVFFLHMNASSEQRWNVIAFIYTVLCIAILLVGSVWIMNYLHFNMM 122


>gi|23500960|ref|NP_697087.1| ubiquinol oxidase subunit IV [Brucella suis 1330]
 gi|23346817|gb|AAN29002.1| ubiquinol oxidase subunit IV [Brucella suis 1330]
          Length = 121

 Score =  123 bits (309), Expect = 9e-27,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|225851588|ref|YP_002731821.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis ATCC
           23457]
 gi|256045835|ref|ZP_05448711.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|256112552|ref|ZP_05453473.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|256264901|ref|ZP_05467433.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260563126|ref|ZP_05833612.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 1 str. 16M]
 gi|265992249|ref|ZP_06104806.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|265993992|ref|ZP_06106549.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|225639953|gb|ACN99866.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis ATCC
           23457]
 gi|260153142|gb|EEW88234.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 1 str. 16M]
 gi|262764973|gb|EEZ10894.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           3 str. Ether]
 gi|263003315|gb|EEZ15608.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis bv.
           1 str. Rev.1]
 gi|263095386|gb|EEZ18987.1| prokaryotic Cytochrome C oxidase subunit IV [Brucella melitensis
           bv. 2 str. 63/9]
 gi|326408057|gb|ADZ65122.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis M28]
 gi|326537773|gb|ADZ85988.1| cytochrome o ubiquinol oxidase subunit IV [Brucella melitensis
           M5-90]
          Length = 121

 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/110 (40%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FL++  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLYLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMPM 110


>gi|188584037|ref|YP_001927482.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium populi
           BJ001]
 gi|179347535|gb|ACB82947.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium populi
           BJ001]
          Length = 131

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/104 (47%), Positives = 70/104 (67%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  + GF+LS+ILT IPF +VM     DK +  + I+  A+ QI+VH+++FLHM+TK 
Sbjct: 26  SFKDYVTGFVLSVILTAIPFWLVMDNVIEDKIVTGVVILALAVVQIVVHMIYFLHMNTKS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           E GW+ +A+IFTI +V I   GS+WVM+HLN NMM +      H
Sbjct: 86  EGGWTFLALIFTITLVVITLCGSIWVMHHLNTNMMPISAEEMRH 129


>gi|307129919|ref|YP_003881935.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii 3937]
 gi|306527448|gb|ADM97378.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii 3937]
          Length = 110

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 83/110 (75%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+    S+G+ K  L+GF+LS+ILT+IPFG+VM G     +++ LT++ CA+ Q
Sbjct: 1   MSH-STHDHAGASHGSVKSYLIGFVLSIILTVIPFGLVMNGSA-SHSVILLTVLGCAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNVVAIVFTALIIAIVVVGSLWIMMNAHHNMM 108


>gi|304395491|ref|ZP_07377374.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. aB]
 gi|308185899|ref|YP_003930030.1| Cytochrome o ubiquinol oxidase protein cyoD [Pantoea vagans C9-1]
 gi|304356785|gb|EFM21149.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. aB]
 gi|308056409|gb|ADO08581.1| Cytochrome o ubiquinol oxidase protein cyoD [Pantoea vagans C9-1]
          Length = 109

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 48/108 (44%), Positives = 77/108 (71%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +  N +  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V CA+ Q++V
Sbjct: 2   SHSVNEHGASHGSVKSYMIGFILSIILTAIPFWMVMDGSASHGTILGVVLV-CAVIQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH+ +K E GW+++A++F+ I++ I  VGS+W+M++LN NMM 
Sbjct: 61  HLVYFLHLDSKSEGGWNMVAIVFSAIIILIVVVGSLWIMWNLNYNMMP 108


>gi|113867094|ref|YP_725583.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113525870|emb|CAJ92215.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 122

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 72/112 (64%), Gaps = 2/112 (1%)

Query: 2   KYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
            +D+  +   H  + + K   +GFIL++ILT+IPF +VM G  +DK  +   I+  A  Q
Sbjct: 12  AHDSHDSHAGHDTHASFKSYAIGFILAVILTVIPFKLVMDGS-MDKGTILWIILGMAAVQ 70

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           I+VHL +FLH+ T  E   +++A++FT +++ I   GS+W+M++LN NMM M
Sbjct: 71  ILVHLKYFLHLDTSSEQRSNVIALLFTALILVIVVAGSLWIMHNLNANMMVM 122


>gi|241663143|ref|YP_002981503.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|309781939|ref|ZP_07676670.1| ubiquinol oxidase subunit IV [Ralstonia sp. 5_7_47FAA]
 gi|240865170|gb|ACS62831.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|308919283|gb|EFP64949.1| ubiquinol oxidase subunit IV [Ralstonia sp. 5_7_47FAA]
          Length = 141

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/99 (46%), Positives = 67/99 (67%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    L GF+LS+ LT IPF +VM   F   +   +TI+L    QI+VH++FFLHM+
Sbjct: 26  PHATLGGYLTGFVLSVFLTAIPFWLVMANVFDRSSTTAVTILLIGAVQIVVHMIFFLHMN 85

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
            K E GW++++++FT+++V I   GS+WVMYHLN NMM 
Sbjct: 86  AKSEGGWNMLSLMFTLVLVVITLSGSLWVMYHLNTNMMP 124


>gi|163867422|ref|YP_001608619.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella tribocorum
           CIP 105476]
 gi|161017066|emb|CAK00624.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella tribocorum
           CIP 105476]
          Length = 242

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 58/110 (52%), Gaps = 3/110 (2%)

Query: 8   NMNMHSYG-TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIAQIIVH 64
           +M   ++  +    L+GFIL++  T+  F  VM G      I    +  +  A+ QIIV 
Sbjct: 2   SMQNETHSPSIGSYLIGFILAVFFTLGSFIPVMYGMMESWAISTKVVYLIGMALIQIIVQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VFFLH+++  +  W++ A+ F  I V I   G+ W + HLN NMM   G
Sbjct: 62  IVFFLHLNSGPDAKWNLSALWFAAICVFIIVGGTWWAISHLNYNMMGGSG 111


>gi|319795348|ref|YP_004156988.1| cytochrome o ubiquinol oxidase subunit iv [Variovorax paradoxus
           EPS]
 gi|315597811|gb|ADU38877.1| cytochrome o ubiquinol oxidase subunit IV [Variovorax paradoxus
           EPS]
          Length = 136

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/101 (49%), Positives = 70/101 (69%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+ T K  + GF+L++ILT IPF +VM   F + N   L I+  A  QI+VH+++FLHM 
Sbjct: 28  SHSTFKGYMTGFVLAVILTAIPFWLVMGKVFANTNTTSLIILGFAAVQIVVHMIYFLHMD 87

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
            K E GW+++A+IFTI++V I   GS+WVMYH+N NMM M 
Sbjct: 88  AKSESGWNMLALIFTIVLVVITLAGSLWVMYHMNTNMMPMS 128


>gi|114767474|ref|ZP_01446257.1| cytochrome o ubiquinol oxidase subunit IV [Pelagibaca bermudensis
           HTCC2601]
 gi|114540454|gb|EAU43536.1| cytochrome o ubiquinol oxidase subunit IV [Roseovarius sp.
           HTCC2601]
          Length = 127

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 45/113 (39%), Positives = 69/113 (61%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           +    + H +GT  Q ++GF L+ ILTIIPF +VM    + ++ +   I+     QI+VH
Sbjct: 2   SADTHHAHDHGTMGQLMIGFALAAILTIIPFYLVMAEVDMARSTLVGIIMGLGAVQIVVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           LV+FLH+    E+GW+  A IF +I++ I   GS+WVM+++N NMM M  M  
Sbjct: 62  LVYFLHLKRSSEEGWNFFATIFAVIILVIVLAGSLWVMHNMNENMMPMHEMDQ 114


>gi|268592045|ref|ZP_06126266.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rettgeri
           DSM 1131]
 gi|291312438|gb|EFE52891.1| cytochrome o ubiquinol oxidase, subunit IV [Providencia rettgeri
           DSM 1131]
          Length = 110

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +         S+G+ K  L+GFILS+ILT+IPF +VM+G     + +  T+V  A+ Q
Sbjct: 1   MSHAKD-AHTGASHGSVKTYLIGFILSVILTVIPFWMVMEGTA-STSAILWTVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  ++ W+++A +FT+++V I  +GS+W+MY+LN NMM
Sbjct: 59  ILVHLVCFLHMNTSSDERWNLVAFLFTMLIVGIVVIGSLWIMYNLNINMM 108


>gi|290474675|ref|YP_003467555.1| cytochrome o ubiquinol oxidase subunit IV [Xenorhabdus bovienii
           SS-2004]
 gi|289173988|emb|CBJ80775.1| cytochrome o ubiquinol oxidase, subunit IV [Xenorhabdus bovienii
           SS-2004]
          Length = 110

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 75/110 (68%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N  + +   +G+ K  ++GFILS+ILT+IPF +VM G      I+   I   A+ Q
Sbjct: 1   MSHPNT-SHSGADHGSFKTYMIGFILSVILTVIPFWMVMDGSASQSTILLTVI-GMAVIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I VH V FLHM+T  E+ W+++A+IFT++++AI  VGS+W+MY+LN NMM
Sbjct: 59  IFVHFVCFLHMNTSSEERWNLVALIFTLLVIAIVVVGSLWIMYNLNINMM 108


>gi|330821325|ref|YP_004350187.1| Ubiquinol oxidase, subunit IV [Burkholderia gladioli BSR3]
 gi|327373320|gb|AEA64675.1| Ubiquinol oxidase, subunit IV [Burkholderia gladioli BSR3]
          Length = 113

 Score =  122 bits (308), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 46/112 (41%), Positives = 73/112 (65%), Gaps = 1/112 (0%)

Query: 1   MKYDNIHN-MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +   H+  +  S+GT    LVGF+LS+ILT   FG+V+ G+F     M + + + A  
Sbjct: 1   MAHSPAHDGHDDASHGTVSSYLVGFVLSVILTAASFGVVLGGWFASTTTMVIALAVLAAV 60

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHL+FFLHM+T     W++ A ++T++ V I  VGS+W+M++++ NMMS
Sbjct: 61  QIVVHLIFFLHMNTSSGQRWNLTAFVYTVLTVGIVIVGSLWIMHNVSMNMMS 112


>gi|103486990|ref|YP_616551.1| cytochrome C oxidase subunit IV [Sphingopyxis alaskensis RB2256]
 gi|98977067|gb|ABF53218.1| cytochrome C oxidase subunit IV [Sphingopyxis alaskensis RB2256]
          Length = 128

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 71/113 (62%), Gaps = 1/113 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H      + T +  ++GF+LS+ILT IPF +VM    L        I+  A+ QI+VH
Sbjct: 9   HGHGEIEMPHATMRDYVIGFVLSVILTAIPFWLVMT-MPLSAGTTGAIIMAFAVVQIVVH 67

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           +VFFLHM+ K E GWS+ +++FT+I+V I   GS+WVM+HLN NMM M    +
Sbjct: 68  MVFFLHMTPKAEGGWSLTSLVFTVIVVVIMLAGSLWVMHHLNTNMMPMPHEPT 120


>gi|146310557|ref|YP_001175631.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter sp. 638]
 gi|145317433|gb|ABP59580.1| cytochrome bo3 quinol oxidase subunit 4 [Enterobacter sp. 638]
          Length = 108

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   +++ A+ Q
Sbjct: 1   MSHSNDHG---ASHGSVKTYMTGFILSIILTVIPFWMVMNGSA-SKPVLLGVVLVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW+I A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNITAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|194289183|ref|YP_002005090.1| cytochrome o ubiquinol oxidase subunit iv [Cupriavidus taiwanensis
           LMG 19424]
 gi|193223018|emb|CAQ69023.1| cytochrome o ubiquinol oxidase, subunit IV [Cupriavidus taiwanensis
           LMG 19424]
          Length = 122

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 44/109 (40%), Positives = 73/109 (66%), Gaps = 1/109 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + H+ +   + + K   +GFIL++ILT+IPF IVM G  +DK  +  TI+  A+ Q+IV
Sbjct: 15  SHAHDSHAGGHASFKGYAIGFILAVILTVIPFKIVMDGT-MDKGTILWTILGMAVVQMIV 73

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           HL +FLH+ +  E   +++A++FT +++ I   GS+W+M++LN NMM M
Sbjct: 74  HLKYFLHLDSSSEQRSNVIALLFTALILVIVVAGSLWIMHNLNANMMVM 122


>gi|117617963|ref|YP_857447.1| cytochrome o ubiquinol oxidase subunit IV [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559370|gb|ABK36318.1| cytochrome O ubiquinol oxidase protein CyoD [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 110

 Score =  122 bits (307), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 50/107 (46%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           ++  + +  S+G+ K  L+GF+LSLILT +PF +VM G       +  T+V  A+ QI V
Sbjct: 3   NHTVDNHGASHGSAKSYLIGFVLSLILTAVPFWMVMDGSA-SHTTVLATVVGMAVVQIFV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV+FLHM+T  E+ W+++A+IFT++++AI  VGS+W+MY+LN NMM
Sbjct: 62  HLVYFLHMNTSSEERWNLVALIFTVLIIAIVVVGSLWIMYNLNINMM 108


>gi|332160740|ref|YP_004297317.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|318604619|emb|CBY26117.1| cytochrome O ubiquinol oxidase subunit IV [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|325664970|gb|ADZ41614.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330859963|emb|CBX70292.1| cytochrome o ubiquinol oxidase protein cyoD [Yersinia
           enterocolitica W22703]
          Length = 115

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/109 (45%), Positives = 74/109 (67%), Gaps = 1/109 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
              +       S+G+ K  ++GFILS+ILT+IPF +VM G      I+  T+V  A+ QI
Sbjct: 6   SSHSTTTHGGASHGSLKSYIIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           IVHLV+FLHM+   E+ W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 65  IVHLVYFLHMNGSSEERWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 113


>gi|212709187|ref|ZP_03317315.1| hypothetical protein PROVALCAL_00220 [Providencia alcalifaciens DSM
           30120]
 gi|212688099|gb|EEB47627.1| hypothetical protein PROVALCAL_00220 [Providencia alcalifaciens DSM
           30120]
          Length = 110

 Score =  122 bits (307), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +         S+G+ K  L+GFILS+ILT+IPF +VM G    + ++  T+V  A+ Q
Sbjct: 1   MSHAKD-AHTGASHGSVKTYLIGFILSVILTVIPFWMVMNGTA-SQGVILATVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  ++ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 59  ILVHLVCFLHMNTSSDERWNLIAFLFTMLIIGIVVIGSLWIMYNLNINMM 108


>gi|13475709|ref|NP_107276.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium loti
           MAFF303099]
 gi|14026465|dbj|BAB53062.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium loti
           MAFF303099]
          Length = 125

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 54/104 (51%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  L+GF+LS+ILT IPF +VM G   +K    + I+  A+ QI+VH+VFFLHM T  
Sbjct: 21  SFKGYLIGFVLSVILTAIPFWLVMSGAIDNKQATAIVIMAFAVVQIVVHMVFFLHMKTAS 80

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM-EGMRSI 118
           E GWS++A+IFT+I+V I   GS+WVMYHLN NMM     MR +
Sbjct: 81  EGGWSMLALIFTLILVVIVLTGSLWVMYHLNANMMPGLHDMREM 124


>gi|304414866|ref|ZP_07395784.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Regiella
           insecticola LSR1]
 gi|304283135|gb|EFL91549.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Regiella
           insecticola LSR1]
          Length = 108

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 50/107 (46%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           +  +    S+G+ K  L+GF+LS+ILT+IPF +VM        ++  T+V  AI QIIVH
Sbjct: 3   DTTDHAGASHGSLKSYLIGFVLSIILTVIPFAMVMSNTA-SHTLILTTVVALAIVQIIVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLHM+   E+ W++ A +FTI+++AI  VGS+W+MY+LN NMM 
Sbjct: 62  LVYFLHMNGSSEERWNLGAFLFTILVIAIIVVGSLWIMYNLNINMMP 108


>gi|293607337|ref|ZP_06689676.1| quinol oxidase subunit IV [Achromobacter piechaudii ATCC 43553]
 gi|292814181|gb|EFF73323.1| quinol oxidase subunit IV [Achromobacter piechaudii ATCC 43553]
          Length = 139

 Score =  122 bits (306), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 51/105 (48%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GFIL+ ILT IPF +VM   F       L I+  A+ QI+VH+++FLHM TK 
Sbjct: 34  TLKSYVTGFILAAILTAIPFWLVMDRVFASSRTTALVILAFAVVQIVVHIIYFLHMDTKS 93

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM--EGMRSI 118
           E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M    MR++
Sbjct: 94  ESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMSTHDMRNM 138


>gi|183601051|ref|ZP_02962544.1| hypothetical protein PROSTU_04673 [Providencia stuartii ATCC 25827]
 gi|188019390|gb|EDU57430.1| hypothetical protein PROSTU_04673 [Providencia stuartii ATCC 25827]
          Length = 110

 Score =  121 bits (305), Expect = 2e-26,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +         S+G+ K  ++GF+LS+ILT+IPF +VM+G    +  +  T+V  A+ Q
Sbjct: 1   MSHAKD-AHTGASHGSMKTYVIGFVLSVILTVIPFWMVMEGTA-SQATILWTVVGMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+T  ++ W+++A +FT++++ I  +GS+W+MY+LN NMM
Sbjct: 59  ILVHLVCFLHMNTSSDERWNLIAFLFTMLIIGIVVIGSLWIMYNLNINMM 108


>gi|226952679|ref|ZP_03823143.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ATCC
           27244]
 gi|294649993|ref|ZP_06727381.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           haemolyticus ATCC 19194]
 gi|226836585|gb|EEH68968.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ATCC
           27244]
 gi|292824086|gb|EFF82901.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           haemolyticus ATCC 19194]
          Length = 109

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/107 (48%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V
Sbjct: 3   SHDHNAAGASHGNVKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAITAVAQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            LV+FLHM+T  +  W+++A I+TI+ +A+  VGS+W+M +L+ NMM
Sbjct: 62  QLVYFLHMNTSSDQRWNLIAFIYTILCIAVLLVGSVWIMNYLHYNMM 108


>gi|251790656|ref|YP_003005377.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya zeae Ech1591]
 gi|247539277|gb|ACT07898.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya zeae Ech1591]
          Length = 110

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 82/110 (74%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+    S+G+ K  LVGF+LS+ILT+IPFG+VM G     N++ L ++ CAI Q
Sbjct: 1   MSH-STHDHAGASHGSVKSYLVGFVLSIILTVIPFGLVMNGSA-SHNVILLAVLGCAIIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNVVAIVFTALIIAIVVVGSLWIMMNAHHNMM 108


>gi|295096783|emb|CBK85873.1| cytochrome bo3 quinol oxidase subunit 4 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 108

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   I++ A+ Q
Sbjct: 1   MSHSNDHG---ASHGSVKTYMTGFILSIILTVIPFWMVMNGSA-SKPVILGAILVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNMTAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|222084384|ref|YP_002542913.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           radiobacter K84]
 gi|221721832|gb|ACM24988.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium
           radiobacter K84]
          Length = 133

 Score =  121 bits (305), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 53/104 (50%), Positives = 72/104 (69%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
             S+GT K  + GF+LS+ILT IPF +VM   F D  +    I++    QIIVH+++FLH
Sbjct: 23  EASHGTFKSYMTGFVLSVILTAIPFWLVMGKVFADPVVTAALIMVFGAIQIIVHMIYFLH 82

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           M+TK E GW++MA+IFTI++V I   GS+WVM+HLN NMM M  
Sbjct: 83  MNTKSEGGWNMMALIFTIVLVIIALSGSLWVMHHLNANMMVMSP 126


>gi|45440613|ref|NP_992152.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51595299|ref|YP_069490.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808652|ref|YP_652568.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis Antiqua]
 gi|108811089|ref|YP_646856.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|145600061|ref|YP_001164137.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides F]
 gi|149364987|ref|ZP_01887022.1| cytochrome O ubiquinol oxidase subunit [Yersinia pestis CA88-4125]
 gi|153949808|ref|YP_001402061.1| cytochrome O ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 31758]
 gi|162420623|ref|YP_001607429.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis Angola]
 gi|165935892|ref|ZP_02224462.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166011041|ref|ZP_02231939.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166212919|ref|ZP_02238954.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167423433|ref|ZP_02315186.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|167469782|ref|ZP_02334486.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis FV-1]
 gi|170025461|ref|YP_001721966.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis YPIII]
 gi|186894316|ref|YP_001871428.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930197|ref|YP_002348072.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis CO92]
 gi|229838772|ref|ZP_04458931.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229896074|ref|ZP_04511244.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides A]
 gi|229899340|ref|ZP_04514483.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229901316|ref|ZP_04516438.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|294504897|ref|YP_003568959.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Z176003]
 gi|45435470|gb|AAS61029.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis biovar
           Microtus str. 91001]
 gi|51588581|emb|CAH20189.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774737|gb|ABG17256.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Nepal516]
 gi|108780565|gb|ABG14623.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Antiqua]
 gi|115348808|emb|CAL21762.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis CO92]
 gi|145211757|gb|ABP41164.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Pestoides F]
 gi|149291400|gb|EDM41474.1| cytochrome O ubiquinol oxidase subunit [Yersinia pestis CA88-4125]
 gi|152961303|gb|ABS48764.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia
           pseudotuberculosis IP 31758]
 gi|162353438|gb|ABX87386.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis Angola]
 gi|165916037|gb|EDR34644.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165990041|gb|EDR42342.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166205706|gb|EDR50186.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167057603|gb|EDR67349.1| cytochrome o ubiquinol oxidase, subunit IV [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|169751995|gb|ACA69513.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis YPIII]
 gi|186697342|gb|ACC87971.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia
           pseudotuberculosis PB1/+]
 gi|229681245|gb|EEO77339.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Nepal516]
 gi|229687742|gb|EEO79815.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229695138|gb|EEO85185.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229700997|gb|EEO89026.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis
           Pestoides A]
 gi|262362963|gb|ACY59684.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           D106004]
 gi|262366882|gb|ACY63439.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           D182038]
 gi|294355356|gb|ADE65697.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia pestis
           Z176003]
 gi|320016354|gb|ADV99925.1| cytochrome o ubiquinol oxidase subunit IV [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 110

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +         S+G+ K  ++GF+LS+ILT+IPF +VM G         LT+V  A+ Q
Sbjct: 1   MSHSTT-THGGASHGSLKSYIIGFVLSVILTVIPFVMVMSGTA-SYTTTLLTVVGLAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLHM+T  E+ W+++A++FT +++AI  VGS+W+MY+LN NMM
Sbjct: 59  IVVHLVYFLHMNTSSEERWNLVALLFTAMIIAIVVVGSLWIMYNLNINMM 108


>gi|283784255|ref|YP_003364120.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter rodentium
           ICC168]
 gi|282947709|emb|CBG87264.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter rodentium
           ICC168]
          Length = 109

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSNDHG--GASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPGVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|156935022|ref|YP_001438938.1| hypothetical protein ESA_02873 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533276|gb|ABU78102.1| hypothetical protein ESA_02873 [Cronobacter sakazakii ATCC BAA-894]
          Length = 109

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   HN     +G  K  L+GFILS+ILT+IPF +VM G       +   +V  A+ Q
Sbjct: 1   MSHSTDHNGAH--HGGVKTYLIGFILSVILTVIPFWMVMNGSA-SHGTLLGVVVATAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+   E+ W+++A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNASSEERWNLVAFVFTLLIIAIVVVGSIWIMWNLNYNMM 107


>gi|260596797|ref|YP_003209368.1| cytochrome o ubiquinol oxidase protein cyoD [Cronobacter turicensis
           z3032]
 gi|260215974|emb|CBA28615.1| Cytochrome o ubiquinol oxidase protein cyoD [Cronobacter turicensis
           z3032]
          Length = 109

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   HN     +G  K  L+GFILS+ILT+IPF +VM G       +   +V  A+ Q
Sbjct: 1   MSHSTDHNGAH--HGGVKTYLIGFILSVILTVIPFWMVMNGSA-SHGTLLGVVVATAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+   E+ W+++A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNASSEERWNLVAFIFTLLIIAIVVVGSIWIMWNLNYNMM 107


>gi|271499589|ref|YP_003332614.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech586]
 gi|270343144|gb|ACZ75909.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech586]
          Length = 110

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 48/110 (43%), Positives = 80/110 (72%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+    S+G+ K  L+GF+LS+ILT+IPFG+VM        I+  T++ CA+ Q
Sbjct: 1   MSH-STHDHAGASHGSVKSYLIGFVLSIILTVIPFGLVMNSSASHSAILL-TVLGCAVIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++FT +++AI  VGS+W+M + ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNLVAIVFTALIIAIVVVGSIWIMMNAHHNMM 108


>gi|145299868|ref|YP_001142709.1| cytochrome o ubiquinol oxidase subunit IV [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142852640|gb|ABO90961.1| cytochrome O ubiquinol oxidase protein CyoD [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 110

 Score =  121 bits (304), Expect = 3e-26,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 79/103 (76%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  S+G+ K  L+GF+LS+ILT IPF +VM G F  + ++ +T+V  A+ QI VHLV+
Sbjct: 7   DNHGASHGSAKSYLIGFVLSVILTAIPFWMVMDGGFTHQTML-ITVVAMAVVQIFVHLVY 65

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLHM+T  E+ W+++A++FT++++AI  VGS+W+MY+LN NMM
Sbjct: 66  FLHMNTSSEERWNLVALVFTVLIIAIVVVGSLWIMYNLNINMM 108


>gi|325161734|gb|ADY89613.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens]
          Length = 111

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H+ +  S+G+ K   +GFILS+ILT+IPFG+VM    L K++    ++  A+ Q
Sbjct: 1   MANAHSHDSHDASHGSVKSYAIGFILSVILTVIPFGLVMYPS-LPKSLTLWIVLAFAVIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++VHLV+FLH+        +++A +F  I++ +    S+W+M+ ++ NMM+
Sbjct: 60  VLVHLVYFLHLDRSAAQRNNVIAFVFAAIVIVLLVGLSLWIMFSIHTNMMA 110


>gi|254700860|ref|ZP_05162688.1| Prokaryotic Cytochrome C oxidase subunit IV [Brucella suis bv. 5
           str. 513]
 gi|261751370|ref|ZP_05995079.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 5 str.
           513]
 gi|261741123|gb|EEY29049.1| cytochrome o ubiquinol oxidase subunit IV [Brucella suis bv. 5 str.
           513]
          Length = 121

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 4   DNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            + H  + H+ +G+ K  L+GF+L++ILT++PF + M G+F       + ++  A  QI+
Sbjct: 2   SSAHQTHDHAAHGSLKSYLIGFVLAVILTVVPFALAMGGYFTP-ATTAVIVLAIAAVQIL 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM M
Sbjct: 61  VHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMMLM 110


>gi|238897313|ref|YP_002922990.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229465068|gb|ACQ66842.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 132

 Score =  121 bits (304), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 49/108 (45%), Positives = 77/108 (71%), Gaps = 2/108 (1%)

Query: 4   DNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D++      ++ G+ K  +VGFILS++LT+IPF +VM      + ++  T++  A+ QII
Sbjct: 24  DHLSAERGGAHQGSLKSYVVGFILSVMLTVIPFMMVMNQSA-SRTVILATVIATAVVQII 82

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VHLV+FLHM+   E+ W+++A IFT+I++AI  VGS+W+M+HLN NMM
Sbjct: 83  VHLVYFLHMNGASEERWNLVAFIFTVIIIAIVLVGSLWIMHHLNINMM 130


>gi|261341030|ref|ZP_05968888.1| cytochrome o ubiquinol oxidase, subunit IV [Enterobacter
           cancerogenus ATCC 35316]
 gi|296101550|ref|YP_003611696.1| cytochrome o ubiquinol oxidase operon protein cyoD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
 gi|288316895|gb|EFC55833.1| cytochrome o ubiquinol oxidase, subunit IV [Enterobacter
           cancerogenus ATCC 35316]
 gi|295056009|gb|ADF60747.1| cytochrome o ubiquinol oxidase operon protein cyoD [Enterobacter
           cloacae subsp. cloacae ATCC 13047]
          Length = 108

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 79/110 (71%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N H     S+G+ K  + GFILS+ILT+IPF +VM G    K ++   I++ A+ Q
Sbjct: 1   MSHSNDHGA---SHGSVKTYMTGFILSIILTVIPFWMVMSGSA-SKPVILGAILVTAVIQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNMTAFIFTVIIIAILVVGSIWIMWNLNYNMM 106


>gi|222107117|ref|YP_002547908.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium vitis S4]
 gi|221738296|gb|ACM39192.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium vitis S4]
          Length = 132

 Score =  121 bits (303), Expect = 4e-26,   Method: Composition-based stats.
 Identities = 50/102 (49%), Positives = 73/102 (71%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ K  ++GFILS+ LT IPF +VM G   +K ++   ++     Q++VH+++FLHM+
Sbjct: 24  SHGSMKTYMIGFILSVTLTSIPFYLVMSGSLTNKALLAGIVMGLGAIQVVVHMIYFLHMN 83

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           TK E GW++MA+IFTII+V I   GS+WVM+HLN NMM M  
Sbjct: 84  TKSEGGWNMMALIFTIIVVVIALSGSLWVMHHLNTNMMPMSP 125


>gi|299769502|ref|YP_003731528.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. DR1]
 gi|298699590|gb|ADI90155.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. DR1]
          Length = 109

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 52/107 (48%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + I+   I + A+AQ++V
Sbjct: 3   SHDHNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGILVTVIAIAAVAQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            LV+FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 62  QLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 108


>gi|319406525|emb|CBI80167.1| Cytochrome o ubiquinol oxidase protein cyoD (modular protein)
           [Bartonella sp. 1-1C]
          Length = 158

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIAQ 60
           YD  H        +    LVGFIL+++ T+  F  VM G      I    I  +  A+ Q
Sbjct: 2   YDKNHEP------SIGSYLVGFILAVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 55

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           IIV +VFFLH+++  +  W++ A++FT +   I   G+ W + HLN NMM   G
Sbjct: 56  IIVQIVFFLHLNSGPDARWNLTALLFTAMCAFIIIGGTWWAISHLNYNMMGGSG 109


>gi|317403926|gb|EFV84395.1| cytochrome ubiquinol oxidase subunit IV [Achromobacter xylosoxidans
           C54]
          Length = 132

 Score =  120 bits (302), Expect = 5e-26,   Method: Composition-based stats.
 Identities = 50/105 (47%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L+ ILT IPF +VM   F       L I+  A+ QI+VH+++FLHM TK 
Sbjct: 27  TLKSYVTGFVLAAILTAIPFWLVMDRVFASSRTTALVILAFAVVQIVVHIIYFLHMDTKS 86

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM--EGMRSI 118
           E GW+++A+IFT+++V I   GS+W+MYHLN+NMM M    MR++
Sbjct: 87  ESGWNMLALIFTLVLVVITLSGSIWIMYHLNSNMMPMSVHDMRNM 131


>gi|238025053|ref|YP_002909285.1| Ubiquinol oxidase subunit IV [Burkholderia glumae BGR1]
 gi|237879718|gb|ACR32050.1| Ubiquinol oxidase, subunit IV [Burkholderia glumae BGR1]
          Length = 113

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 45/112 (40%), Positives = 72/112 (64%), Gaps = 1/112 (0%)

Query: 1   MKYDNIH-NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M + + H + +  S+GT    LVGF+LS+ILT   FG+V+ G+F    +  L + + A  
Sbjct: 1   MAHSHTHASHDDASHGTVSSYLVGFVLSVILTAASFGVVLGGWFSTNEVKILVLAVLAAV 60

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHL+FFLHM+      W++ A  +T++ V I  VGS+W+M++++ NMMS
Sbjct: 61  QIVVHLIFFLHMNGSSSQRWNVTAFAYTVLTVGIVIVGSLWIMHNVSINMMS 112


>gi|218679506|ref|ZP_03527403.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
           etli CIAT 894]
          Length = 133

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 47/106 (44%), Positives = 70/106 (66%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +    + +   +GT K  + GF+LS+ILT IPF +VM G      +  + ++     QI
Sbjct: 14  AHHGHSHGHQAGHGTFKSYMAGFVLSVILTAIPFWLVMSGVIASPALTAVLVMGLGAVQI 73

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
           +VH++FFLHM+T+ E GW+IMA+IFT+I+VAI   GS+WVM+HLN 
Sbjct: 74  VVHMIFFLHMNTRSEGGWTIMALIFTLIIVAIALSGSLWVMHHLNT 119


>gi|220924640|ref|YP_002499942.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           nodulans ORS 2060]
 gi|219949247|gb|ACL59639.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           nodulans ORS 2060]
          Length = 130

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 69/104 (66%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T +  + GF+LS ILT IPF +VM     D+    + ++  A+ QI+VH+V+FLHM+T+ 
Sbjct: 24  TFEGYVTGFVLSAILTAIPFWLVMANVLDDRVQTTIAVLAFAVIQIVVHMVYFLHMNTRS 83

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           E GW+++A+IFT+ +V I   GS+WVM+HLN NMM +      H
Sbjct: 84  EGGWTVLALIFTVTLVVITLTGSIWVMHHLNTNMMPLSAEHVRH 127


>gi|311280674|ref|YP_003942905.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter cloacae
           SCF1]
 gi|308749869|gb|ADO49621.1| cytochrome o ubiquinol oxidase subunit IV [Enterobacter cloacae
           SCF1]
          Length = 108

 Score =  120 bits (302), Expect = 6e-26,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 77/110 (70%), Gaps = 4/110 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H     S+G+ K  + GFILS+ILT+IPF +VM G       +  T+++ A+ Q
Sbjct: 1   MSHSTDHG---ASHGSVKTYMTGFILSIILTLIPFWMVMNGSA-SHVALLGTVLVSAVVQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  +GS+W+M++LN NMM
Sbjct: 57  ILVHLVCFLHMNTKSDEGWNLTAFVFTVLIIAIVVIGSIWIMWNLNYNMM 106


>gi|94309896|ref|YP_583106.1| cytochrome c oxidase subunit IV [Cupriavidus metallidurans CH34]
 gi|93353748|gb|ABF07837.1| Cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|222871193|gb|EEF08324.1| predicted protein [Populus trichocarpa]
          Length = 116

 Score =  120 bits (302), Expect = 7e-26,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 69/108 (63%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
               +   H + + K  ++GF+L++ILT+IPF IVM G  +++  M   I+  A  QI+V
Sbjct: 7   STAAHGASHGHSSVKSYVIGFVLAVILTVIPFKIVMDGT-MERGTMLWIILGMAAVQIVV 65

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLH+       W++MA++FT++++ I   GS+W+M+++N NMM 
Sbjct: 66  HLKYFLHLDGSNGQRWNVMALLFTVLILFIVLAGSLWIMHNMNANMMP 113


>gi|163857711|ref|YP_001632009.1| hypothetical protein Bpet3398 [Bordetella petrii DSM 12804]
 gi|163261439|emb|CAP43741.1| conserved hypothetical protein [Bordetella petrii]
          Length = 125

 Score =  120 bits (301), Expect = 8e-26,   Method: Composition-based stats.
 Identities = 46/116 (39%), Positives = 76/116 (65%), Gaps = 2/116 (1%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           N H  +  ++ +    L+GF L+ ILT IPF IVM   F    +  L ++  AI QI+VH
Sbjct: 9   NGHEEDPLAHASLHGYLLGFALAAILTAIPFFIVMANVFSSSRVTGLVLLALAIVQIVVH 68

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM--EGMRSI 118
           +++FLH+  + E GW++++++FT+++V I   GS+W+MYHL++NMM M    MR++
Sbjct: 69  VIYFLHVDFQSEGGWNMLSIVFTLVLVVIALSGSIWIMYHLDHNMMPMSTHDMRNM 124


>gi|311108526|ref|YP_003981379.1| cytochrome O ubiquinol oxidase subunit IV 2 [Achromobacter
           xylosoxidans A8]
 gi|310763215|gb|ADP18664.1| cytochrome O ubiquinol oxidase subunit IV 2 [Achromobacter
           xylosoxidans A8]
          Length = 134

 Score =  120 bits (301), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 46/98 (46%), Positives = 69/98 (70%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GF+L+ +LT IPF +VM   F +     L I+  A+ QI+VH+++FLHM TK 
Sbjct: 29  TFKSYMTGFVLAAVLTAIPFWLVMGRVFTESRTTALVILAFAVVQIVVHIIYFLHMDTKS 88

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           E GW+++A+IFT+++V I   GS+W+MYHL++NMM M 
Sbjct: 89  ESGWNMLALIFTLVLVVITLSGSIWIMYHLDSNMMPMS 126


>gi|184158692|ref|YP_001847031.1| Heme/copper-type cytochrome/quinol oxidase subunit 4 [Acinetobacter
           baumannii ACICU]
 gi|213158554|ref|YP_002319852.1| cytochrome O ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB0057]
 gi|215482993|ref|YP_002325198.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB307-0294]
 gi|239501440|ref|ZP_04660750.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB900]
 gi|293609458|ref|ZP_06691760.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|301345100|ref|ZP_07225841.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB056]
 gi|301510828|ref|ZP_07236065.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB058]
 gi|301595309|ref|ZP_07240317.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB059]
 gi|332850731|ref|ZP_08432978.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013150]
 gi|332866968|ref|ZP_08437285.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013113]
 gi|332873684|ref|ZP_08441627.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6014059]
 gi|183210286|gb|ACC57684.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Acinetobacter baumannii ACICU]
 gi|193077738|gb|ABO12596.2| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 17978]
 gi|213057714|gb|ACJ42616.1| cytochrome O ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB0057]
 gi|213988781|gb|ACJ59080.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           AB307-0294]
 gi|292827910|gb|EFF86273.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|322507498|gb|ADX02952.1| cyoD [Acinetobacter baumannii 1656-2]
 gi|323518606|gb|ADX92987.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           TCDC-AB0715]
 gi|325122720|gb|ADY82243.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter
           calcoaceticus PHEA-2]
 gi|332730568|gb|EGJ61884.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013150]
 gi|332734297|gb|EGJ65425.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6013113]
 gi|332738072|gb|EGJ68956.1| cytochrome o ubiquinol oxidase, subunit IV [Acinetobacter baumannii
           6014059]
          Length = 109

 Score =  119 bits (300), Expect = 9e-26,   Method: Composition-based stats.
 Identities = 51/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + HN    S+G  KQ  VGFILS+ILTIIPFG+VM G F  + ++   I + A+AQ++V
Sbjct: 3   SHEHNAAGASHGNFKQYTVGFILSVILTIIPFGMVMAGGF-SRGLLVTVIAITAVAQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            LV+FLHM+T  E  W+++A I+TI+ +A+  +GS+W+M +L+ NMM
Sbjct: 62  QLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLIGSVWIMNYLHYNMM 108


>gi|320540328|ref|ZP_08039980.1| cytochrome o ubiquinol oxidase subunit IV [Serratia symbiotica str.
           Tucson]
 gi|320029648|gb|EFW11675.1| cytochrome o ubiquinol oxidase subunit IV [Serratia symbiotica str.
           Tucson]
          Length = 112

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 76/111 (68%), Gaps = 2/111 (1%)

Query: 1   MKYD-NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +  +  +    S+G+ K  L+GFILS+ILT+IPF +VM        I+   +V  A+ 
Sbjct: 1   MSHSSHETSHGGASHGSVKSYLIGFILSIILTVIPFAMVMNDSASHATILA-VVVGTAVI 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VHL++FLHM+T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 60  QVLVHLIYFLHMNTSSEERWNLVALLFTAMVIGIVVVGSLWIMYNLNINMM 110


>gi|152980590|ref|YP_001354327.1| cytochrome o ubiquinol oxidase operon protein [Janthinobacterium
           sp. Marseille]
 gi|151280667|gb|ABR89077.1| cytochrome o ubiquinol oxidase operon protein [Janthinobacterium
           sp. Marseille]
          Length = 149

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/96 (51%), Positives = 67/96 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K   +GFILS+ILT IPF +VM   F   +     I+  A  QI+VH+V+FLHM+TK 
Sbjct: 28  SLKSYTIGFILSVILTAIPFWLVMGKVFDSSSTTAFVILGFAAVQIVVHMVYFLHMNTKS 87

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           E GWS++ +IFTI++V I   GS+WVMYH+N+NMM 
Sbjct: 88  EGGWSMLGLIFTIMVVVIMLAGSIWVMYHMNHNMMP 123


>gi|213425865|ref|ZP_03358615.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
          Length = 109

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 74/107 (69%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +       S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+V
Sbjct: 2   SHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAA-SPAVILGSILAMAVVQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A IFT +++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFIFTALIIAILVVGSIWIMWNLNYNMM 107


>gi|17547633|ref|NP_521035.1| transmembrane cytochrome O ubiquinol oxidase subunit IV [Ralstonia
           solanacearum GMI1000]
 gi|17429937|emb|CAD16621.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit iv)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 121

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 1/109 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
              + H      + T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI
Sbjct: 12  ADAHGHATGGAGHATVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMGLAVVQI 70

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL++FLH+       W++MA +FT++++ I  VGS+WVM+++N NMM
Sbjct: 71  VVHLIYFLHLDGSSAQRWNVMAFLFTLLILVIVIVGSLWVMHNMNVNMM 119


>gi|325291581|ref|YP_004277445.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium sp. H13-3]
 gi|325059434|gb|ADY63125.1| cytochrome o ubiquinol oxidase subunit IV [Agrobacterium sp. H13-3]
          Length = 131

 Score =  119 bits (300), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/98 (44%), Positives = 69/98 (70%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  ++GF++S+ILT IPF +VM     +K ++ + I+   + QI VH+++FLHM TK 
Sbjct: 26  TFKSYMIGFVMSVILTAIPFWLVMGDVLENKTLLVIAIMGLGVIQIFVHMIYFLHMDTKS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           E GW+ MA+IFT++++ I   GS+WVMY++N NMM + 
Sbjct: 86  EGGWTFMALIFTVVVLLITLSGSLWVMYNMNKNMMPLH 123


>gi|157146955|ref|YP_001454274.1| cytochrome o ubiquinol oxidase subunit IV [Citrobacter koseri ATCC
           BAA-895]
 gi|157084160|gb|ABV13838.1| hypothetical protein CKO_02732 [Citrobacter koseri ATCC BAA-895]
          Length = 109

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKTYMTGFILSIILTVIPFWMVMTGTG-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|315500561|ref|YP_004089363.1| cytochrome o ubiquinol oxidase subunit IV [Asticcacaulis
           excentricus CB 48]
 gi|315418573|gb|ADU15212.1| cytochrome o ubiquinol oxidase subunit IV [Asticcacaulis
           excentricus CB 48]
          Length = 147

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 66/112 (58%), Gaps = 2/112 (1%)

Query: 1   MKYDNIHN-MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           +++   H   +   + + K  L+GF LS+ILT IPF + M    L    +   I++  + 
Sbjct: 28  LQHGQGHGRDHGAGHASVKDYLIGFSLSVILTAIPFALTMLK-LLPAATLVPVILILGVI 86

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHL +FLHM++     W+ +A IFT I+V I  VGS+WVM HLN+NM  
Sbjct: 87  QIVVHLRYFLHMNSSSSQVWNNLAFIFTAIIVGILIVGSLWVMTHLNHNMAP 138


>gi|73540688|ref|YP_295208.1| cytochrome C oxidase subunit IV [Ralstonia eutropha JMP134]
 gi|72118101|gb|AAZ60364.1| Prokaryotic Cytochrome C oxidase subunit IV [Ralstonia eutropha
           JMP134]
          Length = 116

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 67/102 (65%), Gaps = 1/102 (0%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
             H + + K   +GF+L++ILT+IPF IVM G  +D+    L I+  A  Q++VHL +FL
Sbjct: 12  ESHGHSSFKSYAIGFVLAVILTVIPFKIVMDGT-MDRGTTLLIILGMAAVQVVVHLKYFL 70

Query: 70  HMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HM    E  W++M+ +FT++++ I   GS+W+M+++N NMM 
Sbjct: 71  HMDGSKEQRWNVMSFLFTLLILFIVLAGSLWIMHNMNANMMP 112


>gi|187734216|ref|YP_001879139.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii CDC
           3083-94]
 gi|187431208|gb|ACD10482.1| cytochrome o ubiquinol oxidase, subunit IV [Shigella boydii CDC
           3083-94]
          Length = 109

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI   A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTIRAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|16759420|ref|NP_455037.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. CT18]
 gi|16763821|ref|NP_459436.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|29142808|ref|NP_806150.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56414404|ref|YP_151479.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62179052|ref|YP_215469.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|161504383|ref|YP_001571495.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161615370|ref|YP_001589335.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi B str. SPB7]
 gi|167551747|ref|ZP_02345500.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|167992292|ref|ZP_02573390.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168232415|ref|ZP_02657473.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|168237552|ref|ZP_02662610.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|168240264|ref|ZP_02665196.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|168261126|ref|ZP_02683099.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|168465531|ref|ZP_02699413.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|168818951|ref|ZP_02830951.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|194446490|ref|YP_002039682.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194450588|ref|YP_002044475.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194470587|ref|ZP_03076571.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194737366|ref|YP_002113471.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|197250726|ref|YP_002145421.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197264545|ref|ZP_03164619.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197363324|ref|YP_002142961.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|198243661|ref|YP_002214394.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|200389690|ref|ZP_03216301.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204927364|ref|ZP_03218566.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|207855920|ref|YP_002242571.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|213023462|ref|ZP_03337909.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. 404ty]
 gi|213052103|ref|ZP_03344981.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E00-7866]
 gi|213416725|ref|ZP_03349869.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E01-6750]
 gi|213584681|ref|ZP_03366507.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213649241|ref|ZP_03379294.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|213857960|ref|ZP_03384931.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. M223]
 gi|224582278|ref|YP_002636076.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|238911428|ref|ZP_04655265.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Tennessee str. CDC07-0191]
 gi|289825082|ref|ZP_06544434.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-3139]
 gi|25331177|pir||AC0557 cytochrome o ubiquinol oxidase C chain [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16418947|gb|AAL19395.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. LT2]
 gi|16501711|emb|CAD08899.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhi]
 gi|29138440|gb|AAO70010.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhi str. Ty2]
 gi|56128661|gb|AAV78167.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. ATCC 9150]
 gi|62126685|gb|AAX64388.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. SC-B67]
 gi|160865730|gb|ABX22353.1| hypothetical protein SARI_02494 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161364734|gb|ABX68502.1| hypothetical protein SPAB_03141 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194405153|gb|ACF65375.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL254]
 gi|194408892|gb|ACF69111.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL476]
 gi|194456951|gb|EDX45790.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CVM29188]
 gi|194712868|gb|ACF92089.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. CVM19633]
 gi|195631677|gb|EDX50197.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Newport str. SL317]
 gi|197094801|emb|CAR60334.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi A str. AKU_12601]
 gi|197214429|gb|ACH51826.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Agona str. SL483]
 gi|197242800|gb|EDY25420.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA23]
 gi|197289479|gb|EDY28842.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Schwarzengrund str. SL480]
 gi|197938177|gb|ACH75510.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602135|gb|EDZ00681.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|204324029|gb|EDZ09224.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Javiana str. GA_MM04042433]
 gi|205323488|gb|EDZ11327.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Saintpaul str. SARA29]
 gi|205329509|gb|EDZ16273.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205333521|gb|EDZ20285.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Kentucky str. CDC 191]
 gi|205340021|gb|EDZ26785.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Heidelberg str. SL486]
 gi|205344082|gb|EDZ30846.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Weltevreden str. HI_N05-537]
 gi|205349794|gb|EDZ36425.1| cytochrome o ubiquinol oxidase, subunit IV [Salmonella enterica
           subsp. enterica serovar Hadar str. RI_05P066]
 gi|206707723|emb|CAR32008.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|224466805|gb|ACN44635.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|261245723|emb|CBG23520.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. D23580]
 gi|267992153|gb|ACY87038.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301157051|emb|CBW16535.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312911473|dbj|BAJ35447.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. T000240]
 gi|320084713|emb|CBY94504.1| Cytochrome o ubiquinol oxidase protein cyoD Ubiquinol oxidase chain
           D [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321226016|gb|EFX51067.1| Cytochrome O ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322614718|gb|EFY11647.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315996572]
 gi|322618824|gb|EFY15712.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-1]
 gi|322623531|gb|EFY20370.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-3]
 gi|322629171|gb|EFY25950.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 495297-4]
 gi|322631891|gb|EFY28645.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-1]
 gi|322637372|gb|EFY34074.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 515920-2]
 gi|322642057|gb|EFY38667.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 531954]
 gi|322647876|gb|EFY44351.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           NC_MB110209-0054]
 gi|322652554|gb|EFY48908.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. OH_2009072675]
 gi|322653284|gb|EFY49617.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str.
           CASC_09SCPH15965]
 gi|322660567|gb|EFY56803.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 19N]
 gi|322664719|gb|EFY60912.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 81038-01]
 gi|322669228|gb|EFY65378.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MD_MDA09249507]
 gi|322670773|gb|EFY66906.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 414877]
 gi|322678988|gb|EFY75043.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 366867]
 gi|322682016|gb|EFY78041.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 413180]
 gi|322685155|gb|EFY81152.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 446600]
 gi|322713513|gb|EFZ05084.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Choleraesuis str. A50]
 gi|323128759|gb|ADX16189.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323192952|gb|EFZ78175.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609458-1]
 gi|323196966|gb|EFZ82108.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556150-1]
 gi|323203951|gb|EFZ88968.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 609460]
 gi|323206964|gb|EFZ91917.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 507440-20]
 gi|323210818|gb|EFZ95690.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 556152]
 gi|323214509|gb|EFZ99260.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB101509-0077]
 gi|323223066|gb|EGA07409.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB102109-0047]
 gi|323227015|gb|EGA11196.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB110209-0055]
 gi|323230167|gb|EGA14287.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. MB111609-0052]
 gi|323233905|gb|EGA17994.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009083312]
 gi|323238401|gb|EGA22459.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 2009085258]
 gi|323244089|gb|EGA28098.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. 315731156]
 gi|323246249|gb|EGA30232.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2009159199]
 gi|323251875|gb|EGA35738.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008282]
 gi|323257872|gb|EGA41551.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008283]
 gi|323261115|gb|EGA44707.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008284]
 gi|323264955|gb|EGA48454.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008285]
 gi|323272518|gb|EGA55925.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Montevideo str. IA_2010008287]
 gi|326622142|gb|EGE28487.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|332987389|gb|AEF06372.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhimurium str. UK-1]
          Length = 109

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +       S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+V
Sbjct: 2   SHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAA-SPAVILGSILAMAVVQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|213621013|ref|ZP_03373796.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
          Length = 105

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 47/105 (44%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +       S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+V
Sbjct: 2   SHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAA-SPAVILGSILAMAVVQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
           HLV FLHM+TK ++GW++ A IFT++++AI  VGS+W+M++LN N
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYN 105


>gi|332094584|gb|EGI99630.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii 5216-82]
          Length = 109

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 79/110 (71%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  ++GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKTYMIGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|283834252|ref|ZP_06353993.1| cytochrome o ubiquinol oxidase, subunit IV [Citrobacter youngae
           ATCC 29220]
 gi|291069774|gb|EFE07883.1| cytochrome o ubiquinol oxidase, subunit IV [Citrobacter youngae
           ATCC 29220]
          Length = 109

 Score =  119 bits (299), Expect = 1e-25,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 76/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + +     S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+V
Sbjct: 2   SHSNESGGASHGSVKTYMTGFILSIILTVIPFWMVMTGSA-SPAVILGTILAMAVVQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM++K ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNSKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|160899494|ref|YP_001565076.1| cytochrome o ubiquinol oxidase subunit IV [Delftia acidovorans
           SPH-1]
 gi|160365078|gb|ABX36691.1| cytochrome o ubiquinol oxidase subunit IV [Delftia acidovorans
           SPH-1]
          Length = 146

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/105 (42%), Positives = 69/105 (65%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            + T    + GF+LS+ILT IPF +VM     D+    + +   A+ QI+VH+VFFLHM+
Sbjct: 29  PHSTFSGYMWGFVLSIILTAIPFWLVMSNVISDRATAVMVLGGFAVVQILVHMVFFLHMN 88

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            K+E GW++++ IFT++ VAI   G++WVM+H+N NMM    M +
Sbjct: 89  GKIEGGWTLLSTIFTVVFVAIGIAGTLWVMFHMNTNMMPQHTMPA 133


>gi|15800159|ref|NP_286171.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           EDL933]
 gi|15829737|ref|NP_308510.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. Sakai]
 gi|16128414|ref|NP_414963.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. MG1655]
 gi|24111811|ref|NP_706321.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 301]
 gi|30061928|ref|NP_836099.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|74311004|ref|YP_309423.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei Ss046]
 gi|82542917|ref|YP_406864.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii Sb227]
 gi|89107299|ref|AP_001079.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. W3110]
 gi|110804456|ref|YP_687976.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 5 str.
           8401]
 gi|157157013|ref|YP_001461615.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           E24377A]
 gi|157159954|ref|YP_001457272.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli HS]
 gi|168749891|ref|ZP_02774913.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4113]
 gi|168756971|ref|ZP_02781978.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4401]
 gi|168761635|ref|ZP_02786642.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4501]
 gi|168776265|ref|ZP_02801272.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4196]
 gi|168800312|ref|ZP_02825319.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC508]
 gi|170021199|ref|YP_001726153.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ATCC
           8739]
 gi|170080015|ref|YP_001729335.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170683697|ref|YP_001742570.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           SMS-3-5]
 gi|188496374|ref|ZP_03003644.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 53638]
 gi|191166691|ref|ZP_03028518.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B7A]
 gi|193065222|ref|ZP_03046295.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli E22]
 gi|195938504|ref|ZP_03083886.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EC4024]
 gi|208815375|ref|ZP_03256554.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4045]
 gi|209395894|ref|YP_002269075.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4115]
 gi|209917645|ref|YP_002291729.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli SE11]
 gi|218549903|ref|YP_002383694.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ATCC 35469]
 gi|218552995|ref|YP_002385908.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI1]
 gi|218693892|ref|YP_002401559.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 55989]
 gi|218698659|ref|YP_002406288.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI39]
 gi|218703712|ref|YP_002411231.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UMN026]
 gi|238899717|ref|YP_002925513.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli BW2952]
 gi|253774583|ref|YP_003037414.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160498|ref|YP_003043606.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B str.
           REL606]
 gi|254791613|ref|YP_003076450.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. TW14359]
 gi|256020399|ref|ZP_05434264.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sp. D9]
 gi|256023954|ref|ZP_05437819.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp. 4_1_40B]
 gi|260842630|ref|YP_003220408.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O103:H2
           str. 12009]
 gi|260853652|ref|YP_003227543.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O26:H11
           str. 11368]
 gi|260866590|ref|YP_003232992.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O111:H-
           str. 11128]
 gi|261223910|ref|ZP_05938191.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261256376|ref|ZP_05948909.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. FRIK966]
 gi|291281336|ref|YP_003498154.1| Cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403549|ref|ZP_06647640.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1412]
 gi|293408578|ref|ZP_06652417.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B354]
 gi|293413684|ref|ZP_06656333.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B185]
 gi|293418499|ref|ZP_06660934.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B088]
 gi|297516402|ref|ZP_06934788.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli OP50]
 gi|298379161|ref|ZP_06989042.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1302]
 gi|300818242|ref|ZP_07098453.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           107-1]
 gi|300820328|ref|ZP_07100480.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           119-7]
 gi|300900497|ref|ZP_07118664.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           198-1]
 gi|300903306|ref|ZP_07121234.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           84-1]
 gi|300918190|ref|ZP_07134797.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           115-1]
 gi|300924154|ref|ZP_07140146.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           182-1]
 gi|300930271|ref|ZP_07145684.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           187-1]
 gi|300957994|ref|ZP_07170159.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           175-1]
 gi|301022580|ref|ZP_07186452.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           69-1]
 gi|301301577|ref|ZP_07207712.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           124-1]
 gi|301330705|ref|ZP_07223307.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           78-1]
 gi|301647352|ref|ZP_07247164.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           146-1]
 gi|307137072|ref|ZP_07496428.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H736]
 gi|307312193|ref|ZP_07591829.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|309794841|ref|ZP_07689262.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           145-7]
 gi|331661808|ref|ZP_08362731.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA143]
 gi|331666783|ref|ZP_08367657.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA271]
 gi|331681823|ref|ZP_08382456.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H299]
 gi|78099997|sp|P0ABJ7|CYOD_ECO57 RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|78099998|sp|P0ABJ6|CYOD_ECOLI RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|78099999|sp|P0ABJ8|CYOD_SHIFL RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD;
           Short=Ubiquinol oxidase chain D
 gi|12513288|gb|AAG54779.1|AE005222_4 cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EDL933]
 gi|145655|gb|AAA23634.1| cytochrome o ubiquinol oxidase C subunit [Escherichia coli]
 gi|1786632|gb|AAC73532.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. MG1655]
 gi|13359940|dbj|BAB33906.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. Sakai]
 gi|24050601|gb|AAN42028.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 301]
 gi|30040172|gb|AAP15905.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|73854481|gb|AAZ87188.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei Ss046]
 gi|81244328|gb|ABB65036.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii Sb227]
 gi|85674569|dbj|BAE76209.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K12 substr. W3110]
 gi|110614004|gb|ABF02671.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 5 str.
           8401]
 gi|157065634|gb|ABV04889.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli HS]
 gi|157079043|gb|ABV18751.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           E24377A]
 gi|169756127|gb|ACA78826.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ATCC
           8739]
 gi|169887850|gb|ACB01557.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli str.
           K-12 substr. DH10B]
 gi|170521415|gb|ACB19593.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           SMS-3-5]
 gi|187768304|gb|EDU32148.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4196]
 gi|188015898|gb|EDU54020.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4113]
 gi|188491573|gb|EDU66676.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli 53638]
 gi|189356033|gb|EDU74452.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4401]
 gi|189368086|gb|EDU86502.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4501]
 gi|189377391|gb|EDU95807.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC508]
 gi|190903202|gb|EDV62924.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli B7A]
 gi|192927196|gb|EDV81817.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli E22]
 gi|208732023|gb|EDZ80711.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4045]
 gi|209157294|gb|ACI34727.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           O157:H7 str. EC4115]
 gi|209743934|gb|ACI70274.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743936|gb|ACI70275.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743938|gb|ACI70276.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743940|gb|ACI70277.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209743942|gb|ACI70278.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli]
 gi|209910904|dbj|BAG75978.1| cytochrome O ubiquinol oxidase subunit IV [Escherichia coli SE11]
 gi|218350624|emb|CAU96316.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 55989]
 gi|218357444|emb|CAQ90083.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ATCC 35469]
 gi|218359763|emb|CAQ97304.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI1]
 gi|218368645|emb|CAR16384.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli IAI39]
 gi|218430809|emb|CAR11683.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UMN026]
 gi|238860710|gb|ACR62708.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli BW2952]
 gi|242376210|emb|CAQ30901.1| cytochrome bo terminal oxidase subunit IV, subunit of cytochrome bo
           terminal oxidase [Escherichia coli BL21(DE3)]
 gi|253325627|gb|ACT30229.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253972399|gb|ACT38070.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B str.
           REL606]
 gi|253976609|gb|ACT42279.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           BL21(DE3)]
 gi|254591013|gb|ACT70374.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. TW14359]
 gi|257752301|dbj|BAI23803.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O26:H11
           str. 11368]
 gi|257757777|dbj|BAI29274.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O103:H2
           str. 12009]
 gi|257762946|dbj|BAI34441.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O111:H-
           str. 11128]
 gi|260450384|gb|ACX40806.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli DH1]
 gi|281599765|gb|ADA72749.1| Cytochrome O ubiquinol oxidase protein CyoD [Shigella flexneri
           2002017]
 gi|284920239|emb|CBG33298.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Escherichia coli 042]
 gi|290761209|gb|ADD55170.1| Cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           O55:H7 str. CB9615]
 gi|291325027|gb|EFE64442.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B088]
 gi|291429402|gb|EFF02422.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1412]
 gi|291433742|gb|EFF06715.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B185]
 gi|291471756|gb|EFF14239.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli B354]
 gi|298280274|gb|EFI21778.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           FVEC1302]
 gi|300315330|gb|EFJ65114.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           175-1]
 gi|300355978|gb|EFJ71848.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           198-1]
 gi|300397461|gb|EFJ80999.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           69-1]
 gi|300404601|gb|EFJ88139.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           84-1]
 gi|300414641|gb|EFJ97951.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           115-1]
 gi|300419607|gb|EFK02918.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           182-1]
 gi|300461843|gb|EFK25336.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           187-1]
 gi|300527113|gb|EFK48182.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           119-7]
 gi|300529133|gb|EFK50195.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           107-1]
 gi|300843074|gb|EFK70834.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           124-1]
 gi|300843366|gb|EFK71126.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           78-1]
 gi|301074497|gb|EFK89303.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           146-1]
 gi|306907695|gb|EFN38197.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|308121494|gb|EFO58756.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           145-7]
 gi|313646949|gb|EFS11406.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri 2a
           str. 2457T]
 gi|315059709|gb|ADT74036.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli W]
 gi|315135111|dbj|BAJ42270.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli DH1]
 gi|315256254|gb|EFU36222.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           85-1]
 gi|320173753|gb|EFW48936.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella dysenteriae CDC
           74-1112]
 gi|320192843|gb|EFW67483.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. EC1212]
 gi|320638423|gb|EFX08137.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. G5101]
 gi|320643803|gb|EFX12926.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H-
           str. 493-89]
 gi|320649154|gb|EFX17732.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H-
           str. H 2687]
 gi|320656047|gb|EFX23963.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O55:H7
           str. 3256-97 TW 07815]
 gi|320661197|gb|EFX28628.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O55:H7
           str. USDA 5905]
 gi|320665173|gb|EFX32266.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. LSU-61]
 gi|323184741|gb|EFZ70112.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 1357]
 gi|323379726|gb|ADX51994.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli KO11]
 gi|323938614|gb|EGB34863.1| cytochrome o ubiquinol oxidase IV [Escherichia coli E1520]
 gi|323943235|gb|EGB39391.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli E482]
 gi|323945333|gb|EGB41389.1| cytochrome o ubiquinol oxidase IV [Escherichia coli H120]
 gi|323963418|gb|EGB58980.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H489]
 gi|323965115|gb|EGB60574.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli M863]
 gi|323972282|gb|EGB67492.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli TA007]
 gi|323976087|gb|EGB71180.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           TW10509]
 gi|324016711|gb|EGB85930.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           117-3]
 gi|324114656|gb|EGC08624.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           B253]
 gi|324116916|gb|EGC10829.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli E1167]
 gi|326341191|gb|EGD64983.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. 1044]
 gi|326346034|gb|EGD69773.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli O157:H7
           str. 1125]
 gi|327254755|gb|EGE66371.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           STEC_7v]
 gi|331060230|gb|EGI32194.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA143]
 gi|331066007|gb|EGI37891.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA271]
 gi|331081025|gb|EGI52190.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli H299]
 gi|332341792|gb|AEE55126.1| cytochrome O ubiquinol oxidase subunit IV CyoD [Escherichia coli
           UMNK88]
          Length = 109

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|330811629|ref|YP_004356091.1| cytochrome o subunit VI [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379737|gb|AEA71087.1| Cytochrome o subunit VI [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 111

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H+ +   +G+ K   +GFILS+ILT+IPFG+VM    L K++    +++ A+ Q
Sbjct: 1   MANAHSHDGHDAGHGSVKSYAIGFILSVILTVIPFGLVMYPS-LPKSLTLWIVLIFAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++VHLV+FLH+        +++A +F  I++ +    S+W+M+ ++ NMM+
Sbjct: 60  VLVHLVYFLHLDRSAAQRNNVVAFVFAAIVIVLLVGLSLWIMFSIHTNMMA 110


>gi|99082127|ref|YP_614281.1| cytochrome C oxidase subunit IV [Ruegeria sp. TM1040]
 gi|99038407|gb|ABF65019.1| cytochrome C oxidase subunit IV [Ruegeria sp. TM1040]
          Length = 115

 Score =  119 bits (298), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 45/106 (42%), Positives = 67/106 (63%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ HS+G+ K   +GF+LS+ILT+IPF +V+    +  N     I      QIIVH+ +F
Sbjct: 1   MSAHSHGSYKSYAIGFVLSVILTVIPFWLVLGEVDIGVNTAIAVIFGLGAVQIIVHMHYF 60

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           LH++   EDGW +M+++FT I++ I   GS+WVM HL+ NMM    
Sbjct: 61  LHVTYGAEDGWQVMSLVFTGILLIIVLAGSIWVMAHLHENMMPAHE 106


>gi|205351751|ref|YP_002225552.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205271532|emb|CAR36350.1| cytochrome o ubiquinol oxidase C subunit [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|326626786|gb|EGE33129.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
          Length = 109

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +       S+G+ K  + GFILS+ILT+IPF +VM G      ++  +I+  A+ QI+V
Sbjct: 2   SHSTESGGASHGSVKTYMTGFILSVILTVIPFWMVMTGAA-SPAVILGSILAMAVLQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|329890316|ref|ZP_08268659.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas diminuta
           ATCC 11568]
 gi|328845617|gb|EGF95181.1| cytochrome o ubiquinol oxidase subunit IV [Brevundimonas diminuta
           ATCC 11568]
          Length = 128

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 50/103 (48%), Positives = 72/103 (69%), Gaps = 1/103 (0%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF LS++LT IPF +VM G    + +  L I   A+ QI+VH++FFLHM+ K 
Sbjct: 26  TYKGYLIGFGLSVVLTAIPFWLVMAGVLAPQ-LTGLIITAFAVVQIVVHMIFFLHMNHKS 84

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           E GW+++A+IFT+++V I   GS+WVMYHLN NMM +  M+ +
Sbjct: 85  EGGWNMLALIFTLVIVVIAVAGSVWVMYHLNTNMMPVHDMQGM 127


>gi|157369330|ref|YP_001477319.1| cytochrome o ubiquinol oxidase subunit IV [Serratia proteamaculans
           568]
 gi|157321094|gb|ABV40191.1| Cytochrome o ubiquinol oxidase subunit IV [Serratia proteamaculans
           568]
          Length = 112

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 77/111 (69%), Gaps = 2/111 (1%)

Query: 1   MKYD-NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +  +  +    S+G+ K  L+GFILS+ILT+IPF +VM G      I+   +V  A+ 
Sbjct: 1   MSHSSHETSHGGASHGSVKTYLIGFILSIILTVIPFAMVMSGTASHSTILA-VVVGMAVI 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VHL++FLHM+T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 60  QVVVHLIYFLHMNTSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|50085513|ref|YP_047023.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ADP1]
 gi|49531489|emb|CAG69201.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter sp. ADP1]
          Length = 108

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +D  HN    S+G  KQ  +GFILS++LTIIPFG+VM G F  + ++   I + A+AQ
Sbjct: 1   MSHD--HNSAGASHGNFKQYTIGFILSVVLTIIPFGMVMAGGF-GRGLLMTVIGITAVAQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LVFFLHM+T  E  W+++A I+T++ +AI  VGS+W+M +L+ NMM
Sbjct: 58  VLVQLVFFLHMNTSSEQRWNLIAFIYTVLCIAILLVGSVWIMNYLHFNMM 107


>gi|91209498|ref|YP_539484.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UTI89]
 gi|110640689|ref|YP_668417.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 536]
 gi|215485510|ref|YP_002327941.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O127:H6
           str. E2348/69]
 gi|218557338|ref|YP_002390251.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli S88]
 gi|218688292|ref|YP_002396504.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ED1a]
 gi|237707577|ref|ZP_04538058.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp.
           3_2_53FAA]
 gi|300997384|ref|ZP_07181724.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           200-1]
 gi|91071072|gb|ABE05953.1| cytochrome O ubiquinol oxidase protein CyoD [Escherichia coli
           UTI89]
 gi|110342281|gb|ABG68518.1| cytochrome O ubiquinol oxidase C subunit [Escherichia coli 536]
 gi|215263582|emb|CAS07912.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O127:H6
           str. E2348/69]
 gi|218364107|emb|CAR01772.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli S88]
 gi|218425856|emb|CAR06662.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli ED1a]
 gi|222032224|emb|CAP74963.1| Cytochrome o ubiquinol oxidase protein cyoD [Escherichia coli LF82]
 gi|226898787|gb|EEH85046.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia sp.
           3_2_53FAA]
 gi|281177599|dbj|BAI53929.1| cytochrome O ubiquinol oxidase subunit IV [Escherichia coli SE15]
 gi|294494005|gb|ADE92761.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli
           IHE3034]
 gi|300304203|gb|EFJ58723.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           200-1]
 gi|307628102|gb|ADN72406.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli UM146]
 gi|312945006|gb|ADR25833.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli O83:H1
           str. NRG 857C]
 gi|315289856|gb|EFU49246.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           110-3]
 gi|315299551|gb|EFU58799.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           16-3]
 gi|323952959|gb|EGB48827.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H252]
 gi|323958622|gb|EGB54325.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli H263]
 gi|324010059|gb|EGB79278.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           57-2]
 gi|324010689|gb|EGB79908.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           60-1]
          Length = 109

 Score =  118 bits (297), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 49/107 (45%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + +  +  S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+V
Sbjct: 2   SHSNASSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQILV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|326389123|ref|ZP_08210703.1| cytochrome o ubiquinol oxidase subunit IV [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326206354|gb|EGD57191.1| cytochrome o ubiquinol oxidase subunit IV [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 104

 Score =  118 bits (297), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 47/98 (47%), Positives = 66/98 (67%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K    GF+L++ILT+IPF +VM     DK++  L I   A  Q+IVH+++FLHM+ K E
Sbjct: 1   MKDYATGFVLAVILTVIPFYLVMTDALGDKSLTTLVIAGFAGVQVIVHMIYFLHMNAKSE 60

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
            GW+++A++FT I+V I   G  WVMYHLN+NMM M  
Sbjct: 61  GGWNLLALVFTCILVFIVLSGVTWVMYHLNHNMMPMPH 98


>gi|238754225|ref|ZP_04615582.1| hypothetical protein yruck0001_21740 [Yersinia ruckeri ATCC 29473]
 gi|238707472|gb|EEP99832.1| hypothetical protein yruck0001_21740 [Yersinia ruckeri ATCC 29473]
          Length = 110

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 53/110 (48%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +         S+G+ K  L+GFILS+ILT+IPF +VM+G      I+  T+V  A+ Q
Sbjct: 1   MSHSTT-GHGGASHGSLKSYLIGFILSIILTVIPFVMVMQGTASHTMILA-TVVTLAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           IIVHLV+FLHM+ K E+ W+++A +FT++++AI  VGS+W+MY+LN NMM
Sbjct: 59  IIVHLVYFLHMNGKSEERWNLVAFLFTVMIIAIVVVGSLWIMYNLNINMM 108


>gi|270263562|ref|ZP_06191831.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera
           4Rx13]
 gi|270042446|gb|EFA15541.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera
           4Rx13]
          Length = 112

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 77/111 (69%), Gaps = 2/111 (1%)

Query: 1   MKYD-NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +  +  +    S+G+ K  L+GFILS+ILT+IPF +VM G      I+   +V  A+ 
Sbjct: 1   MSHSSHETSHGGASHGSVKSYLIGFILSIILTVIPFAMVMSGTASHSTILA-VVVGMAVI 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+IVHL++FLHM+T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 60  QVIVHLIYFLHMNTSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|260426875|ref|ZP_05780854.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
 gi|260421367|gb|EEX14618.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
          Length = 128

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 72/108 (66%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           +   H +GT  Q ++GF L+ ILTIIPF +VM    L +  +   I+     QIIVHLV+
Sbjct: 6   HSESHGHGTMGQLMIGFALAAILTIIPFFLVMVDTGLSRTALVGIIMGLGAVQIIVHLVY 65

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           FLH+++  E+GW+++A +F+++++ I   GS+WVM+++N NMM M  M
Sbjct: 66  FLHLNSSSEEGWTLLASMFSVVILVIVLAGSLWVMHNMNENMMPMPDM 113


>gi|77460866|ref|YP_350373.1| cytochrome C oxidase subunit IV [Pseudomonas fluorescens Pf0-1]
 gi|77384869|gb|ABA76382.1| cytochrome bo3 quinol oxidase subunit 4 [Pseudomonas fluorescens
           Pf0-1]
          Length = 111

 Score =  118 bits (296), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H+ +   +G+ K   +GFILS+ILT+IPFG+VM    L K+     ++L A+ Q
Sbjct: 1   MANAHSHDSHDAGHGSVKSYAIGFILSVILTVIPFGLVMYPT-LPKSTTLAIVLLFAVIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +IVHL +FLH+   +    +++A +FT I++ +    S+W+M+ ++  MM+
Sbjct: 60  VIVHLYYFLHLDRSIAQRNNVIAFVFTAIVIVLLVGLSLWIMFSIHTYMMA 110


>gi|306813105|ref|ZP_07447298.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli NC101]
 gi|331656484|ref|ZP_08357446.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA206]
 gi|305853868|gb|EFM54307.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli NC101]
 gi|331054732|gb|EGI26741.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia coli TA206]
          Length = 109

 Score =  117 bits (295), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + +  +  S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++V
Sbjct: 2   SHSNASSGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|312962953|ref|ZP_07777439.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
 gi|311282722|gb|EFQ61317.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
          Length = 111

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 70/111 (63%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H+ +  S+G+ K   +GFILS+ILT+IPFG+VM    L K+I  + ++  A+ Q
Sbjct: 1   MANAHSHDSHDASHGSVKSYAIGFILSVILTLIPFGLVMYPT-LPKSITLMIVLAFAVIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++VHLV+FLH+        +++A +F  +++ +    S+W+M+ ++  MM+
Sbjct: 60  VLVHLVYFLHLDRSEAQRENVIAFVFAGLVIVLLVGLSLWIMFSIHTYMMA 110


>gi|91775645|ref|YP_545401.1| cytochrome C oxidase subunit IV [Methylobacillus flagellatus KT]
 gi|91709632|gb|ABE49560.1| cytochrome bo3 quinol oxidase subunit 4 [Methylobacillus
           flagellatus KT]
          Length = 112

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 80/110 (72%), Gaps = 1/110 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + ++       + + K  ++GF+LS+ILT+IPFG++M    L  + + +TI++ A+ Q
Sbjct: 1   MSHGHV-ERAGAGHASVKSYIIGFVLSVILTVIPFGLLMFPNDLSSSTILVTILVFAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLHM+T  E  W++MA IFT+I++AI  VGS+WVM+HLN+NMM
Sbjct: 60  IVVHLVYFLHMNTSSEQSWNVMAFIFTVIILAIVVVGSLWVMFHLNHNMM 109


>gi|134095867|ref|YP_001100942.1| cytochrome o ubiquinol oxidase subunit IV [Herminiimonas
           arsenicoxydans]
 gi|133739770|emb|CAL62821.1| Cytochrome o ubiquinol oxidase protein CyoD (Ubiquinol oxidase
           chain D) [Herminiimonas arsenicoxydans]
          Length = 136

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 49/97 (50%), Positives = 67/97 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K   +GFILS+ILT IPF +VM     D     L I+  A  QI+VH+++FLHM+TK 
Sbjct: 24  SLKSYAIGFILSVILTAIPFWMVMNDVLKDSGTTGLVILGFAAVQIVVHMIYFLHMNTKS 83

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           E GWS++A+IFT+++V I   GS+WVMYH+N NMM  
Sbjct: 84  EGGWSMLALIFTVVIVVIVLAGSLWVMYHMNTNMMPG 120


>gi|332290095|ref|YP_004420947.1| cytochrome o ubiquinol oxidase subunit IV [Gallibacterium anatis
           UMN179]
 gi|330432991|gb|AEC18050.1| cytochrome o ubiquinol oxidase subunit IV [Gallibacterium anatis
           UMN179]
          Length = 110

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 47/112 (41%), Positives = 71/112 (63%), Gaps = 2/112 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M YDN H+     +G+ K  L+GF LS+ILT+IPF +VM G    K  + + I + A+ Q
Sbjct: 1   MSYDN-HDYAATEHGSVKSYLIGFGLSVILTLIPFLMVMNGSA-SKMSLLVIIAVTAVIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           +IV LV FLHM T  +  W++++ IFT I++ +    S+W+M+ LN NMM+ 
Sbjct: 59  LIVQLVCFLHMGTSEDGRWNLISFIFTAIVILLLVALSIWIMWSLNANMMAG 110


>gi|170767810|ref|ZP_02902263.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia albertii
           TW07627]
 gi|170123298|gb|EDS92229.1| cytochrome o ubiquinol oxidase, subunit IV [Escherichia albertii
           TW07627]
          Length = 109

 Score =  117 bits (295), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 48/107 (44%), Positives = 77/107 (71%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            + +     S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ Q++V
Sbjct: 2   SHSNASGGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILVMAVVQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 61  HLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|26246435|ref|NP_752474.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli CFT073]
 gi|227884562|ref|ZP_04002367.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 83972]
 gi|300988018|ref|ZP_07178498.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           45-1]
 gi|301049630|ref|ZP_07196581.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           185-1]
 gi|26106833|gb|AAN79018.1|AE016756_201 Cytochrome O ubiquinol oxidase protein cyoD [Escherichia coli
           CFT073]
 gi|227838648|gb|EEJ49114.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 83972]
 gi|300298623|gb|EFJ55008.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           185-1]
 gi|300407570|gb|EFJ91108.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           45-1]
 gi|307552335|gb|ADN45110.1| cytochrome o ubiquinol oxidase protein CyoD [Escherichia coli ABU
           83972]
 gi|315294192|gb|EFU53543.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           153-1]
          Length = 109

 Score =  117 bits (294), Expect = 4e-25,   Method: Composition-based stats.
 Identities = 51/110 (46%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N+      S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSNV--SGGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  ILVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|238920118|ref|YP_002933633.1| cytochrome o ubiquinol oxidase subunit IV [Edwardsiella ictaluri
           93-146]
 gi|238869687|gb|ACR69398.1| cytochrome o ubiquinol oxidase subunit IV, putative [Edwardsiella
           ictaluri 93-146]
          Length = 112

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 46/111 (41%), Positives = 72/111 (64%), Gaps = 2/111 (1%)

Query: 1   MKYD-NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +  +  +     +G  K  L+GFILS++LT+IPF +VM G       +   +V  A+ 
Sbjct: 1   MSHSSHETSHGGAGHGGVKSYLIGFILSIVLTVIPFAVVMSGGVAHSTTLA-VVVGMAVI 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+IVHLV FLHM+T  +  W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 60  QVIVHLVCFLHMNTSSQGRWNLVALLFTAVIIGIVVVGSLWIMYNLNINMM 110


>gi|322834054|ref|YP_004214081.1| cytochrome o ubiquinol oxidase subunit IV [Rahnella sp. Y9602]
 gi|321169255|gb|ADW74954.1| cytochrome o ubiquinol oxidase subunit IV [Rahnella sp. Y9602]
          Length = 110

 Score =  117 bits (294), Expect = 5e-25,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 76/110 (69%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    +    S+G+ K   +GFILS+ILT+IPF +VM       +++  T+V  AI Q
Sbjct: 1   MSHSAT-SHGGASHGSLKSYAIGFILSVILTVIPFAMVMTDTA-SHSLILGTVVASAIIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLVFFLHM+T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 59  IVVHLVFFLHMNTSSEERWNLVALLFTAVIIFIVVVGSLWIMYNLNLNMM 108


>gi|253687435|ref|YP_003016625.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251754013|gb|ACT12089.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 110

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    + +  S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V CA+ Q
Sbjct: 1   MSHSTT-DHSGASHGSVKSYVIGFVLSVILTVIPFSMVMSGTASHNAILF-TVVGCAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|167563463|ref|ZP_02356379.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis EO147]
          Length = 110

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 42/111 (37%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+    ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A AQ
Sbjct: 1   MAHTH-HSYGDEAHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAGAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+T     W++MA  +T++   I   G++WVM+++N NMMS
Sbjct: 59  IVVHLVYFLHMNTSSSQRWNVMAFSYTVLTALILIFGTLWVMHNVNMNMMS 109


>gi|300937043|ref|ZP_07151909.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           21-1]
 gi|300457874|gb|EFK21367.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           21-1]
          Length = 109

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 50/110 (45%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N+      S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSNV--SGGASHGSVKTYMTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|150376510|ref|YP_001313106.1| cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium medicae
           WSM419]
 gi|150031057|gb|ABR63173.1| Cytochrome o ubiquinol oxidase subunit IV [Sinorhizobium medicae
           WSM419]
          Length = 133

 Score =  117 bits (293), Expect = 6e-25,   Method: Composition-based stats.
 Identities = 49/99 (49%), Positives = 67/99 (67%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  + GFILS++LT IPF +VM        +    I+     QI+VH++FFLHM+T+ 
Sbjct: 28  TLKSYVTGFILSVLLTAIPFWLVMADVLESAILTAAIIMALGAIQIVVHMIFFLHMNTRS 87

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           E GW++MA+IFTI++VAI   GS+WVM+HLN NMM M  
Sbjct: 88  EGGWTMMALIFTIVLVAIALSGSLWVMHHLNTNMMPMSP 126


>gi|227113457|ref|ZP_03827113.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. brasiliensis PBR1692]
 gi|227327520|ref|ZP_03831544.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           carotovorum subsp. carotovorum WPP14]
          Length = 110

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 78/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    + +  S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V CA+ Q
Sbjct: 1   MSHSTT-DHSGASHGSVKSYVIGFVLSVILTVIPFSMVMSGTASHSAILF-TVVGCAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|17224969|gb|AAL37191.1|AF321090_3 cytochrome o ubiquinol oxidase D [Pseudomonas putida]
          Length = 111

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 68/111 (61%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H+ +   +G+ K   +GF LS+ILT+IPFG+VM    L K+     ++L A+ Q
Sbjct: 1   MANAHSHDSHDAGHGSVKSYAIGFSLSVILTVIPFGLVMYPT-LPKSTTLAIVLLFAVIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +IVHL +FLH+   +    +++A +FT I++ +    S+W+M+ ++  MM+
Sbjct: 60  VIVHLYYFLHLDRSIAQRNNVIAFVFTAIVIVLLVGLSLWIMFSIHTYMMA 110


>gi|50120079|ref|YP_049246.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium
           atrosepticum SCRI1043]
 gi|261822515|ref|YP_003260621.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium wasabiae
           WPP163]
 gi|49610605|emb|CAG74050.1| cytochrome O ubiquinol oxidase subunit IV [Pectobacterium
           atrosepticum SCRI1043]
 gi|261606528|gb|ACX89014.1| cytochrome o ubiquinol oxidase subunit IV [Pectobacterium wasabiae
           WPP163]
          Length = 110

 Score =  117 bits (293), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 46/110 (41%), Positives = 77/110 (70%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    +    S+G+ K  ++GF+LS+ILT+IPF +VM G      I+  T+V CA+ Q
Sbjct: 1   MSHSTT-DHAGASHGSVKSYVIGFVLSVILTVIPFSMVMSGTASHNAILF-TVVGCAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++F ++++AI  VGS+W+M   ++NMM
Sbjct: 59  ILVHLVYFLHLNTSSEERWNVVALVFAVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|300947920|ref|ZP_07162068.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           116-1]
 gi|300452520|gb|EFK16140.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           116-1]
          Length = 109

 Score =  116 bits (292), Expect = 7e-25,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 77/110 (70%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+I F +VM G      ++  TI+  A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKTYMTGFILSIILTVISFWMVMTGAA-SPAVILGTILAMAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++VHLV FLHM+TK ++GW++ A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 58  VLVHLVCFLHMNTKSDEGWNMTAFVFTVLIIAILVVGSIWIMWNLNYNMM 107


>gi|70732357|ref|YP_262113.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens
           Pf-5]
 gi|68346656|gb|AAY94262.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           Pf-5]
          Length = 109

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 67/107 (62%), Gaps = 1/107 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           N H+ +   +G+ K   +GFILS+ILT+IPFG+VM    L K++    ++  A+ Q++VH
Sbjct: 3   NTHSHDEAGHGSVKSYAIGFILSVILTLIPFGLVMYPS-LPKDVTLWIVLAFAVIQVLVH 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LV+FLH+        +++A IF  +++ +    S+W+M+ ++  MM+
Sbjct: 62  LVYFLHLDRSEAQRNNVVAFIFAALVIVLLVGLSLWIMFSIHTVMMA 108


>gi|73538718|ref|YP_299085.1| cytochrome C oxidase subunit IV [Ralstonia eutropha JMP134]
 gi|72122055|gb|AAZ64241.1| Prokaryotic Cytochrome C oxidase subunit IV [Ralstonia eutropha
           JMP134]
          Length = 130

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 67/99 (67%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           + +    + GF+LS+ILT IPF +VM   F   +   + ++     QI+VH+++FLHM+ 
Sbjct: 29  HISMSGYVTGFVLSVILTTIPFWLVMGKVFEKSSTTAILLLALGAVQIVVHMIYFLHMNA 88

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           K E GW+++A++FT+++V I   G++WVM+HLN+NMM  
Sbjct: 89  KSEGGWNMLALMFTLVLVVITLSGTLWVMFHLNSNMMPG 127


>gi|300722000|ref|YP_003711280.1| cytochrome o ubiquinol oxidase subunit IV [Xenorhabdus nematophila
           ATCC 19061]
 gi|297628497|emb|CBJ89064.1| cytochrome o ubiquinol oxidase, subunit IV [Xenorhabdus nematophila
           ATCC 19061]
          Length = 110

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 47/110 (42%), Positives = 80/110 (72%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + N  + +  S+G+ K  ++GF+LS+ILT+IPF +VM+G      I+  T++  A+ Q
Sbjct: 1   MSHPNT-SHSGASHGSFKTYMIGFVLSVILTVIPFWMVMEGTASHSTILL-TVLAMAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VH ++FLHM+T  E+ W+++A++FT++++ I  VGS+W+MY+LN NMM
Sbjct: 59  IVVHFIYFLHMNTSSEERWNLVALLFTLLVIVIVVVGSLWIMYNLNINMM 108


>gi|224826961|ref|ZP_03700059.1| cytochrome o ubiquinol oxidase subunit IV [Lutiella nitroferrum
           2002]
 gi|224600794|gb|EEG06979.1| cytochrome o ubiquinol oxidase subunit IV [Lutiella nitroferrum
           2002]
          Length = 107

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 38/111 (34%), Positives = 63/111 (56%), Gaps = 4/111 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H     S+G+ K  L GF+LS+ILT+IPF +VM G     + +  TI   A+ Q
Sbjct: 1   MSQAHDH---AASHGSVKSYLTGFVLSVILTVIPFWLVMNGNLNPHDTLL-TIAGFAVVQ 56

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHL +FLH+    E   + +A +FT +++ +    S+W+++  +  MM 
Sbjct: 57  ILVHLKYFLHLDFTTEGRVNTLAFLFTALVIVLLVGLSVWIIFSADALMMP 107


>gi|149926920|ref|ZP_01915179.1| Prokaryotic Cytochrome C oxidase subunit IV [Limnobacter sp.
           MED105]
 gi|149824472|gb|EDM83690.1| Prokaryotic Cytochrome C oxidase subunit IV [Limnobacter sp.
           MED105]
          Length = 133

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/104 (46%), Positives = 71/104 (68%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + +   +GF+L++ILT+IPF +VM G F       L I+     Q++VH+++FLHM++K 
Sbjct: 24  SMRDYTIGFVLAVILTVIPFALVMGGVFESSTTTALVILGLGAVQMVVHMIYFLHMNSKS 83

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           E GWS++AM+FT+I+V I  VGS+WVMYHLN NMM      +I 
Sbjct: 84  EGGWSMLAMMFTLIIVVITLVGSIWVMYHLNTNMMPGMNHEAIE 127


>gi|295691073|ref|YP_003594766.1| cytochrome o ubiquinol oxidase subunit IV [Caulobacter segnis ATCC
           21756]
 gi|295432976|gb|ADG12148.1| cytochrome o ubiquinol oxidase subunit IV [Caulobacter segnis ATCC
           21756]
          Length = 129

 Score =  116 bits (291), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 75/110 (68%), Gaps = 2/110 (1%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
             ++G+ K  ++GF+L++ILT IPF +VM        +  + ++  A+ Q++VH+++FLH
Sbjct: 19  GGAHGSLKDYVIGFVLAVILTAIPFWLVMGNVLPTAQMTAVAVMGLAVIQVLVHMIYFLH 78

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM--EGMRSI 118
           M+++ E GW+++A++FT+I+V I   GS+WVM++LN +MM      M+ +
Sbjct: 79  MNSRSEGGWTLLALMFTLILVVITLSGSLWVMHNLNTHMMPTMAHDMQQM 128


>gi|293392553|ref|ZP_06636873.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera DSM
           4582]
 gi|291424955|gb|EFE98164.1| cytochrome o ubiquinol oxidase subunit IV [Serratia odorifera DSM
           4582]
          Length = 112

 Score =  116 bits (290), Expect = 1e-24,   Method: Composition-based stats.
 Identities = 48/111 (43%), Positives = 76/111 (68%), Gaps = 2/111 (1%)

Query: 1   MKYD-NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +  +  +    S+ + K  ++GFILS+ILT+IPF +VM G      I+   +V  A+ 
Sbjct: 1   MSHSSHETSHGGASHSSVKSYVIGFILSVILTVIPFSMVMSGTASHATILA-VVVGMAVI 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+IVHLV+FLHM+T  E+ W+++A++FT +++ I  VGS+W+MY+LN NMM
Sbjct: 60  QVIVHLVYFLHMNTSSEERWNLVALLFTAMIIGIVVVGSLWIMYNLNINMM 110


>gi|27375263|ref|NP_766792.1| cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobium japonicum
           USDA 110]
 gi|27348399|dbj|BAC45417.1| cytochrome O ubiquinol oxidase subunit IV [Bradyrhizobium japonicum
           USDA 110]
          Length = 126

 Score =  116 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 53/103 (51%), Positives = 74/103 (71%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T    ++GF+LS++LT IPF +VM G    K I  L I+  A+ QI+VH+++FLHM+TK 
Sbjct: 23  TFSGYMLGFVLSVVLTAIPFWLVMSGTLPSKQITALVIMAFAVVQIVVHMIYFLHMNTKS 82

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           E+GWS+MA+IFTI+MV I   GS+WVM HLN+NMM +  M  +
Sbjct: 83  ENGWSMMALIFTIVMVVIALSGSLWVMNHLNSNMMPIHQMSGM 125


>gi|187930227|ref|YP_001900714.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|241664394|ref|YP_002982754.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|309782937|ref|ZP_07677657.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia sp.
           5_7_47FAA]
 gi|187727117|gb|ACD28282.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12J]
 gi|240866421|gb|ACS64082.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia pickettii 12D]
 gi|308918361|gb|EFP64038.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia sp.
           5_7_47FAA]
          Length = 122

 Score =  115 bits (288), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 43/97 (44%), Positives = 72/97 (74%), Gaps = 1/97 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT IPF +VM G +  + ++ +T++  A+ QI+VHL++FLH+    
Sbjct: 27  TVKGYLIGFVLAVILTAIPFKMVMDGGYSHQTVL-VTVMALAVVQIVVHLIYFLHLDGSS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
              W++MA +FT++++AI  VGS+WVM+++N NMM+M
Sbjct: 86  AQRWNVMAFLFTLLILAIVVVGSLWVMHNMNANMMTM 122


>gi|294012087|ref|YP_003545547.1| cytochrome o ubiquinol oxidase operon protein cyoD [Sphingobium
           japonicum UT26S]
 gi|292675417|dbj|BAI96935.1| cytochrome o ubiquinol oxidase operon protein cyoD [Sphingobium
           japonicum UT26S]
          Length = 139

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 51/115 (44%), Positives = 74/115 (64%), Gaps = 1/115 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ H     ++G+    ++GF LS ILT IPF +VM G   D  +  + I+  A  Q+
Sbjct: 7   SHDHGH-HEEGAHGSFGSYMIGFGLSAILTAIPFWLVMSGALNDPQLTGVVIMGFAAVQV 65

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           +VH+++FLHM+T+VE GWS MAM+ T+++V I   GS+WVMYHLN NMM    M 
Sbjct: 66  VVHMIYFLHMNTRVEGGWSFMAMMLTVVLVVIVLSGSLWVMYHLNANMMPHAQME 120


>gi|148253544|ref|YP_001238129.1| cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobium sp.
           BTAi1]
 gi|146405717|gb|ABQ34223.1| cytochrome bo3 quinol oxidase subunit 4 [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 55/116 (47%), Positives = 76/116 (65%), Gaps = 1/116 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            + + H+      GT++  L+GF  S++LT IPF +VM G  LDK    L I+  A  Q+
Sbjct: 5   AHAHAHDSADAHAGTRQGQLIGFGASVVLTAIPFLLVMHGT-LDKQATALIIMAFAAVQV 63

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
           +VH++FFLHM+TK E GW++MA+IFTIIMV I   GS+WVM+HL  NMM +  M  
Sbjct: 64  VVHMIFFLHMNTKAEGGWTMMALIFTIIMVVIALSGSLWVMHHLTTNMMPVHEMGQ 119


>gi|17546580|ref|NP_519982.1| transmembrane cytochrome O ubiquinol oxidase subunit IV [Ralstonia
           solanacearum GMI1000]
 gi|17428879|emb|CAD15563.1| probable transmembrane cytochrome o ubiquinol oxidase (subunit iv)
           oxidoreductase protein [Ralstonia solanacearum GMI1000]
          Length = 125

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 58/107 (54%), Gaps = 1/107 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H      +G+ +   VG +LS+ LT+  F  VM G    +  +   + LC +AQ++V LV
Sbjct: 10  HAGETAPHGSLRGYTVGLLLSVALTLAAFATVMTGALPARLALAGMVGLC-VAQLLVQLV 68

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           +FLH+ T      +    + T +++AI   GS+WVM++ N NMM  +
Sbjct: 69  YFLHLGTGPGQRGNTAIFVCTGLLIAIVVAGSLWVMHNANENMMPTD 115


>gi|260773172|ref|ZP_05882088.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio metschnikovii CIP
           69.14]
 gi|260612311|gb|EEX37514.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio metschnikovii CIP
           69.14]
          Length = 112

 Score =  114 bits (287), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 46/113 (40%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M++         ++G+ K+ L+GF+ S++LT+IPF +VM           + I++CA+AQ
Sbjct: 1   MEHSYEQTHGGQAHGSVKEYLLGFLYSVLLTLIPFAMVMAD-IGSPTTKVVVILICAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           I+V LVFFLHM+T  E  W+++  +F++++VAI  VGSMW+M HLN+NM+   
Sbjct: 60  ILVQLVFFLHMNTSSEQAWNVITAVFSVVIVAIVLVGSMWIMQHLNHNMLMGH 112


>gi|167570631|ref|ZP_02363505.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis C6786]
          Length = 110

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+    ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A  Q
Sbjct: 1   MAHTH-HSHGDEAHGTVGGYIAGFMLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAGVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+T     W++MA  +T++   I   G++WVM+++N NMMS
Sbjct: 59  IVVHLVYFLHMNTSSSQRWNVMAFSYTVLTALILIFGTLWVMHNVNMNMMS 109


>gi|94314709|ref|YP_587918.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
 gi|93358561|gb|ABF12649.1| cytochrome o ubiquinol oxidase subunit IV [Cupriavidus
           metallidurans CH34]
          Length = 121

 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 65/108 (60%), Gaps = 1/108 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
            +  S+G+ +  L+G+ LS++LT++ FG VM G       + + ++LC IAQ++V LVFF
Sbjct: 8   AHESSHGSIRSHLIGYGLSVVLTLVSFGAVMSGVLPPGYGLAVIVLLC-IAQLLVQLVFF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMR 116
           LH+  +     +      T+ ++AI   GS+WVM++ N NMM M+ M 
Sbjct: 67  LHLGPRKGQRGNTAIFACTVFLIAIVVSGSLWVMHNANLNMMPMQSMP 114


>gi|119387827|ref|YP_918861.1| cytochrome C oxidase subunit IV [Paracoccus denitrificans PD1222]
 gi|461330|emb|CAA55035.1| cytochrome ba(3) [Paracoccus denitrificans]
 gi|119378402|gb|ABL73165.1| cytochrome ba3 quinol oxidase subunit 4 [Paracoccus denitrificans
           PD1222]
          Length = 127

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 46/104 (44%), Positives = 72/104 (69%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           +    + GF+LS+ILT IPFG+VM G F  + +  +T++  A+ QI+VH+V+FLHM+ K 
Sbjct: 20  SHASYIKGFLLSVILTAIPFGLVMAGGFESRALTAVTVIGFAVVQILVHMVYFLHMNGKQ 79

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           E+GW++++ IFT+++V I   GS+WVMYH+N NMM       + 
Sbjct: 80  EEGWTMLSTIFTVVVVVILLAGSLWVMYHMNTNMMPQMDHELMQ 123


>gi|299065536|emb|CBJ36707.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           CMR15]
          Length = 121

 Score =  114 bits (286), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 72/109 (66%), Gaps = 1/109 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
              + H      + T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI
Sbjct: 12  ADAHGHATGGAGHATVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMGLAVVQI 70

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL++FLH+       W++MA +FT++++ I  VGS+WVM+++N NMM
Sbjct: 71  VVHLIYFLHLDGSSAQRWNVMAFLFTLLILLIVIVGSLWVMHNMNVNMM 119


>gi|186472798|ref|YP_001860140.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184195130|gb|ACC73094.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 114

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 37/104 (35%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
                ++G+    ++GF+LS+ILT   FG+V+ G+      +   I    + QI+VHLV+
Sbjct: 11  AHADENHGSFGSYMIGFVLSVILTAAAFGVVLAGWATGTQALYA-IAGLGLVQIVVHLVY 69

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           FLHM+T     W++ A  FT++   I   G++WVM++++ NMMS
Sbjct: 70  FLHMNTSSGQRWNVTAFAFTVLTAVIVIGGTLWVMHNVSMNMMS 113


>gi|242240301|ref|YP_002988482.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech703]
 gi|242132358|gb|ACS86660.1| cytochrome o ubiquinol oxidase subunit IV [Dickeya dadantii Ech703]
          Length = 110

 Score =  114 bits (286), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 49/110 (44%), Positives = 83/110 (75%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + + H+ +  S+G+ K  L+GF+LS+ILT+IPF +VM G     +I+ LT++ CA+ Q
Sbjct: 1   MSH-SAHDHSGASHGSVKSYLMGFVLSIILTVIPFSMVMNGT-TAHSIILLTVLGCAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLH++T  E+ W+++A++FT++++AI  VGS+W+M   ++NMM
Sbjct: 59  ILVHLVYFLHLNTASEERWNVVAIVFTVLIIAIVVVGSIWIMMSAHHNMM 108


>gi|83719004|ref|YP_442317.1| ubiquinol oxidase subunit IV [Burkholderia thailandensis E264]
 gi|167619297|ref|ZP_02387928.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis Bt4]
 gi|257138514|ref|ZP_05586776.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
 gi|83652829|gb|ABC36892.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
          Length = 110

 Score =  114 bits (285), Expect = 5e-24,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 67/111 (60%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +       ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A  Q
Sbjct: 1   MAHSHP-THGDEAHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAAVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+T     W++MA  +T +   I   G++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNTSSSQRWNVMAFSYTALTALILIFGTVWVMHNVSMNMMS 109


>gi|53719988|ref|YP_108974.1| putative cytochrome o ubiquinol oxidase protein [Burkholderia
           pseudomallei K96243]
 gi|53725262|ref|YP_102390.1| ubiquinol oxidase subunit IV [Burkholderia mallei ATCC 23344]
 gi|67641797|ref|ZP_00440564.1| ubiquinol oxidase, subunit IV [Burkholderia mallei GB8 horse 4]
 gi|76809313|ref|YP_334220.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1710b]
 gi|121598783|ref|YP_993720.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124385820|ref|YP_001028822.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126440812|ref|YP_001059741.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 668]
 gi|126450472|ref|YP_001081267.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|126454810|ref|YP_001067026.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|134277478|ref|ZP_01764193.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|167001101|ref|ZP_02266902.1| ubiquinol oxidase, subunit IV [Burkholderia mallei PRL-20]
 gi|167720491|ref|ZP_02403727.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei DM98]
 gi|167744575|ref|ZP_02417349.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 14]
 gi|167816684|ref|ZP_02448364.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 91]
 gi|167846591|ref|ZP_02472099.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei B7210]
 gi|167895177|ref|ZP_02482579.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 7894]
 gi|167903561|ref|ZP_02490766.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei NCTC
           13177]
 gi|167911809|ref|ZP_02498900.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 112]
 gi|167919811|ref|ZP_02506902.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei BCC215]
 gi|217420541|ref|ZP_03452046.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|226199882|ref|ZP_03795432.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237813135|ref|YP_002897586.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|242314110|ref|ZP_04813126.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|254178120|ref|ZP_04884775.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|254184265|ref|ZP_04890855.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|254191300|ref|ZP_04897804.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|254195702|ref|ZP_04902128.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|254199289|ref|ZP_04905655.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|254205599|ref|ZP_04911951.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|254258458|ref|ZP_04949512.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|254296927|ref|ZP_04964380.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|254357761|ref|ZP_04974034.1| ubiquinol oxidase, subunit IV [Burkholderia mallei 2002721280]
 gi|52210402|emb|CAH36383.1| putative cytochrome o ubiquinol oxidase protein [Burkholderia
           pseudomallei K96243]
 gi|52428685|gb|AAU49278.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|76578766|gb|ABA48241.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710b]
 gi|121227593|gb|ABM50111.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124293840|gb|ABN03109.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126220305|gb|ABN83811.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei 668]
 gi|126228452|gb|ABN91992.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|126243342|gb|ABO06435.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|134251128|gb|EBA51207.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|147748885|gb|EDK55959.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|147753042|gb|EDK60107.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|148026888|gb|EDK84909.1| ubiquinol oxidase, subunit IV [Burkholderia mallei 2002721280]
 gi|157807091|gb|EDO84261.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|157938972|gb|EDO94642.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|160699159|gb|EDP89129.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|169652447|gb|EDS85140.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|184214796|gb|EDU11839.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|217395953|gb|EEC35970.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|225927938|gb|EEH23975.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237504955|gb|ACQ97273.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|238522785|gb|EEP86227.1| ubiquinol oxidase, subunit IV [Burkholderia mallei GB8 horse 4]
 gi|242137349|gb|EES23751.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|243063053|gb|EES45239.1| ubiquinol oxidase, subunit IV [Burkholderia mallei PRL-20]
 gi|254217147|gb|EET06531.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
          Length = 110

 Score =  114 bits (285), Expect = 6e-24,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +    ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A  Q
Sbjct: 1   MAHSHP-SHGDEAHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAAVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+T     W++MA  +T++   I   G++WVM+++  NMMS
Sbjct: 59  IVVHLVYFLHMNTSSSQRWNVMAFSYTVLTALILIFGTVWVMHNVGMNMMS 109


>gi|332532049|ref|ZP_08407932.1| cytochrome O ubiquinol oxidase, subunit IV [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332038390|gb|EGI74834.1| cytochrome O ubiquinol oxidase, subunit IV [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 118

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 42/118 (35%), Positives = 66/118 (55%), Gaps = 9/118 (7%)

Query: 1   MKYDNIH-------NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI 53
           M +   H       + +  S+G+ K  L+GF+LS+ILT IPF +VM+G F  K     +I
Sbjct: 1   MSHSETHALKQTQSDHHDESHGSVKTYLIGFVLSVILTAIPFYMVMEGDF-SKATTLWSI 59

Query: 54  VLCAIAQIIVHLVFFLHMSTKVE-DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           V  AI QI VHL +FLH++   E    S  + +F+ +++ +    S+W++Y  N  MM
Sbjct: 60  VTLAIVQIWVHLKYFLHLNFTTEDGRASTFSFLFSALIIVMVVGLSVWIIYESNAMMM 117


>gi|167581212|ref|ZP_02374086.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis TXDOH]
          Length = 108

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 38/103 (36%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
               ++GT    + GF+LS++LT   FG+VM G    +  + +++ + A  QI+VHLV+F
Sbjct: 6   HGDEAHGTVGGYIAGFVLSVLLTAASFGLVMGGVLPPREAL-VSLAVLAAVQIVVHLVYF 64

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LHM+T     W++MA  +T++   I   G++WVM++++ NMMS
Sbjct: 65  LHMNTSSSQRWNVMAFSYTVLTALILIFGTVWVMHNVSMNMMS 107


>gi|254428964|ref|ZP_05042671.1| cytochrome o ubiquinol oxidase subunit IV [Alcanivorax sp. DG881]
 gi|196195133|gb|EDX90092.1| cytochrome o ubiquinol oxidase subunit IV [Alcanivorax sp. DG881]
          Length = 118

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K+   GF+L++ILT+IPF +VM           + I+  A+ QI+VH+VFFLHM+   
Sbjct: 19  SLKEYATGFVLAVILTVIPFWLVMGDVLESSTTTVMVILGFALVQIVVHMVFFLHMNFHS 78

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           E GW+++A+IFT+I+V I   GS+WVM++LN NMM  
Sbjct: 79  EGGWNMLALIFTLILVFITLAGSLWVMHNLNVNMMPG 115


>gi|221067298|ref|ZP_03543403.1| cytochrome o ubiquinol oxidase subunit IV [Comamonas testosteroni
           KF-1]
 gi|220712321|gb|EED67689.1| cytochrome o ubiquinol oxidase subunit IV [Comamonas testosteroni
           KF-1]
          Length = 141

 Score =  113 bits (284), Expect = 7e-24,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 67/103 (65%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T    + GFIL++ILT IPF +VM     D+      + L A+ Q++VH+V+FLHM+ K+
Sbjct: 22  TMGDYVKGFILAVILTAIPFYLVMNNVITDRTTAVAVLGLFAVIQVLVHMVYFLHMNGKI 81

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           + GW++++ IFT+I +AI   G++WVM+H+N NMM    M   
Sbjct: 82  QGGWTMLSTIFTVIFLAIAISGTLWVMFHMNTNMMPGHEMHQA 124


>gi|209518753|ref|ZP_03267568.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. H160]
 gi|209500795|gb|EEA00836.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. H160]
          Length = 113

 Score =  113 bits (283), Expect = 9e-24,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            ++     +   +G+      GF+LS+ILT+  F IVM G    ++ +   I   A  QI
Sbjct: 4   SHNAHGAHSEGGHGSFGSYTAGFVLSVILTVAAFAIVMTGTLTGQSALFA-IAGLAFVQI 62

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLVFFLHM+T     W++ A  FT +   I   G++WVM++++ NMMS
Sbjct: 63  LVHLVFFLHMNTSSSQRWNVTAFAFTALTAVIVIGGTLWVMHNVSMNMMS 112


>gi|85058642|ref|YP_454344.1| cytochrome o ubiquinol oxidase subunit IV [Sodalis glossinidius
           str. 'morsitans']
 gi|84779162|dbj|BAE73939.1| cytochrome o ubiquinol oxidase subunit IV [Sodalis glossinidius
           str. 'morsitans']
          Length = 110

 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 80/111 (72%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +       S G+ K  L+GFILS+ILT+IPF IVM+G    ++++   +V+CA+ Q
Sbjct: 1   MSHASA-GHTGASQGSHKSYLIGFILSIILTVIPFAIVMQGSA-SESMLIAVLVICAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLH+ST  E  W+++A +F ++++AI  VGS+W+M++LN+N+M 
Sbjct: 59  IVVHLVYFLHLSTSSEQQWNLIAFVFAVMIIAILVVGSLWIMWYLNHNLMG 109


>gi|264678283|ref|YP_003278190.1| cytochrome C oxidase subunit IV [Comamonas testosteroni CNB-2]
 gi|299532079|ref|ZP_07045473.1| cytochrome C oxidase subunit IV [Comamonas testosteroni S44]
 gi|262208796|gb|ACY32894.1| cytochrome C oxidase subunit IV [Comamonas testosteroni CNB-2]
 gi|298719741|gb|EFI60704.1| cytochrome C oxidase subunit IV [Comamonas testosteroni S44]
          Length = 141

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 44/103 (42%), Positives = 67/103 (65%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T    + GFIL++ILT IPF +VM     D+      + L A+ Q+IVH+V+FLHM+ K+
Sbjct: 22  TMGDYVKGFILAVILTAIPFYLVMNNIITDRTTAVAVLGLFAVIQVIVHMVYFLHMNGKI 81

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSI 118
           + GW++++ IFT+I +AI   G++WVM+H+N NMM    M   
Sbjct: 82  QGGWTMLSTIFTVIFLAIAISGTLWVMFHMNTNMMPGHEMHQA 124


>gi|258541197|ref|YP_003186630.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256632275|dbj|BAH98250.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256635332|dbj|BAI01301.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256638387|dbj|BAI04349.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256641441|dbj|BAI07396.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256644496|dbj|BAI10444.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256647551|dbj|BAI13492.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256650604|dbj|BAI16538.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256653595|dbj|BAI19522.1| cytochrome o ubiquinol oxidase subunit IV [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 137

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 62/108 (57%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +   + +  S+G+    ++GF+L+++LT++ FG+VM         +       A+ Q++V
Sbjct: 30  NPHTSSSGESHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAV-SALALVQVLV 88

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLHM    E  W+ M  +FT+  VAI  VGS+++M +   +MMS
Sbjct: 89  HLHYFLHMGGDSEQRWNNMCFVFTVAFVAILIVGSVFIMNNTALHMMS 136


>gi|163857014|ref|YP_001631312.1| cytochrome 0 ubiquinol oxidase [Bordetella petrii DSM 12804]
 gi|163260742|emb|CAP43044.1| Predicted cytochrome 0 ubiquinol oxidase [Bordetella petrii]
          Length = 120

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 67/114 (58%), Gaps = 5/114 (4%)

Query: 1   MKYDN----IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLC 56
           M +D      H  +  ++GT K  LVGF LS++LT+  FG+VM G       M   IVLC
Sbjct: 1   MSHDTIAAADHGHDDAAHGTLKSYLVGFGLSILLTLASFGLVMSGAVPRSLAMPGIIVLC 60

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +AQ++V LV+FLHM        ++ A +F + ++AI   GS WV++++N NMM
Sbjct: 61  -VAQLLVQLVYFLHMGASRSQRDNLSAFVFAVFVIAIIVGGSAWVLHNMNANMM 113


>gi|190573374|ref|YP_001971219.1| putative transmembrane quinol oxidase subunit 4 [Stenotrophomonas
           maltophilia K279a]
 gi|254523523|ref|ZP_05135578.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
 gi|30351180|gb|AAP22951.1| cytochrome oxidase subunit IV [Rhizobium arachis]
 gi|190011296|emb|CAQ44909.1| putative transmembrane quinol oxidase subunit 4 [Stenotrophomonas
           maltophilia K279a]
 gi|219721114|gb|EED39639.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
          Length = 113

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 73/108 (67%), Gaps = 1/108 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + + H     S+GT K  L+GF+L+++LT+IPF +VM G F  + +  + I + A+ Q++
Sbjct: 6   HAHDHGTGGESHGTVKSYLIGFVLAVVLTVIPFWMVMSGDF-SRTVNGVVIAITAVLQML 64

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VHLVFFLH+    E  W++ A  FT++++ I  VG++WVM+++N +MM
Sbjct: 65  VHLVFFLHLDRSSESRWNVNAAAFTVVVIGIIVVGTLWVMHNMNVHMM 112


>gi|194364921|ref|YP_002027531.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
 gi|194347725|gb|ACF50848.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
          Length = 113

 Score =  112 bits (282), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 42/108 (38%), Positives = 73/108 (67%), Gaps = 1/108 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + + H     S+G+ K  L+GF+L+++LT+IPF +VM G F  + +  + I + A+ Q++
Sbjct: 6   HAHDHAAGGESHGSVKSYLIGFVLAVVLTVIPFWMVMSGDF-SRTVNGVVIAITAVLQML 64

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VHLVFFLH+    E  W++ A  FT++++ I  VG++WVM+++N +MM
Sbjct: 65  VHLVFFLHLDRSSESRWNVNAAAFTVVVIGIIVVGTLWVMHNMNVHMM 112


>gi|229592521|ref|YP_002874640.1| cytochrome C oxidase (ubiquinol oxidase) subunit IV [Pseudomonas
           fluorescens SBW25]
 gi|229364387|emb|CAY52169.1| cytochrome C oxidase (ubiquinol oxidase) subunit IV [Pseudomonas
           fluorescens SBW25]
          Length = 113

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            + + H+ +  S+G+ K   +GFILS+ILT+IPFG+VM    L K+I  + ++  A+ Q+
Sbjct: 4   AHSHDHDSHDASHGSVKSYAIGFILSVILTLIPFGLVMYPT-LPKSITLMIVLAFAVIQV 62

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLH+    E   +++A +F  +++ +    S+W+M+ ++  MM+
Sbjct: 63  LVHLVYFLHLDRSKEQRDNVIAFVFAGLVILLLVGLSIWIMFSIHTFMMA 112


>gi|114327937|ref|YP_745094.1| cytochrome O ubiquinol oxidase protein cyoD [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316111|gb|ABI62171.1| cytochrome O ubiquinol oxidase protein cyoD [Granulibacter
           bethesdensis CGDNIH1]
          Length = 126

 Score =  112 bits (281), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 65/111 (58%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMH--SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAI 58
           M   + H  + H  S+G+    ++GFILS+ILT   F IV      +  I+       A+
Sbjct: 1   MATAHAHGASDHGSSHGSVGSYIIGFILSVILTAAAFLIVAYKLVPEHLILPGV-AALAV 59

Query: 59  AQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
            QI+VHLVFFLHM+   E  W++ A +F+++++ I   GS+W+MY+L + M
Sbjct: 60  IQILVHLVFFLHMNASSEQRWNVTAFVFSVVVLLILVSGSIWIMYNLTSRM 110


>gi|83747511|ref|ZP_00944549.1| CyoD [Ralstonia solanacearum UW551]
 gi|83725825|gb|EAP72965.1| CyoD [Ralstonia solanacearum UW551]
          Length = 122

 Score =  112 bits (280), Expect = 2e-23,   Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+    
Sbjct: 27  SVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W++MA +FT++++AI  VGS+WVM+++N NMM
Sbjct: 86  AQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMM 120


>gi|113867651|ref|YP_726140.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
 gi|113526427|emb|CAJ92772.1| bo3-type quinol oxidase, subunit IV [Ralstonia eutropha H16]
          Length = 125

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 33/109 (30%), Positives = 59/109 (54%), Gaps = 1/109 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           ++H     ++G+ +   +G +LS+ LT+  F  VM G    +  + L + LC +AQ++V 
Sbjct: 8   SVHADQPAAHGSVRSYTIGLLLSVALTMASFAAVMTGSLSTQAAIALVVGLC-VAQLLVQ 66

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           LV+FLH+ T      +      T  ++ I   GS+WVM++ + NMM  +
Sbjct: 67  LVYFLHLGTGPGQRGNTAIFACTGFLIVIVVAGSLWVMHNADINMMPTD 115


>gi|296156344|ref|ZP_06839183.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. Ch1-1]
 gi|295893850|gb|EFG73629.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp. Ch1-1]
          Length = 110

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 46/109 (42%), Positives = 71/109 (65%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+     VGFILS++LT+  FG+VM G    ++ +   I   A+ QI+
Sbjct: 2   DHSHNAHAGESHGSLGSYTVGFILSVVLTVAAFGLVMTGKLTGEHALFA-IAGLALVQIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLVFFLHM+T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLVFFLHMNTSSEQRWNVMAFAFTLLTAIIVIGGTLWVMHNVSMHMMS 109


>gi|190576212|ref|YP_001974057.1| putative cytochrome O ubiquinol oxidase subunit IV
           [Stenotrophomonas maltophilia K279a]
 gi|190014134|emb|CAQ47773.1| putative cytochrome O ubiquinol oxidase subunit IV
           [Stenotrophomonas maltophilia K279a]
          Length = 110

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 70/110 (63%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    +   +++G+ K  L+GF+L  +LT++PF +VM    L + +    +V  A+AQ
Sbjct: 1   MAHVET-SRAGNAHGSTKSYLIGFVLCALLTVVPFALVMNP-LLSRPLTLFLLVGFAVAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+V LV+FLHM  K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 59  ILVQLVYFLHMDRKSEGGWNLASFVFTLVILFIIVALSVWIIWSMHYHMM 108


>gi|152968964|ref|YP_001334073.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206576416|ref|YP_002240092.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella pneumoniae
           342]
 gi|238893376|ref|YP_002918110.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           NTUH-K2044]
 gi|262042465|ref|ZP_06015624.1| cytochrome o ubiquinol oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936842|ref|YP_003440901.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella variicola
           At-22]
 gi|330011525|ref|ZP_08307111.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella sp. MS 92-3]
 gi|150953813|gb|ABR75843.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
 gi|206565474|gb|ACI07250.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella pneumoniae
           342]
 gi|238545692|dbj|BAH62043.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040169|gb|EEW41281.1| cytochrome o ubiquinol oxidase [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891551|gb|ADC59869.1| cytochrome o ubiquinol oxidase subunit IV [Klebsiella variicola
           At-22]
 gi|328534142|gb|EGF60777.1| cytochrome o ubiquinol oxidase, subunit IV [Klebsiella sp. MS 92-3]
          Length = 109

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 52/110 (47%), Positives = 80/110 (72%), Gaps = 3/110 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +   H+    S+G+ K  + GFILS+ILT+IPF +VM G      ++  TI++ A+ Q
Sbjct: 1   MSHSTDHS--GASHGSVKSYMTGFILSIILTVIPFAMVMSGSA-SHAVILGTILVTAVVQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHLV+FLHM++K ++GW++ A IFT+I++AI  VGS+W+M++LN NMM
Sbjct: 58  IVVHLVYFLHMNSKSDEGWNLTAFIFTVIIIAIVVVGSIWIMWNLNYNMM 107


>gi|312961436|ref|ZP_07775939.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
 gi|311284331|gb|EFQ62909.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           WH6]
          Length = 112

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           K  +IH+    S+G+ +  LVGF++S++LT+IPFG+ M    L + +    +V     QI
Sbjct: 3   KQSSIHSSAGTSHGSSRSYLVGFVVSVLLTLIPFGLAMFPS-LPRTVTAWLVVALGAIQI 61

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHL FFLH+ T  E  W+++A+IF+ +++ +    S+W+M  +++NM++
Sbjct: 62  VVHLKFFLHLDTAQEQRWNLIALIFSAVIIVLLVGLSLWIMNSIHHNMLA 111


>gi|194367564|ref|YP_002030174.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
 gi|194350368|gb|ACF53491.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas
           maltophilia R551-3]
          Length = 110

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 70/110 (63%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    +   +++G+ K  L+GF+L  +LT++PF +VM    L + +    +V  A+AQ
Sbjct: 1   MAHVET-SRAGNAHGSTKSYLIGFVLCALLTVVPFALVMNPV-LSRPLTLFLLVGFAVAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+V LV+FLHM  K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 59  ILVQLVYFLHMDRKSEGGWNLASFVFTLVILFIVVALSVWIIWSMHYHMM 108


>gi|300702890|ref|YP_003744491.1| cytochrome o ubiquinol oxidase, subunit iv [Ralstonia solanacearum
           CFBP2957]
 gi|299070552|emb|CBJ41847.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           CFBP2957]
          Length = 122

 Score =  111 bits (279), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+    
Sbjct: 27  TVKGYLIGFVLAVILTVIPFKMVMGGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSS 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W++MA +FT++++AI  VGS+WVM+++N NMM
Sbjct: 86  AQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMM 120


>gi|91778473|ref|YP_553681.1| CyoD [Burkholderia xenovorans LB400]
 gi|91691133|gb|ABE34331.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia xenovorans
           LB400]
          Length = 110

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 45/109 (41%), Positives = 69/109 (63%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+      GF+LS+ILT+  FG+VM G    ++ +   I   A  QI+
Sbjct: 2   DHSHNAHAGESHGSIGSYTAGFVLSVILTVAAFGLVMTGKLTGEHALFA-IAGLAFVQIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHLVFFLHM+T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLVFFLHMNTSSEQRWNVMAFAFTLLTAIIVIGGTLWVMHNVSMHMMS 109


>gi|285017726|ref|YP_003375437.1| cytochrome o ubiquinol oxidase subunit iv transmembrane protein
           [Xanthomonas albilineans GPE PC73]
 gi|283472944|emb|CBA15449.1| probable cytochrome o ubiquinol oxidase subunit iv transmembrane
           protein [Xanthomonas albilineans]
          Length = 112

 Score =  111 bits (278), Expect = 3e-23,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 2/109 (1%)

Query: 3   YDNIHNMNMHSYGT-KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           + +       S+G+  K  L+GF+L++ILT+IPFG+VM G F  K    + I + A  Q+
Sbjct: 4   HPSSEAHADPSHGSSLKSYLIGFVLAVILTVIPFGMVMSGAF-PKGATVIAIAVMAAVQM 62

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHLV+FLHM    E   ++   +F+++++ I  VGS+WV+++LN NMM
Sbjct: 63  LVHLVYFLHMDRSPEQRSNVHVGLFSLLIIGIVVVGSLWVLHNLNVNMM 111


>gi|170723534|ref|YP_001751222.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida W619]
 gi|169761537|gb|ACA74853.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida W619]
          Length = 110

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 69/110 (62%), Gaps = 4/110 (3%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D  H  N   +G+ K  ++GF+LS+ILT IPFG+VM    L KN+  L +V  A+ Q+
Sbjct: 4   AHDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLVMYPS-LPKNLTVLIVVAMAVIQV 59

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  MM+
Sbjct: 60  VVHLVYFLHMDRSKEQRSNVSTFLFTTMVIALLVGLSLWIMFSIHYEMMA 109


>gi|161524385|ref|YP_001579397.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia multivorans
           ATCC 17616]
 gi|189350860|ref|YP_001946488.1| cytochrome o ubiquinol oxidase protein [Burkholderia multivorans
           ATCC 17616]
 gi|221198370|ref|ZP_03571416.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2M]
 gi|221208953|ref|ZP_03581950.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2]
 gi|221215750|ref|ZP_03588710.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD1]
 gi|160341814|gb|ABX14900.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia multivorans
           ATCC 17616]
 gi|189334882|dbj|BAG43952.1| cytochrome o ubiquinol oxidase protein [Burkholderia multivorans
           ATCC 17616]
 gi|221164362|gb|EED96848.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD1]
 gi|221171236|gb|EEE03686.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2]
 gi|221182302|gb|EEE14703.1| ubiquinol oxidase, subunit IV [Burkholderia multivorans CGD2M]
          Length = 110

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +   + + A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGSYVAGFILSVLLTAASFGLVMGGVLSPHASLVA-LAVLAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|34499448|ref|NP_903663.1| cytochrome o ubiquinol oxidase subunit IV [Chromobacterium
           violaceum ATCC 12472]
 gi|34105300|gb|AAQ61655.1| cytochrome o ubiquinol oxidase subunit IV [Chromobacterium
           violaceum ATCC 12472]
          Length = 106

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
            H  +  S+GT K  +VGF+LS+ILT IPF +VM G F  K    + I+  A+ QI+V L
Sbjct: 2   SHAHDNASHGTVKSYMVGFVLSVILTAIPFWMVMGGAFT-KQATLIGILAMAVVQIVVQL 60

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +FLH+    E   +  + +FT +++ +  V S+W++Y  +  MM
Sbjct: 61  KYFLHLDFSKEGKLNTFSFLFTGMVIVLLVVLSIWIIYTADALMM 105


>gi|295699447|ref|YP_003607340.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
 gi|295438660|gb|ADG17829.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
          Length = 113

 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 1/110 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +      +   +G+    + GF+LS+ILT+  F IVM G     + +   I   A+ QI
Sbjct: 4   SHSAHGAHSEGGHGSFGSYMTGFVLSVILTVAAFAIVMTGTLTGHSALFA-IAGLAVVQI 62

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLVFFLHM+      W++ A +FT +   I   G++WVM++++ NMMS
Sbjct: 63  LVHLVFFLHMNASSSQRWNVTAFVFTALTAVIVVGGTLWVMHNVSMNMMS 112


>gi|262396851|ref|YP_003288704.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio sp. Ex25]
 gi|262340445|gb|ACY54239.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio sp. Ex25]
          Length = 103

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H   +    + GFI SLILT+IPF  V      D       +  CA+ QI VH  +F
Sbjct: 1   MDQHVETSASDYVKGFIASLILTVIPFYFVWTKSLPD-TTTYAILFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM TK  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMETKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|325522318|gb|EGD00930.1| ubiquinol oxidase, subunit IV [Burkholderia sp. TJI49]
          Length = 110

 Score =  110 bits (277), Expect = 5e-23,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +   + + A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVLLTAASFGLVMGGVLSPHASLVA-LAVLAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|307545742|ref|YP_003898221.1| cytochrome O ubiquinol oxidase cyoD [Halomonas elongata DSM 2581]
 gi|307217766|emb|CBV43036.1| K02300 cytochrome o ubiquinol oxidase operon protein cyoD
           [Halomonas elongata DSM 2581]
          Length = 109

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 73/103 (70%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           +   HS+G+ K  +VG ILS++LTIIPFG+VM G F       L IV  A+AQ++V L+ 
Sbjct: 6   SHEEHSHGSVKSYVVGLILSIVLTIIPFGVVMTGSF-GTPATVLIIVATAVAQVLVQLIL 64

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           F+HM+TK ++GW+ M+ +FT+ ++ +   GS+W+MY+L+ NMM
Sbjct: 65  FMHMNTKADEGWNFMSFVFTVSILVLIIGGSVWIMYNLHQNMM 107


>gi|33593868|ref|NP_881512.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33600272|ref|NP_887832.1| cytochrome 0 ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|33563941|emb|CAE43202.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis Tohama I]
 gi|33567870|emb|CAE31784.1| cytochrome 0 ubiquinol oxidase [Bordetella bronchiseptica RB50]
 gi|332383287|gb|AEE68134.1| cytochrome 0 ubiquinol oxidase [Bordetella pertussis CS]
          Length = 115

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 70/116 (60%), Gaps = 3/116 (2%)

Query: 1   MKYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +      + H+ +G+ K  L+GF +SL+LT   FG+VM G    + I    +V+  +A
Sbjct: 1   MSHAVTSEDHGHADHGSLKSYLIGFAISLVLTFGSFGLVMAGTV-PRGIALAGVVVLCVA 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM-SMEG 114
           Q++V LVFFLHM    +   ++   +FTI+++AI   GS+WV++++N NMM  M G
Sbjct: 60  QLLVQLVFFLHMGGSKKQRDNVTTFVFTILIIAIIVGGSVWVLHNMNANMMHPMPG 115


>gi|78066842|ref|YP_369611.1| cytochrome C oxidase subunit IV [Burkholderia sp. 383]
 gi|77967587|gb|ABB08967.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia sp. 383]
          Length = 110

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +   + + A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVLLTAASFGLVMGGVLSPHASLIA-LAVLAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|91225752|ref|ZP_01260781.1| hypothetical protein V12G01_07168 [Vibrio alginolyticus 12G01]
 gi|91189641|gb|EAS75916.1| hypothetical protein V12G01_07168 [Vibrio alginolyticus 12G01]
          Length = 103

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H   +    + GFI SLILT+IPF  V      D       +  CA+ QI VH  +F
Sbjct: 1   MDQHVETSSSDYVKGFIASLILTVIPFYFVWTKSLPD-TTTYAILFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM TK  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMETKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|107028752|ref|YP_625847.1| cytochrome C oxidase subunit IV [Burkholderia cenocepacia AU 1054]
 gi|116690089|ref|YP_835712.1| cytochrome C oxidase subunit IV [Burkholderia cenocepacia HI2424]
 gi|170733423|ref|YP_001765370.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia cenocepacia
           MC0-3]
 gi|206560505|ref|YP_002231269.1| cytochrome O ubiquinol oxidase protein [Burkholderia cenocepacia
           J2315]
 gi|254247836|ref|ZP_04941157.1| Heme/copper-type cytochrome/quinol oxidase [Burkholderia
           cenocepacia PC184]
 gi|105897916|gb|ABF80874.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia cenocepacia
           AU 1054]
 gi|116648178|gb|ABK08819.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia cenocepacia
           HI2424]
 gi|124872612|gb|EAY64328.1| Heme/copper-type cytochrome/quinol oxidase [Burkholderia
           cenocepacia PC184]
 gi|169816665|gb|ACA91248.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia cenocepacia
           MC0-3]
 gi|198036546|emb|CAR52443.1| cytochrome O ubiquinol oxidase protein [Burkholderia cenocepacia
           J2315]
          Length = 110

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 66/111 (59%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +   + + A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVLLTAASFGLVMGGVLSPHASLIG-LAVLAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAIVIVGTLWVMHNVSMNMMS 109


>gi|123443352|ref|YP_001007326.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090313|emb|CAL13179.1| cytochrome O ubiquinol oxidase subunit CyoD [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 95

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  L+GFILS+ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E
Sbjct: 1   MKSYLIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSE 59

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 60  ERWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 93


>gi|77361151|ref|YP_340726.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas haloplanktis TAC125]
 gi|76876062|emb|CAI87284.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 119

 Score =  110 bits (276), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 40/119 (33%), Positives = 65/119 (54%), Gaps = 10/119 (8%)

Query: 1   MKYDNIH--------NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLT 52
           M +   H        + +  S+G+ K  L+GF+LS+ILT IPF +VM G F  K     +
Sbjct: 1   MSHSETHALKQMQNEHHHDESHGSVKSYLIGFVLSVILTAIPFYMVMSGDF-SKATTLYS 59

Query: 53  IVLCAIAQIIVHLVFFLHMSTKVE-DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+  A+ QI VHL +FLH++   E    S  + +F+ +++ +    S+W++Y  N  MM
Sbjct: 60  IITLAVVQIWVHLKYFLHLNFITEDGRASTFSFLFSALIIVMVVGLSVWIIYESNAMMM 118


>gi|207721795|ref|YP_002252233.1| transmembrane cytochrome o ubiquinol oxidase (subunit iv) protein
           [Ralstonia solanacearum MolK2]
 gi|206586959|emb|CAQ17543.1| transmembrane cytochrome o ubiquinol oxidase (subunit iv) protein
           [Ralstonia solanacearum MolK2]
          Length = 123

 Score =  110 bits (276), Expect = 7e-23,   Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 70/95 (73%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  L+GF+L++ILT+IPF +VM G F   + + +T++  A+ QI+VHL++FLH+    
Sbjct: 28  SVKGYLIGFVLAVILTVIPFKMVMSGGF-SHDTVLVTVMALAVVQIVVHLIYFLHLDGSS 86

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W++MA +FT++++AI  VGS+WVM+++N NMM
Sbjct: 87  AQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMM 121


>gi|296115138|ref|ZP_06833779.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           hansenii ATCC 23769]
 gi|295978239|gb|EFG84976.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           hansenii ATCC 23769]
          Length = 110

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D   +    S+G+    L GF++S++LT   FG+VM   F     M   I L A+ QI+V
Sbjct: 3   DAHTSSAGESHGSVGSYLTGFVISVLLTAAAFGLVMAHTFSPSGTMGA-ITLLAVVQIVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL+FFLHM+   E  W+IMA  FT++ V I   G++++M+  + NMMS
Sbjct: 62  HLIFFLHMNGSSEQRWNIMAFAFTVVTVLILVGGTIFIMHDTSINMMS 109


>gi|332184971|ref|ZP_08386720.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
 gi|332014695|gb|EGI56751.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
          Length = 101

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 47/91 (51%), Positives = 65/91 (71%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LS+ILT IPF  VM G   D     L I+  A  QI+VH+++FLHM+TK E GW+
Sbjct: 1   MIGFVLSVILTAIPFWAVMTGALGDTQTTALVIMGLAFVQIVVHMIYFLHMNTKSEGGWT 60

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +MA++FT ++V I   GS+WVMYH+N NMM 
Sbjct: 61  MMALVFTAVLVVITLSGSIWVMYHMNTNMMP 91


>gi|222111442|ref|YP_002553706.1| cytochrome o ubiquinol oxidase subunit Iv [Acidovorax ebreus TPSY]
 gi|221730886|gb|ACM33706.1| cytochrome o ubiquinol oxidase subunit IV [Acidovorax ebreus TPSY]
          Length = 139

 Score =  110 bits (275), Expect = 9e-23,   Method: Composition-based stats.
 Identities = 41/98 (41%), Positives = 70/98 (71%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           TK   + GFIL++ILT+IPF +VM     ++    L + + A+ Q++VH+V+FLHM+ K+
Sbjct: 23  TKGDYVKGFILAVILTVIPFWLVMADVIQNRTTAVLVLGIFAMVQVVVHMVYFLHMNGKI 82

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           + GW++++ IFTI+ +A+  +G++WVM+H+N NMM   
Sbjct: 83  QGGWTMLSTIFTIVFLAVTIIGTLWVMFHMNANMMPAH 120


>gi|33595747|ref|NP_883390.1| cytochrome 0 ubiquinol oxidase [Bordetella parapertussis 12822]
 gi|33565826|emb|CAE36371.1| cytochrome 0 ubiquinol oxidase [Bordetella parapertussis]
          Length = 115

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 43/116 (37%), Positives = 71/116 (61%), Gaps = 3/116 (2%)

Query: 1   MKYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M +      + H+ +G+ K  L+GF +SL+LT   FG+VM G    ++I    +V+  +A
Sbjct: 1   MSHAVTSEDHGHANHGSLKSYLIGFAISLVLTFGSFGLVMAGTV-PRSIALAGVVVLCVA 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM-SMEG 114
           Q++V LVFFLHM    +   ++   +FTI+++AI   GS+WV++++N NMM  M G
Sbjct: 60  QLLVQLVFFLHMGGSKKQRDNVTTFVFTILIIAIIVGGSVWVLHNMNANMMHPMPG 115


>gi|259909263|ref|YP_002649619.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia pyrifoliae
           Ep1/96]
 gi|224964885|emb|CAX56407.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia pyrifoliae
           Ep1/96]
 gi|283479315|emb|CAY75231.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia pyrifoliae DSM
           12163]
 gi|310766834|gb|ADP11784.1| Cytochrome o ubiquinol oxidase protein CyoD [Erwinia sp. Ejp617]
          Length = 109

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 44/108 (40%), Positives = 73/108 (67%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +    +  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V   +  ++V
Sbjct: 2   SHPATEHGASHGSVKSYMIGFILSIILTGIPFWMVMDGGASKATILTVVLVCAVVQ-VLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH+ +K E GW+++A++F  +++ I  VGS+W+M++LN NMMS
Sbjct: 61  HLVYFLHLDSKSEGGWNLIAIVFAALIILIVVVGSLWIMWNLNYNMMS 108


>gi|315125955|ref|YP_004067958.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas sp. SM9913]
 gi|315014469|gb|ADT67807.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Pseudoalteromonas sp. SM9913]
          Length = 118

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/118 (34%), Positives = 64/118 (54%), Gaps = 9/118 (7%)

Query: 1   MKYDNIHN-------MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI 53
           M +   H         +  S+G+ K  L+GF+LS+ILT IPF +VM+G F  K     +I
Sbjct: 1   MSHSETHALAQMQSQHHDQSHGSVKTYLIGFVLSVILTAIPFWMVMEGDF-SKVTTLWSI 59

Query: 54  VLCAIAQIIVHLVFFLHMSTKV-EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           V  AI QI VHL +FLH++    E   +    +F+ +++ +    S+W++Y  N  MM
Sbjct: 60  VTFAIVQIWVHLKYFLHLNFTTDEGKANTFTFLFSALIIVMVVGLSVWIIYESNAMMM 117


>gi|238750997|ref|ZP_04612493.1| hypothetical protein yrohd0001_1290 [Yersinia rohdei ATCC 43380]
 gi|238765442|ref|ZP_04626363.1| hypothetical protein ykris0001_44090 [Yersinia kristensenii ATCC
           33638]
 gi|238696336|gb|EEP89132.1| hypothetical protein ykris0001_44090 [Yersinia kristensenii ATCC
           33638]
 gi|238710687|gb|EEQ02909.1| hypothetical protein yrohd0001_1290 [Yersinia rohdei ATCC 43380]
          Length = 95

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 48/94 (51%), Positives = 69/94 (73%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  ++GFILS+ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E
Sbjct: 1   MKSYIIGFILSVILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSE 59

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + W+++A +FT +++AI  VGS+W+MY+LN NMM
Sbjct: 60  ERWNLVAFLFTAMIIAIVVVGSLWIMYNLNINMM 93


>gi|121595099|ref|YP_986995.1| cytochrome C oxidase subunit IV [Acidovorax sp. JS42]
 gi|120607179|gb|ABM42919.1| cytochrome bo3 quinol oxidase subunit 4 [Acidovorax sp. JS42]
          Length = 142

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 41/100 (41%), Positives = 72/100 (72%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           + TK   + GFIL++ILT+IPF +VM     +++   L + + A+ Q++VH+V+FLHM+ 
Sbjct: 24  HVTKGDYVKGFILAVILTVIPFALVMGDVIQNRSTAVLVLGIFAMVQVVVHMVYFLHMNG 83

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           K++ GW++++ IFTI+ +A+  +G++WVM+H+N NMM   
Sbjct: 84  KIQGGWTMLSTIFTIVFLAVTIIGTLWVMFHMNANMMPAH 123


>gi|299067541|emb|CBJ38741.1| cytochrome o ubiquinol oxidase subunit IV [Ralstonia solanacearum
           CMR15]
          Length = 125

 Score =  109 bits (274), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 1/107 (0%)

Query: 7   HNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLV 66
           H      +G+ +   VG +LS+ LT+  F  VM G    +  +   + LC +AQ++V LV
Sbjct: 10  HAGETAVHGSLRGYTVGLLLSVALTLAAFATVMTGALPARLALAGMVGLC-VAQLLVQLV 68

Query: 67  FFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           FFLH+        +    + T +++AI   GS+WVM++ N NMM  +
Sbjct: 69  FFLHLGPGPGQRGNTAIFVCTGLLIAIVVAGSLWVMHNANANMMPTD 115


>gi|186470621|ref|YP_001861939.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184196930|gb|ACC74893.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 125

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 32/106 (30%), Positives = 59/106 (55%), Gaps = 1/106 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  S+G+ K  ++G +LSL LT   FG+VM         +   + LC + Q++V L +
Sbjct: 11  HAHDASHGSVKHYVIGMLLSLALTFASFGVVMTHVVPRAMGLTAVVALC-VVQLLVQLRY 69

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           FLH+ +  +   +    + T +++AI   GS+WV+++ N NMM  +
Sbjct: 70  FLHLGSSADQRSNTGIFVCTALLIAIIVAGSLWVIHNANVNMMPTQ 115


>gi|307293187|ref|ZP_07573033.1| cytochrome o ubiquinol oxidase subunit IV [Sphingobium
           chlorophenolicum L-1]
 gi|306881253|gb|EFN12469.1| cytochrome o ubiquinol oxidase subunit IV [Sphingobium
           chlorophenolicum L-1]
          Length = 133

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 49/105 (46%), Positives = 72/105 (68%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
             ++G+ +  ++GF LS+ILT IPF +VM G   D  +  + I+  A  Q++VH+++FLH
Sbjct: 17  EGAHGSLRSNMIGFGLSVILTAIPFWLVMSGVLGDPQLTGVIIMGFAAVQVVVHMIYFLH 76

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
           M+T+VE GWS MAM+ T+++V I   GS+WVMYHLN NMM    M
Sbjct: 77  MNTRVEGGWSFMAMMLTVVLVVIVLSGSLWVMYHLNANMMPHADM 121


>gi|8134389|sp|Q9WWR4|CYOD_PSEPU RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit IV
 gi|4586340|dbj|BAA76359.1| cytochrome o ubiquinol oxidase D [Pseudomonas putida]
          Length = 110

 Score =  109 bits (273), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 42/110 (38%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D  H  N   +G+ K  ++GFILS+ILT IPFG+ M    L KN+  L IV  A+ Q+
Sbjct: 4   AHDTHHEGN---HGSVKSYMIGFILSIILTAIPFGLAMSPS-LPKNLTVLIIVAMAVIQV 59

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 60  VVHLVYFLHMDRSKEQRNNVWTFLFTTLVIALLVGLSLWIMFSIHFEMLA 109


>gi|188534643|ref|YP_001908440.1| Cytochrome o ubiquinol oxidase protein cyoD (Ubiquinol oxidase
           chain D) [Erwinia tasmaniensis Et1/99]
 gi|292487459|ref|YP_003530331.1| cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora
           CFBP1430]
 gi|292898701|ref|YP_003538070.1| cytochrome O ubiquinol oxidase subunit IV [Erwinia amylovora ATCC
           49946]
 gi|188029685|emb|CAO97564.1| Cytochrome o ubiquinol oxidase protein cyoD (Ubiquinol oxidase
           chain D) [Erwinia tasmaniensis Et1/99]
 gi|291198549|emb|CBJ45657.1| cytochrome O ubiquinol oxidase subunit IV [Erwinia amylovora ATCC
           49946]
 gi|291552878|emb|CBA19923.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora
           CFBP1430]
 gi|312171563|emb|CBX79821.1| Cytochrome o ubiquinol oxidase protein cyoD [Erwinia amylovora ATCC
           BAA-2158]
          Length = 109

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 46/108 (42%), Positives = 76/108 (70%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +    +  S+G+ K  ++GFILS+ILT IPF +VM G    K  +   +++CA+ Q++V
Sbjct: 2   SHPATEHGASHGSVKSYMIGFILSIILTGIPFWMVMDGGA-SKATILAVVLVCAVVQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH+ +K E GW+++A++F  +++ I  VGS+W+M++LN NMMS
Sbjct: 61  HLVYFLHLDSKSEGGWNLIAIVFAALIILIVVVGSLWIMWNLNYNMMS 108


>gi|92113085|ref|YP_573013.1| cytochrome C oxidase subunit IV [Chromohalobacter salexigens DSM
           3043]
 gi|91796175|gb|ABE58314.1| cytochrome bo3 quinol oxidase subunit 4 [Chromohalobacter
           salexigens DSM 3043]
          Length = 111

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 43/107 (40%), Positives = 72/107 (67%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D   + +  ++G+ K  ++G ILS++LTIIPFG+VM G F +   + +TI + AI Q++V
Sbjct: 3   DAHTSHDGGNHGSVKSYVIGLILSIVLTIIPFGMVMSGGF-ETMTVVVTISIMAILQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            L+ F+H+  K E+GW+  + IFT +++ I   GS+W+M +L+ NMM
Sbjct: 62  QLIMFMHLDFKTEEGWNAGSFIFTALILVILVGGSLWIMQNLHANMM 108


>gi|254524619|ref|ZP_05136674.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
 gi|219722210|gb|EED40735.1| cytochrome o ubiquinol oxidase subunit IV [Stenotrophomonas sp.
           SKA14]
          Length = 110

 Score =  109 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 69/110 (62%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    +   +++G+    L+GF+L  +LT++PF +VM    L + +    +V  A+AQ
Sbjct: 1   MAHVET-SRAGNAHGSTTSYLIGFVLCALLTVVPFALVMNPV-LSRPLTLFLLVGFAVAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+V LV+FLHM  K E GW++ + +FT++++ I    S+W+++ ++ +MM
Sbjct: 59  ILVQLVYFLHMDRKSEGGWNLASFVFTLVILFIVVALSVWIIWSMHYHMM 108


>gi|167589186|ref|ZP_02381574.1| Cytochrome C oxidase subunit IV [Burkholderia ubonensis Bu]
          Length = 110

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+V+ G       +   + + A+ Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYIAGFILSVLLTAASFGLVLGGVQSPHASLIA-LAVLALVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM++     W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNSSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|26987551|ref|NP_742976.1| cytochrome o ubiquinol oxidase, protein CyoD [Pseudomonas putida
           KT2440]
 gi|148546082|ref|YP_001266184.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida F1]
 gi|325275995|ref|ZP_08141820.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas sp. TJI-51]
 gi|24982224|gb|AAN66440.1|AE016273_9 cytochrome o ubiquinol oxidase, protein CyoD [Pseudomonas putida
           KT2440]
 gi|18149144|dbj|BAB83596.1| cytochrome o oxidase D [Pseudomonas putida]
 gi|42795026|gb|AAS45859.1| CyoD [Pseudomonas putida]
 gi|148510140|gb|ABQ77000.1| Cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida F1]
 gi|313497178|gb|ADR58544.1| CyoD [Pseudomonas putida BIRD-1]
 gi|324098876|gb|EGB96897.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas sp. TJI-51]
          Length = 110

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D  H  N   +G+ K  ++GF+LS+ILT IPFG+ M    L KN+  L IV  A+ Q+
Sbjct: 4   AHDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLAMTAS-LPKNLTVLIIVAMAVIQV 59

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 60  VVHLVYFLHMDRSKEQRNNVSTFLFTTLVIALLVGLSLWIMFSIHFEMLA 109


>gi|291616541|ref|YP_003519283.1| CyoD [Pantoea ananatis LMG 20103]
 gi|291151571|gb|ADD76155.1| CyoD [Pantoea ananatis LMG 20103]
 gi|327392972|dbj|BAK10394.1| cytochrome o ubiquinol oxidase protein CyoD [Pantoea ananatis
           AJ13355]
          Length = 109

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 45/108 (41%), Positives = 74/108 (68%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +  N +  S+G+ K  ++GFILS+ILT IPF +VM G      I+ + +V   +  ++V
Sbjct: 2   SHSVNEHGASHGSVKSYMIGFILSIILTGIPFWMVMDGSASHGTILGVVLVCAVVQ-VLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLH+ +K E GW+++A++F+ I++ I  VGS+W+M++LN NMM 
Sbjct: 61  HLVYFLHLDSKSEGGWNMVAIVFSAIIILIVVVGSLWIMWNLNYNMMP 108


>gi|70732058|ref|YP_261814.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas fluorescens
           Pf-5]
 gi|68346357|gb|AAY93963.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas fluorescens
           Pf-5]
          Length = 112

 Score =  108 bits (271), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 37/98 (37%), Positives = 66/98 (67%), Gaps = 1/98 (1%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +G+++  LVGF LSL+LT+IPF +VM    L +N+    +V   + QI+VHL +FLH+ T
Sbjct: 15  HGSRRSYLVGFALSLVLTLIPFALVMYPS-LPRNVTLWAVVGLGMIQILVHLRYFLHLDT 73

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
             E  W++ A+IF+ +++ +    S+W+M  +++NM++
Sbjct: 74  ATEQRWNLTALIFSAVVIFLLVGLSLWIMNSIHHNMLA 111


>gi|104780180|ref|YP_606678.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas entomophila
           L48]
 gi|95109167|emb|CAK13864.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas entomophila
           L48]
          Length = 110

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 70/110 (63%), Gaps = 4/110 (3%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D  H  N   +G+ K  ++GF+LS+ILT IPFG+VM    L KN+  L +V  A+ Q+
Sbjct: 4   AHDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLVMFPS-LPKNLTVLVVVAMAVIQV 59

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLHM    E   ++   +FT++++A+    S+W+M+ ++  M++
Sbjct: 60  VVHLVYFLHMDRSKEQRSNVSTFLFTVLVIALLVGLSLWIMFSIHFEMLA 109


>gi|239995160|ref|ZP_04715684.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii ATCC 27126]
 gi|332143297|ref|YP_004429035.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii str. 'Deep ecotype']
 gi|327553319|gb|AEB00038.1| cytochrome o ubiquinol oxidase protein (Ubiquinol oxidase chain D)
           [Alteromonas macleodii str. 'Deep ecotype']
          Length = 123

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + +  + +  ++G  K  ++GFILS++LT IPF +VM G  L K     ++V   + QI 
Sbjct: 15  HASSTHNSDDAHGDVKSYIIGFILSVVLTAIPFTLVMNG-DLSKVTTIWSVVTLGLVQIW 73

Query: 63  VHLVFFLHMSTKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VHL +FLH++   E+G  +  + +F+ +++ +    S+W++Y  N  MM
Sbjct: 74  VHLKYFLHLNFVTEEGRANTFSFLFSALIIFMVVGLSVWIIYESNAMMM 122


>gi|301058564|ref|ZP_07199569.1| cytochrome o ubiquinol oxidase, subunit IV [delta proteobacterium
           NaphS2]
 gi|300447296|gb|EFK11056.1| cytochrome o ubiquinol oxidase, subunit IV [delta proteobacterium
           NaphS2]
          Length = 109

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +    G+ +  + GF+LS++LT+IPF +VM G    ++++   I    I QI +HL +
Sbjct: 7   DSSGAGRGSLRTYISGFVLSVVLTVIPFALVMGGGV-PRSVVIWGICGAGIVQIFIHLHY 65

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLH+ T     W++MA++FT++++ I   G++WVM  LN+ MM
Sbjct: 66  FLHLDTSSAARWNVMALVFTLLIIFIFVGGTVWVMVTLNSRMM 108


>gi|109897618|ref|YP_660873.1| cytochrome C oxidase subunit IV [Pseudoalteromonas atlantica T6c]
 gi|109699899|gb|ABG39819.1| cytochrome bo3 quinol oxidase subunit 4 [Pseudoalteromonas
           atlantica T6c]
          Length = 105

 Score =  108 bits (271), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 39/105 (37%), Positives = 66/105 (62%), Gaps = 1/105 (0%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
            H+    ++G+ K  L+GF+LS+ILT IPF +VM G F  K+++  ++V  A+ QI+VHL
Sbjct: 2   SHSAEATAHGSVKSYLIGFVLSVILTAIPFWMVMSGHF-GKSVLFYSVVSFALVQIVVHL 60

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +FLH++  V+      A +FT +++ +    S+W++Y  N  MM
Sbjct: 61  KYFLHLNFSVKGRLDTFAFLFTALIIVMVVGLSIWIIYSANAMMM 105


>gi|319762686|ref|YP_004126623.1| cytochrome o ubiquinol oxidase subunit iv [Alicycliphilus
           denitrificans BC]
 gi|330824827|ref|YP_004388130.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans K601]
 gi|317117247|gb|ADU99735.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans BC]
 gi|329310199|gb|AEB84614.1| cytochrome o ubiquinol oxidase subunit IV [Alicycliphilus
           denitrificans K601]
          Length = 124

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 41/99 (41%), Positives = 67/99 (67%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T+   + GF+L++ILT IPF +VM G   D+    L + L A  QI+VH+V+FLHM+ K+
Sbjct: 26  TRGDYVKGFVLAVILTAIPFWLVMNGAIQDRTTGALVLGLFAAVQIVVHMVYFLHMNGKI 85

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           + GW++++ +FTI+ +A+   G++WVM+H+N  MM    
Sbjct: 86  QGGWTMLSTLFTIVFLAVTIAGTLWVMFHMNAAMMPSHP 124


>gi|49474943|ref|YP_032984.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella henselae str.
           Houston-1]
 gi|49237748|emb|CAF26940.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella henselae str.
           Houston-1]
          Length = 228

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 35/114 (30%), Positives = 56/114 (49%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           ++  HN       +    LVGFIL++  T+  F  VM G      I    + L  +A I 
Sbjct: 4   HNETHNP------STSSYLVGFILAVFFTLGSFIPVMYGMMDSWAISTKVVYLIGMAIIQ 57

Query: 63  VHL--VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           + +  +FFLH+++  +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 58  IIVQIIFFLHLNSGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGGSG 111


>gi|66044395|ref|YP_234236.1| cytochrome C oxidase subunit IV [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255102|gb|AAY36198.1| Prokaryotic Cytochrome C oxidase subunit IV [Pseudomonas syringae
           pv. syringae B728a]
 gi|330969178|gb|EGH69244.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aceris str. M302273PT]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           ++ H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+V
Sbjct: 3   NSHHSAEDNSHGSVKSYVIGFVLSIILTAIPFALVMSPS-LPKDMTIAIVLVFAIIQILV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLH+        ++MA  FT +++ +    S+W+++ ++  MM+
Sbjct: 62  HLHYFLHLDFTSVQRNNVMAFAFTTMVIVLLVGLSLWIIFSVHREMMA 109


>gi|319945343|ref|ZP_08019605.1| cytochrome o ubiquinol oxidase subunit IV [Lautropia mirabilis ATCC
           51599]
 gi|319741913|gb|EFV94338.1| cytochrome o ubiquinol oxidase subunit IV [Lautropia mirabilis ATCC
           51599]
          Length = 105

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 67/105 (63%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M    + +   C +GF+L++ILT+IPFG+VM G F D     L I+   + QIIVH+V+F
Sbjct: 1   MGQPPHVSGTDCNIGFLLAVILTLIPFGLVMTGAFEDTGTAALIIMGLGVVQIIVHMVYF 60

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           L ++ + E  W++ A+I T+++VAI  VG++W M  L+ N++   
Sbjct: 61  LQLNCRAEGSWTLPALIVTVLLVAILLVGTLWGMPPLDGNVVPGS 105


>gi|71733637|ref|YP_273479.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|237799927|ref|ZP_04588388.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           oryzae str. 1_6]
 gi|257487314|ref|ZP_05641355.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tabaci ATCC 11528]
 gi|289623938|ref|ZP_06456892.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289646772|ref|ZP_06478115.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|289678123|ref|ZP_06499013.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           syringae FF5]
 gi|298485880|ref|ZP_07003956.1| Cytochrome O ubiquinol oxidase subunit IV [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|302186053|ref|ZP_07262726.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           syringae 642]
 gi|71554190|gb|AAZ33401.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|298159569|gb|EFI00614.1| Cytochrome O ubiquinol oxidase subunit IV [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
 gi|320323022|gb|EFW79112.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329855|gb|EFW85843.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330870268|gb|EGH04977.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aesculi str. 0893_23]
 gi|330874428|gb|EGH08577.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330890459|gb|EGH23120.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           mori str. 301020]
 gi|330895789|gb|EGH28078.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           japonica str. M301072PT]
 gi|330939016|gb|EGH42488.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           pisi str. 1704B]
 gi|330975784|gb|EGH75850.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           aptata str. DSM 50252]
 gi|330988098|gb|EGH86201.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331009080|gb|EGH89136.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|331022782|gb|EGI02839.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 110

 Score =  107 bits (269), Expect = 4e-22,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           ++ H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+V
Sbjct: 3   NSHHSAEDNSHGSVKSYIIGFVLSIILTAIPFALVMSPS-LPKDMTIAIVLVFAIIQILV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLH+        ++MA  FT +++ +    S+W+++ ++  MM+
Sbjct: 62  HLHYFLHLDFTSVQRNNVMAFAFTTMVIVLLVGLSLWIIFSVHREMMA 109


>gi|53716518|ref|YP_105024.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|53722915|ref|YP_111900.1| cytochrome O ubiquinol oxidase protein [Burkholderia pseudomallei
           K96243]
 gi|67641747|ref|ZP_00440515.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei GB8
           horse 4]
 gi|76817781|ref|YP_336148.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1710b]
 gi|121597003|ref|YP_990968.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|124382029|ref|YP_001025369.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10229]
 gi|126445034|ref|YP_001063705.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 668]
 gi|126446731|ref|YP_001077433.1| ubiquinol oxidase, subunit IV [Burkholderia mallei NCTC 10247]
 gi|126456685|ref|YP_001076599.1| ubiquinol oxidase subunit IV [Burkholderia pseudomallei 1106a]
 gi|134278624|ref|ZP_01765338.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|226195663|ref|ZP_03791250.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|237510118|ref|ZP_04522833.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|242313191|ref|ZP_04812208.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|251767252|ref|ZP_04820032.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           PRL-20]
 gi|254177413|ref|ZP_04884069.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|254184768|ref|ZP_04891357.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|254185987|ref|ZP_04892505.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|254193750|ref|ZP_04900182.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|254202956|ref|ZP_04909318.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|254208290|ref|ZP_04914639.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|254263772|ref|ZP_04954637.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|254301043|ref|ZP_04968487.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|52213329|emb|CAH39372.1| cytochrome O ubiquinol oxidase protein [Burkholderia pseudomallei
           K96243]
 gi|52422488|gb|AAU46058.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 23344]
 gi|76582254|gb|ABA51728.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710b]
 gi|121224801|gb|ABM48332.1| ubiquinol oxidase, subunit IV [Burkholderia mallei SAVP1]
 gi|126224525|gb|ABN88030.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 668]
 gi|126230453|gb|ABN93866.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106a]
 gi|126239585|gb|ABO02697.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           NCTC 10247]
 gi|134250408|gb|EBA50488.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 305]
 gi|147746001|gb|EDK53079.1| ubiquinol oxidase, subunit IV [Burkholderia mallei FMH]
 gi|147750977|gb|EDK58045.1| ubiquinol oxidase, subunit IV [Burkholderia mallei JHU]
 gi|157811393|gb|EDO88563.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 406e]
 gi|157933673|gb|EDO89343.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pasteur
           52237]
 gi|160698453|gb|EDP88423.1| ubiquinol oxidase, subunit IV [Burkholderia mallei ATCC 10399]
 gi|169650501|gb|EDS83194.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei S13]
 gi|184215360|gb|EDU12341.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1655]
 gi|225932148|gb|EEH28148.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei Pakistan
           9]
 gi|235002323|gb|EEP51747.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia
           pseudomallei MSHR346]
 gi|238522722|gb|EEP86165.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei GB8
           horse 4]
 gi|242136430|gb|EES22833.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1106b]
 gi|243063388|gb|EES45574.1| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           PRL-20]
 gi|254214774|gb|EET04159.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 1710a]
 gi|261826610|gb|ABM99196.2| cytochrome o ubiquinol oxidase, subunit IV [Burkholderia mallei
           NCTC 10229]
          Length = 110

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  ++GT    L GFILS++LT   FG+V+ G       +   + + A  QI+VHLV+
Sbjct: 7   SHDGEAHGTVGGYLAGFILSVLLTAASFGLVLSGALSSHASLIA-LAVLAFVQIVVHLVY 65

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           FLHM+      W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 66  FLHMNGSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|283850557|ref|ZP_06367845.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio sp.
           FW1012B]
 gi|283574128|gb|EFC22100.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio sp.
           FW1012B]
          Length = 107

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 61/95 (64%), Gaps = 1/95 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ +   VGF+LS++LT+IPF +VM G  L  +     +   AI QI+V L +FLH+ T 
Sbjct: 14  GSVRSYTVGFVLSVVLTVIPFALVMSGA-LSPSATVFCVFAAAIVQIVVQLHYFLHLDTS 72

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               W++++++FT++++ +   GS+WVMY L+  M
Sbjct: 73  SGMHWNLLSLVFTVLIMTLFIGGSIWVMYSLHYRM 107


>gi|217422660|ref|ZP_03454163.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
 gi|217394891|gb|EEC34910.1| ubiquinol oxidase, subunit IV [Burkholderia pseudomallei 576]
          Length = 107

 Score =  107 bits (268), Expect = 5e-22,   Method: Composition-based stats.
 Identities = 40/104 (38%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  ++GT    L GFILS++LT   FG+V+ G       +   + + A  QI+VHLV+
Sbjct: 4   SHDGEAHGTVGGYLAGFILSVLLTAASFGLVLSGALSSHASLIA-LAVLAFVQIVVHLVY 62

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           FLHM+      W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 63  FLHMNGSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 106


>gi|332992078|gb|AEF02133.1| cytochrome o ubiquinol oxidase protein (ubiquinol oxidase chain D)
           [Alteromonas sp. SN2]
          Length = 130

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 64/102 (62%), Gaps = 2/102 (1%)

Query: 10  NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
           +   +G+ K  L+GF+LS+ILT+IPF +VM+G F  K     +IV+ A+ QI VHL +FL
Sbjct: 29  HAAEHGSVKTYLIGFVLSVILTLIPFVMVMEGDF-SKVTTLWSIVVFALVQIWVHLKYFL 87

Query: 70  HMSTKVE-DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           H++   E    S ++ +F+ +++ +    S+W++Y  N  MM
Sbjct: 88  HLNFVTEDGRASTISFLFSALIIFMVVGLSIWIIYESNAMMM 129


>gi|303246930|ref|ZP_07333206.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio
           fructosovorans JJ]
 gi|302491637|gb|EFL51520.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio
           fructosovorans JJ]
          Length = 110

 Score =  107 bits (268), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 62/108 (57%), Gaps = 1/108 (0%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            + +  N      G+ +   +GF+LSL+LT+IPF +VM G  L        +   A+ QI
Sbjct: 4   THASGDNDVRAGSGSFRTYTLGFVLSLVLTVIPFALVMTGA-LPHGATLACLYAAAVIQI 62

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +VHL +FLH+       W++++++FT  ++ +   GS+W+MY L++ M
Sbjct: 63  VVHLHYFLHLDRSSGMYWNMLSLLFTFFIMFLFIGGSLWIMYSLHSRM 110


>gi|117922465|ref|YP_871657.1| cytochrome C oxidase subunit IV [Shewanella sp. ANA-3]
 gi|117614797|gb|ABK50251.1| cytochrome C oxidase subunit IV [Shewanella sp. ANA-3]
          Length = 113

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ H  +  +  + K  LVGF+LS++LT IPF  VM   F     + + IV  A+ QI
Sbjct: 7   SHDHSHGADDLA-ASIKSYLVGFVLSVVLTAIPFWAVMTHHFEQSTTLAIVIV-TALVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 65  LVHLKYFLHLDFSKEGKINTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|167031867|ref|YP_001667098.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida GB-1]
 gi|166858355|gb|ABY96762.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas putida GB-1]
          Length = 110

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 68/110 (61%), Gaps = 4/110 (3%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D  H  N   +G+ K  ++GF+LS+ILT IPFG+ M    L KN+  L IV  A+ Q+
Sbjct: 4   AHDTHHEGN---HGSVKSYMIGFVLSIILTAIPFGLAMTAS-LPKNLTVLIIVAMAVIQV 59

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +VHLV+FLHM    E   ++   +FT +++A+    S+W+M+ ++  M++
Sbjct: 60  VVHLVYFLHMDRSKEQRNNVSTFLFTTMVIALLVGLSLWIMFSIHFEMLA 109


>gi|152994134|ref|YP_001338969.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas sp. MWYL1]
 gi|150835058|gb|ABR69034.1| Cytochrome o ubiquinol oxidase subunit IV [Marinomonas sp. MWYL1]
          Length = 107

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 2/107 (1%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H+   +S+G+ K  + GF+LS+ILT IPF +VM   F DK    +TI+L AI QI VH
Sbjct: 2   SDHSSEANSHGSVKSYVTGFVLSVILTGIPFWMVMTEAF-DKGPTYVTIILLAIVQIFVH 60

Query: 65  LVFFLHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           L +FLH++   E G     + +F ++++ +    S+W++Y  N  MM
Sbjct: 61  LKYFLHLNFTSEQGKLDAYSFLFALMIIVMVVALSVWIIYASNAMMM 107


>gi|83718186|ref|YP_438682.1| ubiquinol oxidase subunit IV [Burkholderia thailandensis E264]
 gi|257141752|ref|ZP_05590014.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
 gi|83652011|gb|ABC36075.1| ubiquinol oxidase, subunit IV [Burkholderia thailandensis E264]
          Length = 110

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 39/104 (37%), Positives = 64/104 (61%), Gaps = 1/104 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  ++GT    + GFILS++LT   FG+V+ G       +   + + A  QI+VHLV+
Sbjct: 7   SHDGEAHGTVGGYVAGFILSVLLTAASFGLVLSGALSSHASLIA-LAVLAFVQIVVHLVY 65

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           FLHM+      W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 66  FLHMNGSSSQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|317047167|ref|YP_004114815.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. At-9b]
 gi|316948784|gb|ADU68259.1| cytochrome o ubiquinol oxidase subunit IV [Pantoea sp. At-9b]
          Length = 109

 Score =  107 bits (267), Expect = 6e-22,   Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            +    +  S+G+ K  ++GFILS+ILT IPF +VM G    K  +   +++CA+ Q++V
Sbjct: 2   SHSATEHGASHGSVKSYMIGFILSIILTAIPFWMVMDGSA-SKGTILAVVLVCAVVQVLV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HLV+FLH+ +K E GW+++A++F  +++ I  VGS+W+M++LN NMM
Sbjct: 61  HLVYFLHLDSKSEGGWNMVAIVFAAVIILIVVVGSLWIMWNLNYNMM 107


>gi|146338788|ref|YP_001203836.1| cytochrome o ubiquinol oxidase subunit IV [Bradyrhizobium sp.
           ORS278]
 gi|146191594|emb|CAL75599.1| cytochrome o ubiquinol oxidase, subunit IV (Ubiquinol oxidase chain
           D) [Bradyrhizobium sp. ORS278]
          Length = 123

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 56/103 (54%), Positives = 75/103 (72%), Gaps = 1/103 (0%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           GT++  L+GF LS++LT IPF +VM G  LDK +  L I+  A  Q++VH++FFLHM+TK
Sbjct: 20  GTRQGQLIGFGLSVVLTAIPFLLVMNGS-LDKQVSALIIMAFAAVQVVVHMIFFLHMNTK 78

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            E GW++MA+IFTIIMV I   GS+WVM+HL  NMM +  M S
Sbjct: 79  AEGGWTMMALIFTIIMVVIALSGSLWVMHHLTTNMMPVHEMGS 121


>gi|28868536|ref|NP_791155.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213968330|ref|ZP_03396474.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato T1]
 gi|301383462|ref|ZP_07231880.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato Max13]
 gi|302060281|ref|ZP_07251822.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato K40]
 gi|302129918|ref|ZP_07255908.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           tomato NCPPB 1108]
 gi|28851774|gb|AAO54850.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|213926968|gb|EEB60519.1| cytochrome o ubiquinol oxidase, subunit IV [Pseudomonas syringae
           pv. tomato T1]
 gi|330873013|gb|EGH07162.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330957415|gb|EGH57675.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           maculicola str. ES4326]
 gi|330963121|gb|EGH63381.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331015175|gb|EGH95231.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 110

 Score =  107 bits (267), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 36/108 (33%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           ++ H+   +S+G+ K  ++GF+LS+ILT IPF +VM    L K++    +++ AI QI+V
Sbjct: 3   NSHHSAEDNSHGSVKSYIIGFVLSVILTAIPFALVMSPM-LPKDMTIAIVLVFAIIQILV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLH+        ++MA  FT +++ +    S+W+++ ++  MM+
Sbjct: 62  HLHYFLHLDFTSVQRNNVMAFAFTTMVIVLLVGLSLWIIFSVHREMMA 109


>gi|187919715|ref|YP_001888746.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia
           phytofirmans PsJN]
 gi|187718153|gb|ACD19376.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia
           phytofirmans PsJN]
          Length = 110

 Score =  106 bits (266), Expect = 8e-22,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 69/109 (63%), Gaps = 2/109 (1%)

Query: 4   DNIHNMNM-HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           D+ HN +   S+G+      GFILS++LT+  FG+VM G    +N +     L  + QI+
Sbjct: 2   DHSHNAHAGESHGSIGSYTTGFILSVVLTVAAFGLVMTGTLTGENALLAIAGLA-LVQIV 60

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           VHL+FFLH++T  E  W++MA  FT++   I   G++WVM++++ +MMS
Sbjct: 61  VHLIFFLHLNTSSEQRWNVMAFAFTLLTAVIVIGGTLWVMHNVSMHMMS 109


>gi|212634274|ref|YP_002310799.1| Quinol oxidase subunit V [Shewanella piezotolerans WP3]
 gi|212555758|gb|ACJ28212.1| Quinol oxidase subunit V [Shewanella piezotolerans WP3]
          Length = 111

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 55/94 (58%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  LVGF+LS++LT IPF  VM   F +K +    ++  A+ QI+VHL +FLH+    E
Sbjct: 19  VKSYLVGFMLSVVLTAIPFWAVMSHHF-EKPLTIALVLGSAVVQIVVHLKYFLHLDFSKE 77

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 78  GKLNTFSFLFTALIIVMVVGLSVWIIYAANALMM 111


>gi|325921009|ref|ZP_08182892.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas gardneri ATCC
           19865]
 gi|325548516|gb|EGD19487.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas gardneri ATCC
           19865]
          Length = 111

 Score =  106 bits (266), Expect = 9e-22,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M   + H     ++ G  K  L+GF++++ILT+IPF +VM G F  K +  + I L A  
Sbjct: 1   MANHHAHETAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVIVISLMAAV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 60  QMLVHMVYFLHMDRSPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|433189|dbj|BAA02483.1| ubiquinol oxidase subunit IV precursor [Acetobacter aceti]
 gi|229365480|dbj|BAH57988.1| ubiquinol oxidase subunit IV [Acetobacter lovaniensis]
          Length = 109

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +   + +  S+G+    ++GF+L+++LT++ FG+VM             I   A+ Q++V
Sbjct: 3   NPHTSSSGESHGSVSSYIIGFVLAVVLTVLSFGVVMTPQ-PSPAGTLAAISALALVQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           HL +FLHM    E  W+ M  +FT+  VAI  VG++++M +  + M
Sbjct: 62  HLHYFLHMGGSSEQRWNNMCFVFTVAFVAILIVGTVFIMNNTEHMM 107


>gi|73538403|ref|YP_298770.1| cytochrome O ubiquinol oxidase subunit IV [Ralstonia eutropha
           JMP134]
 gi|72121740|gb|AAZ63926.1| cyoD2, RSc1861; probable transmembrane cytochrome O ubiquinol
           oxidase (subunit Iv) oxidoreductase protein [Ralstonia
           eutropha JMP134]
          Length = 131

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 34/101 (33%), Positives = 52/101 (51%), Gaps = 1/101 (0%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
           S+G+ +   +GF LSL+LT   FG VM G       +   IV   +AQ++V L FFLH+ 
Sbjct: 22  SHGSPRSYAIGFALSLVLTFASFGAVMSGALPPGMGLP-VIVGLCVAQLLVQLSFFLHLG 80

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
                  +      T  ++ I   GS+WVM++ + NMM  +
Sbjct: 81  IGKGQRGNSGIFACTFGLIVIVIAGSLWVMHNADTNMMPTQ 121


>gi|28198530|ref|NP_778844.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           Temecula1]
 gi|182681209|ref|YP_001829369.1| cytochrome o ubiquinol oxidase subunit IV [Xylella fastidiosa M23]
 gi|28056614|gb|AAO28493.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           Temecula1]
 gi|182631319|gb|ACB92095.1| cytochrome o ubiquinol oxidase subunit IV [Xylella fastidiosa M23]
 gi|307579655|gb|ADN63624.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa
           subsp. fastidiosa GB514]
          Length = 113

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 4/113 (3%)

Query: 1   MKYDNIHNMNMHSYGT---KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +   H+    +       K  L+GF+L++ILT IPF IVM   F  K      +   A
Sbjct: 1   MSHHPHHSSEPTAPSQSTHLKSYLIGFVLAVILTAIPFAIVMNRSF-SKETTVALVSALA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             Q++VHLV+FLHM    E   ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 60  AVQMLVHLVYFLHMDRSKEQRSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|260778346|ref|ZP_05887239.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio coralliilyticus
           ATCC BAA-450]
 gi|260606359|gb|EEX32644.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio coralliilyticus
           ATCC BAA-450]
          Length = 103

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 59/102 (57%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+ H        + GF+ SLILT+IPF  V      D     + +  CA+ QI VH  +F
Sbjct: 1   MDQHLETGASDYVKGFVASLILTVIPFYFVWTQSLPD-TTTYVLLFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|71897568|ref|ZP_00679813.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|71732471|gb|EAO34524.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
          Length = 113

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 4/113 (3%)

Query: 1   MKYDNIHNMNMHSYGT---KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +   H+    +       K  L+GF+L++ILT IPF IVM   F  K      +   A
Sbjct: 1   MSHHPHHSSEPTAPSQSTHLKSYLIGFVLAVILTAIPFAIVMNRSF-SKETTVALVSALA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             Q++VHLV+FLHM    E   ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 60  AVQMLVHLVYFLHMDRSEEQRSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|15837988|ref|NP_298676.1| cytochrome O ubiquinol oxidase, subunit IV [Xylella fastidiosa
           9a5c]
 gi|9106395|gb|AAF84196.1|AE003970_3 cytochrome O ubiquinol oxidase, subunit IV [Xylella fastidiosa
           9a5c]
          Length = 113

 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 64/113 (56%), Gaps = 4/113 (3%)

Query: 1   MKYDNIHNMNMHSYGT---KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +   H+    +       K  L+GF+L++ILT IPF IVM   F  K      +   A
Sbjct: 1   MSHHPHHSSEPAAPSQSTHLKSYLIGFVLAVILTAIPFAIVMNRSF-SKETSVALVSALA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             Q++VHLV+FLHM    E   ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 60  AVQMLVHLVYFLHMDRSKEQRSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|332307456|ref|YP_004435307.1| cytochrome o ubiquinol oxidase subunit IV [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332174785|gb|AEE24039.1| cytochrome o ubiquinol oxidase subunit IV [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 105

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 41/105 (39%), Positives = 65/105 (61%), Gaps = 1/105 (0%)

Query: 6   IHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
            H+    ++G+ K  LVGF+LS+ILT IPF +VM G F  K+++  ++V  AI QI+VHL
Sbjct: 2   SHSAETTAHGSVKSYLVGFVLSVILTGIPFWMVMSGHF-GKSVLFYSVVSFAIVQIVVHL 60

Query: 66  VFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +FLH+   V+      A +FT +++ +    S+W++Y  N  MM
Sbjct: 61  KYFLHLDFSVKGRMDTFAFLFTALIIVMVVGLSIWIIYSANAMMM 105


>gi|329114807|ref|ZP_08243564.1| Ubiquinol oxidase subunit IV [Acetobacter pomorum DM001]
 gi|326695938|gb|EGE47622.1| Ubiquinol oxidase subunit IV [Acetobacter pomorum DM001]
          Length = 110

 Score =  105 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 35/108 (32%), Positives = 62/108 (57%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +   + +  S+G+    ++GF+L+++LT++ FG+VM         +       A+ Q++V
Sbjct: 3   NPHTSSSGESHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAV-SALALVQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HL +FLHM    E  W+ M  +FT+  VAI  VGS+++M +   +MMS
Sbjct: 62  HLHYFLHMGGDSEQRWNNMCFVFTVAFVAILIVGSVFIMNNTALHMMS 109


>gi|288962725|ref|YP_003453019.1| cytochrome o ubiquinol oxidase operon protein [Azospirillum sp.
           B510]
 gi|288914991|dbj|BAI76475.1| cytochrome o ubiquinol oxidase operon protein [Azospirillum sp.
           B510]
          Length = 139

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 54/102 (52%), Positives = 75/102 (73%), Gaps = 1/102 (0%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
             ++GT    ++GF+LS+ILT+IPF +VM G  LD     + ++  A+ QIIVH+V+FLH
Sbjct: 30  AGAHGTFGSYMIGFVLSVILTVIPFWLVMNGT-LDNVTTTVVVLALAVVQIIVHMVYFLH 88

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           M+ + E GWS++AMIFTII+V I F GS+WVMYHLN+NMM  
Sbjct: 89  MNGRAEGGWSMLAMIFTIIVVVIMFSGSLWVMYHLNHNMMPG 130


>gi|114561409|ref|YP_748922.1| cytochrome C oxidase subunit IV [Shewanella frigidimarina NCIMB
           400]
 gi|114332702|gb|ABI70084.1| cytochrome C oxidase subunit IV [Shewanella frigidimarina NCIMB
           400]
          Length = 109

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 36/110 (32%), Positives = 58/110 (52%), Gaps = 1/110 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   +  +       + K  LVGF+LS++LT IPF  VM   F D       +V+ A+ Q
Sbjct: 1   MSNAHASHGEGDFSASVKSYLVGFVLSVVLTGIPFWSVMTHQF-DHMTTLWVVVITALVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHL +FLH+    E   +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 60  IVVHLKYFLHLDFSKEGRINTFSFLFTALIIVMVVGLSVWIIYAANELMM 109


>gi|172061019|ref|YP_001808671.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MC40-6]
 gi|171993536|gb|ACB64455.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MC40-6]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +       A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVVLTAASFGLVMGGVLSPHASLIAL-AALAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|115352155|ref|YP_773994.1| cytochrome C oxidase subunit IV [Burkholderia ambifaria AMMD]
 gi|171318688|ref|ZP_02907832.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MEX-5]
 gi|254252017|ref|ZP_04945335.1| cytochrome o ubiquinol oxidase [Burkholderia dolosa AUO158]
 gi|115282143|gb|ABI87660.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia ambifaria
           AMMD]
 gi|124894626|gb|EAY68506.1| cytochrome o ubiquinol oxidase [Burkholderia dolosa AUO158]
 gi|171096123|gb|EDT41048.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           MEX-5]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 64/111 (57%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +       A  Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVLLTAASFGLVMGGVLSPHASLIAL-AALAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|134296911|ref|YP_001120646.1| cytochrome C oxidase subunit IV [Burkholderia vietnamiensis G4]
 gi|134140068|gb|ABO55811.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia vietnamiensis
           G4]
          Length = 110

 Score =  105 bits (263), Expect = 2e-21,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 66/103 (64%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
            +  ++GT +  +VGF+LS++LT   FG+VM G    K  +    VL   AQI+VHLV F
Sbjct: 8   HHDEAHGTARGYVVGFVLSVLLTAASFGLVMAGVLAPKAAVIALAVLA-FAQILVHLVCF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LHM+T     W++MA  +T++   I  VG++WVM++++ NMMS
Sbjct: 67  LHMNTASSQRWNVMAFSYTVLTALILIVGTLWVMHNVSMNMMS 109


>gi|167585492|ref|ZP_02377880.1| cytochrome C oxidase subunit IV [Burkholderia ubonensis Bu]
          Length = 110

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/103 (41%), Positives = 65/103 (63%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
            +  ++GT    +VGF+LS++LT   FG+VM G    K  +    VL   AQI+VHLV F
Sbjct: 8   HHDEAHGTAGGYIVGFVLSVLLTAASFGLVMGGVLAPKAAVIALAVLA-FAQILVHLVCF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LHM+T     W++MA  +T++   I  VG++WVM++++ NMMS
Sbjct: 67  LHMNTSSSQRWNVMAFSYTVLTALILIVGTLWVMHNVSMNMMS 109


>gi|127511303|ref|YP_001092500.1| cytochrome C oxidase subunit IV [Shewanella loihica PV-4]
 gi|126636598|gb|ABO22241.1| cytochrome C oxidase subunit IV [Shewanella loihica PV-4]
          Length = 108

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 34/110 (30%), Positives = 61/110 (55%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M     H  +  +  + K  L GF+LS++LT IPF  VM    L+ +     +++ A+ Q
Sbjct: 1   MSQATTHGQDDLA-ASIKSYLTGFLLSVVLTGIPFWAVMTHS-LETSTTLAIVLVLAVVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHL +FLH+    E   + ++ +FT +++ +    S+W++Y  N+ MM
Sbjct: 59  ILVHLKYFLHLDFSKEGKVNTLSFMFTALVIVMVVGLSVWIIYAANDLMM 108


>gi|71274827|ref|ZP_00651115.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Dixon]
 gi|71899871|ref|ZP_00682020.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|170729928|ref|YP_001775361.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa M12]
 gi|71164559|gb|EAO14273.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Dixon]
 gi|71730388|gb|EAO32470.1| Prokaryotic Cytochrome C oxidase subunit IV [Xylella fastidiosa
           Ann-1]
 gi|167964721|gb|ACA11731.1| cytochrome O ubiquinol oxidase subunit IV [Xylella fastidiosa M12]
          Length = 113

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 43/113 (38%), Positives = 65/113 (57%), Gaps = 4/113 (3%)

Query: 1   MKYDNIHNMNM--HSYGT-KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M +   H+      S  T  K  L+GF+L++ILT IPF IVM   F  K      +   A
Sbjct: 1   MSHHPHHSSEPTVPSQSTHLKSYLIGFVLAVILTAIPFAIVMNRSF-SKETTVALVSALA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
             Q++VHLV+FLHM    E   ++   +F+++++ I  VGS+WVM++LN +MM
Sbjct: 60  AVQMLVHLVYFLHMDRSEEQRSNVHVALFSLLVIGIVIVGSLWVMHNLNIHMM 112


>gi|113972153|ref|YP_735946.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-4]
 gi|113886837|gb|ABI40889.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-4]
          Length = 113

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 59/109 (54%), Gaps = 2/109 (1%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
            +D+ H  +  +  + K  LVGF LS++LT IPF  VM   F     + + +V  A+ QI
Sbjct: 7   SHDHSHGADDLA-ASIKSYLVGFGLSVVLTAIPFWAVMTHHFEQSTTLAIVVV-TALVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 65  LVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|46446826|ref|YP_008191.1| putative cytochrome O ubiquinol oxidase chain IV cyoD [Candidatus
           Protochlamydia amoebophila UWE25]
 gi|46400467|emb|CAF23916.1| putative cytochrome O ubiquinol oxidase chain IV cyoD [Candidatus
           Protochlamydia amoebophila UWE25]
          Length = 120

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           N+ ++    +GT K  ++GF  SLILT++ F  V     L    +  T++  A+ Q  V 
Sbjct: 6   NLDDVKKEWHGTIKSYVIGFTASLILTLLSFSFVFFK-ILKGQDLVYTLIGFALTQTFVQ 64

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           LVFFLH+  + +  W  +A+ FTI+++ I  +GS+W+M+ LN  MM        H
Sbjct: 65  LVFFLHIGQEPKPRWESIALGFTILILLIVVIGSLWIMHDLNERMMGYMTQEMTH 119


>gi|269964141|ref|ZP_06178438.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
 gi|269831096|gb|EEZ85258.1| conserved hypothetical protein [Vibrio harveyi 1DA3]
          Length = 103

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 57/102 (55%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILT+IPF  V      D       +  CAI QI VH  +F
Sbjct: 1   MEQHLDTGASDYVKGFIASLILTVIPFYCVWAQVLPD-TATYAVLFGCAIVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  E  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTSEGQWNVVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|170745536|ref|YP_001766993.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
 gi|170659137|gb|ACB28191.1| cytochrome o ubiquinol oxidase subunit IV [Methylobacterium
           radiotolerans JCM 2831]
          Length = 182

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 35/95 (36%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            +  L+G  L+ +LT+  F +V   F     +    IV  AIAQ+ VHLVFFLH++T  +
Sbjct: 66  IRGYLIGLALATLLTVCSFAVVHAKFVWAPAVPVAVIV-FAIAQMGVHLVFFLHITTGPD 124

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           +  ++MA+ F ++ V +   GS+W+M ++N+NMM 
Sbjct: 125 NINNVMALAFGVLFVVLLIGGSVWIMSNMNSNMMP 159


>gi|170701549|ref|ZP_02892499.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           IOP40-10]
 gi|170133543|gb|EDT01921.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia ambifaria
           IOP40-10]
          Length = 110

 Score =  105 bits (262), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 65/111 (58%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +  +     +G+    + GFILS++LT   FG+VM G       +       A+ Q
Sbjct: 1   MAHSHS-SQLEEGHGSVGGYVAGFILSVLLTAASFGLVMGGVLSPHASLIAL-AALALVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|148978616|ref|ZP_01815043.1| hypothetical protein VSWAT3_04531 [Vibrionales bacterium SWAT-3]
 gi|145962282|gb|EDK27564.1| hypothetical protein VSWAT3_04531 [Vibrionales bacterium SWAT-3]
          Length = 103

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H     K  ++GF+ SLILTIIPF +V            + +  CA+ QI VH  +F
Sbjct: 1   MEQHLDSGAKDYVIGFVASLILTIIPFYVVWAHALPSTE-TYVVLFGCALVQIFVHFKYF 59

Query: 69  LHMSTKV-EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTTDGQWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|58040344|ref|YP_192308.1| cytochrome o ubiquinol oxidase subunit IV [Gluconobacter oxydans
           621H]
 gi|58002758|gb|AAW61652.1| Cytochrome o ubiquinol oxidase subunit IV [Gluconobacter oxydans
           621H]
          Length = 111

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 61/111 (54%), Gaps = 1/111 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M       M   S+G+    L+GF+L++ILT+  F  VM    L   +    + + A+ Q
Sbjct: 1   MTQAPTTTMTGDSHGSYPSYLIGFVLAVILTVASFAAVMTHA-LSPGMTMAALTVLAVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLVFFLHM+T  E  W++M  IF    V +   G++++M+    NMMS
Sbjct: 60  IVVHLVFFLHMNTSTEQSWNLMCFIFAAASVIVIIGGTIFIMHDTAINMMS 110


>gi|21321322|dbj|BAB97176.1| ubiquinol oxidase subunit IV [Acetobacter pasteurianus]
          Length = 109

 Score =  104 bits (261), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 33/106 (31%), Positives = 60/106 (56%), Gaps = 1/106 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           +   + +  S+G+    ++GF+L+++LT++ FG+VM         +       A+ Q++V
Sbjct: 3   NPHTSSSGESHGSVSSYIIGFVLAVVLTVLSFGVVMSHSLSPAGTLAAV-SALALVQVLV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           HL +FLHM    E  W+ M  +FT+  VAI  VGS+++M +  + M
Sbjct: 62  HLHYFLHMGGDSEQRWNNMCFVFTVAFVAILIVGSVFIMNNTEHMM 107


>gi|90409892|ref|ZP_01217909.1| hypothetical protein P3TCK_03976 [Photobacterium profundum 3TCK]
 gi|90329245|gb|EAS45502.1| hypothetical protein P3TCK_03976 [Photobacterium profundum 3TCK]
          Length = 103

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 41/102 (40%), Positives = 63/102 (61%), Gaps = 1/102 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
            N H+  +      GFI SL+LTIIPF        L   +  + +  CAI Q++VHLV+F
Sbjct: 2   SNQHAQSSMNGYTKGFIGSLVLTIIPFYFAATKM-LPHAVTLVILFACAIVQVVVHLVYF 60

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LHM    +  W++++++FT I+V I   GS+W+M++LN+NMM
Sbjct: 61  LHMDRSEKGQWNLLSLVFTGIVVFILIAGSLWIMWNLNHNMM 102


>gi|84386634|ref|ZP_00989660.1| hypothetical protein V12B01_00852 [Vibrio splendidus 12B01]
 gi|84378440|gb|EAP95297.1| hypothetical protein V12B01_00852 [Vibrio splendidus 12B01]
          Length = 103

 Score =  104 bits (260), Expect = 4e-21,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 57/102 (55%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILTIIPF IV            + +  CA+ QI VH  +F
Sbjct: 1   MEQHLDSGATDYVKGFIASLILTIIPFYIVWAHVLPSTE-TYVILFGCALVQIFVHFKYF 59

Query: 69  LHMST-KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM     +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKSSDGRWNLVSLMFTAIVVLILIAGSVWIIYNMNVNM 101


>gi|153833176|ref|ZP_01985843.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio harveyi HY01]
 gi|148870606|gb|EDL69514.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio harveyi HY01]
          Length = 103

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILT+IPF  V      D       +  CA+ QI VH  +F
Sbjct: 1   MENHLDTGASDYVKGFIASLILTVIPFYCVWAQVLPD-TATYAVLFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  E  W+ ++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTPEGQWNFVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|156976719|ref|YP_001447625.1| cytochrome o ubiquinol oxidase protein CyoD [Vibrio harveyi ATCC
           BAA-1116]
 gi|156528313|gb|ABU73398.1| hypothetical protein VIBHAR_05494 [Vibrio harveyi ATCC BAA-1116]
          Length = 103

 Score =  104 bits (260), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 56/102 (54%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILT+IPF  V      D       +  CA+ QI VH  +F
Sbjct: 1   MENHLDTGASDYVKGFIASLILTVIPFYCVWAQLLPD-TATYAVLFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  E  W+ ++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTPEGQWNFVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|163800404|ref|ZP_02194305.1| hypothetical protein 1103602000595_AND4_06974 [Vibrio sp. AND4]
 gi|159175847|gb|EDP60641.1| hypothetical protein AND4_06974 [Vibrio sp. AND4]
          Length = 103

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 40/102 (39%), Positives = 57/102 (55%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H        + GFI SLILT+IPF  V      D     + +  CA+ QI VH  +F
Sbjct: 1   MESHLDTGASDYVKGFIASLILTVIPFYCVWAKVLPD-AATYVVLFGCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  E  W+ ++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEVKTPEGQWNFVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|312881378|ref|ZP_07741175.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio caribbenthicus
           ATCC BAA-2122]
 gi|309371018|gb|EFP98473.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio caribbenthicus
           ATCC BAA-2122]
          Length = 103

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF +      L   +    +  CAI QI+VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYLAYTKA-LPNGVTYALLFGCAIVQILVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  E  W+I+++ FT I+V I   GS+W++Y++  NM
Sbjct: 60  LHMEAKTSEGQWNIVSLAFTAIIVLILIAGSVWIIYNMTANM 101


>gi|167566667|ref|ZP_02359583.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis EO147]
 gi|167573742|ref|ZP_02366616.1| ubiquinol oxidase, subunit IV [Burkholderia oklahomensis C6786]
          Length = 110

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D   + +  ++GT    + GFILS++LT   FG+V+ G       +       A  QI+V
Sbjct: 3   DTHLSHDGEAHGTVGGYVAGFILSVLLTAASFGLVLSGALSSHASLIAL-AALAFVQIVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           HLV+FLHM+      W++MA  +T++  AI  VG++WVM+++  NMMS
Sbjct: 62  HLVYFLHMNASSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVGMNMMS 109


>gi|282891622|ref|ZP_06300111.1| hypothetical protein pah_c186o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498485|gb|EFB40815.1| hypothetical protein pah_c186o006 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 120

 Score =  104 bits (259), Expect = 6e-21,   Method: Composition-based stats.
 Identities = 36/115 (31%), Positives = 63/115 (54%), Gaps = 1/115 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           ++H++    +GT K   +GFI S+ILT+I F +      L    +  T+V  A+ Q ++ 
Sbjct: 6   SLHDIQREWHGTLKSYAIGFIGSIILTVISFFM-TSAKILSGRFLAYTLVGLALIQAVIQ 64

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           L +FLH+  + +  W  +   F  +++ I  +GS+W+MY LN+ +MS   M   H
Sbjct: 65  LRYFLHLGQETKPRWETIIFYFMFLVLLIIALGSLWIMYDLNDRVMSDIAMGMSH 119


>gi|297620726|ref|YP_003708863.1| putative cytochrome o ubiquinol oxidase, subunit IV [Waddlia
           chondrophila WSU 86-1044]
 gi|297376027|gb|ADI37857.1| putative cytochrome o ubiquinol oxidase, subunit IV [Waddlia
           chondrophila WSU 86-1044]
          Length = 121

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 36/107 (33%), Positives = 55/107 (51%), Gaps = 1/107 (0%)

Query: 13  SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMS 72
            +GT     +GF +SL+ T I F +V    F   +++  TI   A  Q +V L+FFLH+ 
Sbjct: 14  WHGTYLSYGIGFFVSLVFTSISFLLVAYDAFPPVSLIY-TIATLAFLQAVVQLIFFLHLG 72

Query: 73  TKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
            + +  W      F ++++ I  VGS+WVM  LN  MM    M + H
Sbjct: 73  QEGKPHWETFIFFFMLLILLIIVVGSLWVMNDLNERMMPKHNMTAAH 119


>gi|289670391|ref|ZP_06491466.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. musacearum NCPPB4381]
          Length = 111

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 1/108 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + +         G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++
Sbjct: 4   HRHTETAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVVVISVMAAVQML 62

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 63  VHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|296533148|ref|ZP_06895777.1| cytochrome o ubiquinol oxidase subunit IV [Roseomonas cervicalis
           ATCC 49957]
 gi|296266520|gb|EFH12516.1| cytochrome o ubiquinol oxidase subunit IV [Roseomonas cervicalis
           ATCC 49957]
          Length = 123

 Score =  103 bits (258), Expect = 7e-21,   Method: Composition-based stats.
 Identities = 43/109 (39%), Positives = 68/109 (62%), Gaps = 1/109 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           D     + H++G     L G + SL LT +PF IV+ G+ L + +    ++L A+AQ+ V
Sbjct: 15  DPAAAQSAHAHGDALGYLRGLLWSLALTALPFAIVLGGW-LPRELAVPAVLLLAVAQMAV 73

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           HLV+FLH+ T   + W++MA +FT ++V I  +GS+WVM +L+ NMM  
Sbjct: 74  HLVYFLHLRTAPGERWTLMAFLFTAVVVGIVVIGSLWVMQNLDANMMPG 122


>gi|254500701|ref|ZP_05112852.1| cytochrome o ubiquinol oxidase subunit IV [Labrenzia alexandrii
           DFL-11]
 gi|222436772|gb|EEE43451.1| cytochrome o ubiquinol oxidase subunit IV [Labrenzia alexandrii
           DFL-11]
          Length = 104

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +   + +    L GF L+++LT IPFG+V  G      +    I   A+ Q++VHLVF
Sbjct: 3   HTDHTEHRSLGTYLTGFALAIVLTAIPFGLVWTGALTGPAV-YGVIAAAAVIQVLVHLVF 61

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLH++ K   G ++  + F  +++ I   GS+W+M+ L++ MM
Sbjct: 62  FLHLNFKSTPGENLFFLAFAAVLICIMVGGSLWIMFDLHHRMM 104


>gi|21230619|ref|NP_636536.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66769385|ref|YP_244147.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|188992572|ref|YP_001904582.1| Cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. B100]
 gi|21112200|gb|AAM40460.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66574717|gb|AAY50127.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167734332|emb|CAP52542.1| Cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. campestris]
          Length = 111

 Score =  103 bits (258), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 39/108 (36%), Positives = 68/108 (62%), Gaps = 1/108 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           + +  N      G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  Q++
Sbjct: 4   HHHTENAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVIVISVMAAVQML 62

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 63  VHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|153837559|ref|ZP_01990226.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio parahaemolyticus
           AQ3810]
 gi|149749056|gb|EDM59867.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio parahaemolyticus
           AQ3810]
 gi|328470437|gb|EGF41348.1| hypothetical protein VP10329_06552 [Vibrio parahaemolyticus 10329]
          Length = 103

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF  V     L  +   + +  CA+ QI VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYFVWAQT-LPASTTYVVMFTCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKTSDGRWNLVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|186472485|ref|YP_001859827.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
 gi|184194817|gb|ACC72781.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia phymatum
           STM815]
          Length = 113

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 41/113 (36%), Positives = 68/113 (60%), Gaps = 3/113 (2%)

Query: 1   MKYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M + N H ++  + +G     +VGF+L+++LT   FGIVM+G+ L      L +   A+ 
Sbjct: 1   MAHSNSHALDAEAGHGGIGGYVVGFVLAVVLTAAAFGIVMQGW-LPAAYAPLVLAALAVV 59

Query: 60  QIIVHLVFFLHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           QI+VHLV FLHMS       W+ +A+ +T++       G++WVM++++ NMMS
Sbjct: 60  QIVVHLVCFLHMSVSTSGQRWNTLALAYTVLAAMFLVFGTVWVMHNVSMNMMS 112


>gi|21242014|ref|NP_641596.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|78046866|ref|YP_363041.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|294627029|ref|ZP_06705619.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294664345|ref|ZP_06729709.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325928656|ref|ZP_08189835.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas perforans
           91-118]
 gi|21107412|gb|AAM36132.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas axonopodis
           pv. citri str. 306]
 gi|78035296|emb|CAJ22941.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
 gi|292598691|gb|EFF42838.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292605885|gb|EFF49172.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|325540984|gb|EGD12547.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas perforans
           91-118]
          Length = 111

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 70/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M   +  +    ++ G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  
Sbjct: 1   MANHHHTDTAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTIVVISVMAAV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 60  QMLVHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|134296073|ref|YP_001119808.1| cytochrome C oxidase subunit IV [Burkholderia vietnamiensis G4]
 gi|134139230|gb|ABO54973.1| cytochrome bo3 quinol oxidase subunit 4 [Burkholderia vietnamiensis
           G4]
          Length = 110

 Score =  103 bits (257), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 63/111 (56%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M + +   M    +G+      GFILS++LT   FG+V+ G       +       A  Q
Sbjct: 1   MAHSHSSQM-EEGHGSVGGYFAGFILSVLLTAASFGLVLGGVLSPHASLIAL-AALAFVQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           I+VHLV+FLHM+      W++MA  +T++  AI  VG++WVM++++ NMMS
Sbjct: 59  IVVHLVYFLHMNGSSGQRWNVMAFSYTVLTAAILIVGTLWVMHNVSMNMMS 109


>gi|28900485|ref|NP_800140.1| hypothetical protein VPA0630 [Vibrio parahaemolyticus RIMD 2210633]
 gi|260365638|ref|ZP_05778159.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           K5030]
 gi|260877438|ref|ZP_05889793.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AN-5034]
 gi|260898919|ref|ZP_05907360.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           Peru-466]
 gi|260901247|ref|ZP_05909642.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AQ4037]
 gi|28808865|dbj|BAC61973.1| hypothetical protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308089178|gb|EFO38873.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           Peru-466]
 gi|308090840|gb|EFO40535.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AN-5034]
 gi|308106803|gb|EFO44343.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           AQ4037]
 gi|308111444|gb|EFO48984.1| cytochrome o ubiquinol oxidase, subunit IV [Vibrio parahaemolyticus
           K5030]
          Length = 103

 Score =  102 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M  H   +    + GF+ SLILT+IPF  V     L  +   + +  CA+ QI VH  +F
Sbjct: 1   MGQHVETSSSDYVKGFVASLILTVIPFYFVWAQT-LPASATYVVMFTCALVQIFVHFKYF 59

Query: 69  LHMSTK-VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM  K  +  W++++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKTSDGRWNLVSLMFTAIVVLILIAGSIWIIYNMNVNM 101


>gi|58581255|ref|YP_200271.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84623175|ref|YP_450547.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188575779|ref|YP_001912708.1| cytOchrome o ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae PXO99A]
 gi|289662732|ref|ZP_06484313.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas campestris
           pv. vasculorum NCPPB702]
 gi|58425849|gb|AAW74886.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84367115|dbj|BAE68273.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188520231|gb|ACD58176.1| cytOchrome o ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzae PXO99A]
          Length = 111

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M   +       ++ G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  
Sbjct: 1   MANHHHTETAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVVVISVMAAV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 60  QMLVHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|89073979|ref|ZP_01160485.1| cytochrome o ubiquinol oxidase subunit IV [Photobacterium sp.
           SKA34]
 gi|89050307|gb|EAR55811.1| cytochrome o ubiquinol oxidase subunit IV [Photobacterium sp.
           SKA34]
          Length = 112

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/113 (38%), Positives = 72/113 (63%), Gaps = 1/113 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H     ++G+ K+ L G ILS+ILT++PF +VM G    K ++   I++ A+AQ
Sbjct: 1   MANSSEHGQGGQAHGSVKEYLNGLILSIILTVVPFAMVMAG-IGSKPLIIGVIMVFAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           I V LV+FLHM+   +  W+  + +F +++VAI  +GS+W+M HLN+NM+   
Sbjct: 60  IFVQLVYFLHMNASSKQMWNTSSAVFVVVIVAIILIGSLWIMEHLNHNMLMGH 112


>gi|89072118|ref|ZP_01158714.1| hypothetical protein SKA34_08788 [Photobacterium sp. SKA34]
 gi|89052219|gb|EAR57670.1| hypothetical protein SKA34_08788 [Photobacterium sp. SKA34]
          Length = 103

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+          + GFI SLI+T+IPF  V    F +       ++ CAI QI VH  +F
Sbjct: 1   MDQQLEVNTSDYVKGFIASLIITVIPFYCVWAKIFTE-ATTYAVLLGCAIVQIFVHFKYF 59

Query: 69  LHMST-KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LHM     E  W+I++++FT I+V I   GS+W++Y++N NM
Sbjct: 60  LHMEAKSSEGKWNIVSLMFTSIVVLILIAGSVWIIYNMNVNM 101


>gi|325914849|ref|ZP_08177184.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538940|gb|EGD10601.1| cytochrome bo3 quinol oxidase subunit 4 [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 111

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 69/111 (62%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M   +       ++ G  K  L+GF++++ILT+IPF +VM G F  K +  + I + A  
Sbjct: 1   MANHHHTETAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTIVVISVMAAV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 60  QMLVHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|166713085|ref|ZP_02244292.1| cytochrome O ubiquinol oxidase subunit IV [Xanthomonas oryzae pv.
           oryzicola BLS256]
          Length = 111

 Score =  102 bits (255), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 39/111 (35%), Positives = 68/111 (61%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M   +       ++ G  K  L+GF++++ILT+IPF +VM G F  K +    I + A  
Sbjct: 1   MANHHHTETAADAHAGGLKSYLIGFVMAVILTVIPFAMVMSGAF-SKGVTVTVISVMAAV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q++VH+V+FLHM    E   ++   +F+++++ I  VGS+WV++++N NMM
Sbjct: 60  QMLVHMVYFLHMDRTPEQRSNVQVGLFSLLIIGIVIVGSLWVLHNMNVNMM 110


>gi|90579540|ref|ZP_01235349.1| cytochrome o ubiquinol oxidase subunit IV [Vibrio angustum S14]
 gi|90439114|gb|EAS64296.1| cytochrome o ubiquinol oxidase subunit IV [Vibrio angustum S14]
          Length = 112

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 45/113 (39%), Positives = 73/113 (64%), Gaps = 1/113 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   + H     ++G+ K+ L G ILS+ILT++PF +VM G    K ++   I++ A+AQ
Sbjct: 1   MANSSEHGQGGQAHGSVKEYLNGLILSIILTVVPFVMVMAG-IGSKPLIIGVIMVFAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           I V LV+FLHM+T  +  W+  + +F +++VAI  +GS+W+M HLN+NM+   
Sbjct: 60  IFVQLVYFLHMNTSSKQMWNTSSAVFVVVIVAIILIGSLWIMEHLNHNMLMGH 112


>gi|260769714|ref|ZP_05878647.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio furnissii CIP
           102972]
 gi|260615052|gb|EEX40238.1| cytochrome O ubiquinol oxidase subunit IV [Vibrio furnissii CIP
           102972]
 gi|315182290|gb|ADT89203.1| cytOchrome o ubiquinol oxidase subunit IV [Vibrio furnissii NCTC
           11218]
          Length = 104

 Score =  101 bits (253), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 44/103 (42%), Positives = 63/103 (61%), Gaps = 2/103 (1%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
            N H    K   + GFI SLILTIIPF  V     L + +    +  CAI Q+ VH V+F
Sbjct: 2   SNQHVDSGKSDYIKGFIASLILTIIPFYFVATQS-LPEAVTFALMFGCAIVQVFVHFVYF 60

Query: 69  LHMSTKVE-DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           LHM T+ E   W++++++FT ++V I   GS+W+M++LN NMM
Sbjct: 61  LHMETRTEDGRWNLVSLMFTALVVLILIGGSIWIMWNLNINMM 103


>gi|319424516|gb|ADV52590.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella putrefaciens
           200]
          Length = 113

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 61/109 (55%), Gaps = 7/109 (6%)

Query: 8   NMNMHSYG------TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           + + HS+G      + K  L+GF+LS++LT IPF  VM   F +K      +++ AI QI
Sbjct: 6   HTDKHSHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHF-EKATTLSLVLVMAIVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 65  VVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|170724797|ref|YP_001758823.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella woodyi ATCC
           51908]
 gi|169810144|gb|ACA84728.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella woodyi ATCC
           51908]
          Length = 111

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G+ K  L+GF+LS++LT IPF  V+   F DK +    +++ A+ QI+VHL +FLH+   
Sbjct: 17  GSVKSYLMGFMLSVVLTAIPFWAVITHHF-DKPVTLGLVLVTAVVQIVVHLKYFLHLDFS 75

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            E   +  + +FT +++ +    S+W++Y  N+ MM
Sbjct: 76  KEGKLNTFSFLFTALIIVMVVGLSVWIIYAANDLMM 111


>gi|326793470|ref|YP_004311290.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas mediterranea
           MMB-1]
 gi|326544234|gb|ADZ89454.1| cytochrome o ubiquinol oxidase subunit IV [Marinomonas mediterranea
           MMB-1]
          Length = 108

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 38/107 (35%), Positives = 64/107 (59%), Gaps = 2/107 (1%)

Query: 5   NIHNMNMH-SYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
           + H+ + H ++G+    +VGF+LS++LT+IPF  VM   F D+  +   IV+ A+ QI V
Sbjct: 2   SQHDHDSHDAHGSVSSYVVGFVLSVVLTVIPFWAVMTSAF-DRATLFAVIVVTAVVQIFV 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           HL +FLH++   E     ++ IFT I++ +    S+W++Y     MM
Sbjct: 61  HLKYFLHLNFTKEGKLDTLSFIFTAIIIIMVVALSIWIIYESVLMMM 107


>gi|92118914|ref|YP_578643.1| cytochrome C oxidase subunit IV [Nitrobacter hamburgensis X14]
 gi|91801808|gb|ABE64183.1| cytochrome bo3 quinol oxidase subunit 4 [Nitrobacter hamburgensis
           X14]
          Length = 113

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 52/94 (55%), Gaps = 1/94 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+G +L+L LT IPFG+V            + I + AIAQ++VHL +FLH+  K 
Sbjct: 20  TIKSYLIGVVLALALTAIPFGLVAAHTLPPIQ-TFVIIGVAAIAQVVVHLRYFLHLDFKP 78

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
                ++A+ F  +++ I   G++W+M+     M
Sbjct: 79  SSQNKLVALCFAAVVLLILVGGTLWIMFDRYYRM 112


>gi|330502492|ref|YP_004379361.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas mendocina
           NK-01]
 gi|328916778|gb|AEB57609.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas mendocina
           NK-01]
          Length = 111

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 44/112 (39%), Positives = 71/112 (63%), Gaps = 5/112 (4%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKG--FFLDKNIMCLTIVLCAI 58
           M + + H  +       K  L GFILS+ILT+IPF +VM      L +    +T+VL  +
Sbjct: 1   MAHQDNHAAHAVG---FKDYLTGFILSVILTVIPFMLVMHPEVLGLSRGATLITVVLFGL 57

Query: 59  AQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           AQ++VHLV+FLHM T  E  W++++MIFT++++A     S+W+M+ ++ +MM
Sbjct: 58  AQVLVHLVYFLHMKTDAEGRWNVVSMIFTVLIIAFVVGLSVWIMWSMHYHMM 109


>gi|114049401|ref|YP_739951.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-7]
 gi|113890843|gb|ABI44894.1| cytochrome C oxidase subunit IV [Shewanella sp. MR-7]
          Length = 113

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  LVGF+LS++LT IPF  VM   F     + + +V  A+ QI+VHL +FLH+    
Sbjct: 20  SIKSYLVGFVLSVVLTAIPFWAVMTHHFEQSTTLAIVVV-TALVQILVHLKYFLHLDFSK 78

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 79  EGKINTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|312964549|ref|ZP_07778805.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           2362-75]
 gi|312290783|gb|EFR18660.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           2362-75]
 gi|323191347|gb|EFZ76610.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           RN587/1]
 gi|330910221|gb|EGH38731.1| cytochrome O ubiquinol oxidase subunit 4 [Escherichia coli AA86]
          Length = 91

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 46/90 (51%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ QI+VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQILVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIIAILVVGSIWIMWNLNYNMM 89


>gi|153002719|ref|YP_001368400.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS185]
 gi|151367337|gb|ABS10337.1| Cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS185]
          Length = 113

 Score =  101 bits (252), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 2   KYDNIHNMNMHSY---GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAI 58
            + + H  +  +     + K  L+GF+LS++LT IPF  VM   F +K      +++ AI
Sbjct: 3   AHSHTHKPSHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHF-EKATTLSLVLVMAI 61

Query: 59  AQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            QI+VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 62  VQIVVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|120596925|ref|YP_961499.1| cytochrome C oxidase subunit IV [Shewanella sp. W3-18-1]
 gi|160877455|ref|YP_001556771.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS195]
 gi|217975292|ref|YP_002360043.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS223]
 gi|120557018|gb|ABM22945.1| cytochrome C oxidase subunit IV [Shewanella sp. W3-18-1]
 gi|160862977|gb|ABX51511.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS195]
 gi|217500427|gb|ACK48620.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS223]
 gi|315269657|gb|ADT96510.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS678]
          Length = 113

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 7/109 (6%)

Query: 8   NMNMHSYG------TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           + +  S+G      + K  L+GF+LS++LT IPF  VM   F +K      +++ AI QI
Sbjct: 6   HTDKPSHGTDDLAASIKSYLMGFVLSVVLTAIPFWAVMTHHF-EKATTLSLVLVMAIVQI 64

Query: 62  IVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 65  VVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|301025684|ref|ZP_07189200.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           196-1]
 gi|312970524|ref|ZP_07784705.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           1827-70]
 gi|299879996|gb|EFI88207.1| cytOchrome o ubiquinol oxidase subunit IV [Escherichia coli MS
           196-1]
 gi|310337173|gb|EFQ02311.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           1827-70]
 gi|315616631|gb|EFU97248.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 3431]
 gi|320181589|gb|EFW56504.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella boydii ATCC
           9905]
 gi|320197133|gb|EFW71750.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli
           WV_060327]
 gi|320201673|gb|EFW76249.1| Cytochrome O ubiquinol oxidase subunit IV [Escherichia coli
           EC4100B]
 gi|323157117|gb|EFZ43241.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           EPECa14]
 gi|323160461|gb|EFZ46409.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli
           E128010]
 gi|323164228|gb|EFZ50035.1| cytochrome o ubiquinol oxidase subunit IV [Shigella sonnei 53G]
 gi|323170514|gb|EFZ56164.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli LT-68]
 gi|323178303|gb|EFZ63881.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia coli 1180]
 gi|325498280|gb|EGC96139.1| cytochrome o ubiquinol oxidase subunit IV [Escherichia fergusonii
           ECD227]
 gi|332085679|gb|EGI90843.1| cytochrome o ubiquinol oxidase subunit IV [Shigella dysenteriae
           155-74]
 gi|332098563|gb|EGJ03529.1| cytochrome o ubiquinol oxidase subunit IV [Shigella boydii 3594-74]
 gi|332760715|gb|EGJ91003.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           4343-70]
 gi|332761669|gb|EGJ91948.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           2747-71]
 gi|332763720|gb|EGJ93958.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-671]
 gi|332768345|gb|EGJ98529.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri
           2930-71]
 gi|333007851|gb|EGK27327.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-218]
 gi|333010886|gb|EGK30312.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-272]
 gi|333021384|gb|EGK40637.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-227]
 gi|333021987|gb|EGK41233.1| cytochrome o ubiquinol oxidase subunit IV [Shigella flexneri K-304]
          Length = 91

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 45/90 (50%), Positives = 69/90 (76%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++AI  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIIAILVVGSIWIMWNLNYNMM 89


>gi|146294942|ref|YP_001185366.1| cytochrome C oxidase subunit IV [Shewanella putrefaciens CN-32]
 gi|145566632|gb|ABP77567.1| cytochrome C oxidase subunit IV [Shewanella putrefaciens CN-32]
          Length = 113

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 35/110 (31%), Positives = 60/110 (54%), Gaps = 2/110 (1%)

Query: 2   KYDNIHNMNMHS-YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
            + + H+    S   + K  L+GF+LS++LT IPF  VM   F +K      +++ AI Q
Sbjct: 5   SHTDKHSHGTDSLAASIKSYLMGFVLSVVLTAIPFWAVMTHHF-EKATTLSLVLVMAIVQ 63

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I+VHL +FLH+    E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 64  IVVHLKYFLHLDFSKEGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|304412072|ref|ZP_07393682.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS183]
 gi|307305967|ref|ZP_07585713.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           BA175]
 gi|304349622|gb|EFM14030.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           OS183]
 gi|306911460|gb|EFN41886.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella baltica
           BA175]
          Length = 113

 Score =  100 bits (251), Expect = 5e-20,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  L+GF+LS++LT IPF  VM   F +K      +++ AI QI+VHL +FLH+    
Sbjct: 20  SIKSYLMGFVLSVVLTAIPFWAVMTHHF-EKATTLSLVLVMAIVQIVVHLKYFLHLDFSK 78

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           E   +  + +FT +++ +    S+W++   N  MM
Sbjct: 79  EGKVNTFSFLFTALIIVMVVGLSVWIILEANALMM 113


>gi|254234442|ref|ZP_04927765.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           C3719]
 gi|126166373|gb|EAZ51884.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           C3719]
          Length = 111

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
              H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++V
Sbjct: 3   SAAHDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           HL+ FLHM+   E  W++MA IFT+I++ +    S+W+++  +  MM M 
Sbjct: 62  HLICFLHMNKSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|320186058|gb|EFW60803.1| Cytochrome O ubiquinol oxidase subunit IV [Shigella flexneri CDC
           796-83]
          Length = 91

 Score =  100 bits (249), Expect = 8e-20,   Method: Composition-based stats.
 Identities = 44/90 (48%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + GFILS+ILT+IPF +VM G      ++  TI+  A+ Q++VHLV FLHM+TK ++GW+
Sbjct: 1   MTGFILSIILTVIPFWMVMTGAA-SPAVILGTILAMAVVQVLVHLVCFLHMNTKSDEGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + A +FT++++ I  VGS+W+M++LN NMM
Sbjct: 60  MTAFVFTVLIITILVVGSIWIMWNLNYNMM 89


>gi|300690265|ref|YP_003751260.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           PSI07]
 gi|299077325|emb|CBJ49951.1| cytochrome o ubiquinol oxidase, subunit IV [Ralstonia solanacearum
           PSI07]
          Length = 121

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 66/90 (73%), Gaps = 1/90 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T K  L+GF+L++ILT+IPF +VM G F    ++ +T++  A+ QI+VHL++FLH+    
Sbjct: 26  TVKGYLIGFVLAVILTVIPFKMVMGGGFSHGTVL-VTVMALAVVQIVVHLIYFLHLDGSS 84

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
              W++MA +FT++++AI  VGS+WVM+++
Sbjct: 85  SQRWNVMAFLFTLLILAIVIVGSLWVMHNM 114


>gi|294143095|ref|YP_003559073.1| cytochrome o ubiquinol oxidase subunit IV [Shewanella violacea
           DSS12]
 gi|7657998|dbj|BAA94867.1| quinol oxidase subunit V [Shewanella violacea]
 gi|293329564|dbj|BAJ04295.1| cytochrome o ubiquinol oxidase, subunit IV [Shewanella violacea
           DSS12]
          Length = 111

 Score = 99.1 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 36/95 (37%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  LVGF+LS+ILT IPF  VM   F +K I    +++ A+ QI+VHL +FLH+    
Sbjct: 18  SVKSYLVGFLLSVILTGIPFWAVMTHHF-EKPITLGLVLVMAVVQIVVHLKYFLHLDFSK 76

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           E   +  + +FT +++ +    S+W++Y  N  MM
Sbjct: 77  EGKINTFSFLFTALIMVMVMGLSVWIIYAANALMM 111


>gi|121602245|ref|YP_989521.1| cytochrome o ubiquinol oxidase, subunit IV [Bartonella
           bacilliformis KC583]
 gi|120614422|gb|ABM45023.1| cytochrome o ubiquinol oxidase, subunit IV [Bartonella
           bacilliformis KC583]
          Length = 123

 Score = 98.7 bits (245), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 8/115 (6%)

Query: 2   KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIA 59
           +++  H+       + +  LVGF+L++I T   F  VM G      I    I  +  AI 
Sbjct: 3   EHNETHDP------SIRSYLVGFVLAVIFTFCSFIPVMYGMLEGWAISTKVIYLIGMAII 56

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           QIIV ++FFLH+++  +  W+ +A+ F +  V I   G+ W + HLN NMM   G
Sbjct: 57  QIIVQIIFFLHLNSGPDAKWNFVALWFAVTCVTIIIGGTWWAISHLNYNMMGGSG 111


>gi|330819565|ref|YP_004348427.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia gladioli
           BSR3]
 gi|327371560|gb|AEA62915.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia gladioli
           BSR3]
          Length = 126

 Score = 98.7 bits (245), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 1/99 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           GT K  ++G ILS++LT + FG VM      +      IV+  +AQ+IV L +FLH+ T 
Sbjct: 19  GTLKGYVIGMILSVLLTFVSFGAVMTDIV-PRGWGLAAIVVACVAQLIVQLFYFLHIGTA 77

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
                +    + T  ++A+    S+WV+++ N NMM   
Sbjct: 78  RSQRANTGIFLCTGFLIAVIVGLSLWVIHNANVNMMPTH 116


>gi|15596517|ref|NP_250011.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAO1]
 gi|107100771|ref|ZP_01364689.1| hypothetical protein PaerPA_01001799 [Pseudomonas aeruginosa PACS2]
 gi|116049272|ref|YP_791925.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152984607|ref|YP_001349424.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PA7]
 gi|218892575|ref|YP_002441444.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           LESB58]
 gi|254239692|ref|ZP_04933014.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           2192]
 gi|296390303|ref|ZP_06879778.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAb1]
 gi|81541485|sp|Q9I424|CYOD_PSEAE RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD; AltName:
           Full=Cytochrome o ubiquinol oxidase subunit IV
 gi|9947258|gb|AAG04709.1|AE004561_5 cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PAO1]
 gi|115584493|gb|ABJ10508.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126193070|gb|EAZ57133.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           2192]
 gi|150959765|gb|ABR81790.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           PA7]
 gi|218772803|emb|CAW28588.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           LESB58]
          Length = 111

 Score = 98.3 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 40/110 (36%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
              H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++V
Sbjct: 3   SAAHDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           HL+ FLHM+   E  W++MA IFT+I++ +    S+W+++  +  MM M 
Sbjct: 62  HLICFLHMNMSSEGRWNVMAFIFTVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|193212540|ref|YP_001998493.1| cytochrome o ubiquinol oxidase subunit IV [Chlorobaculum parvum
           NCIB 8327]
 gi|193086017|gb|ACF11293.1| cytochrome o ubiquinol oxidase subunit IV [Chlorobaculum parvum
           NCIB 8327]
          Length = 108

 Score = 97.9 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 65/110 (59%), Gaps = 2/110 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M+  +I N     + + K  + GFIL+++LTII F +V+ G    K I  + +   A AQ
Sbjct: 1   MEQTHIENTATE-HVSYKNYITGFILAVVLTIISFSLVLTGVV-PKQIAVIGLFAAAAAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           I VHL +FLH+ +     W+++ + FT +++ I   G++WV++ LN+ MM
Sbjct: 59  IAVHLYYFLHLDSSKSQRWNVITISFTALLLFIFIAGTIWVIHTLNSRMM 108


>gi|319405035|emb|CBI78645.1| cytochrome o ubiquinol oxidase subunit IV (fragment) [Bartonella
           sp. AR 15-3]
          Length = 135

 Score = 97.5 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 41/114 (35%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTI--VLCAIAQ 60
           YD  H+            LVGFILS++ T+  F  VM G      I    I  +  A+ Q
Sbjct: 4   YDKNHDPG------IGSYLVGFILSVLFTLGSFIPVMYGLLDSWAISTKVIYLIGMALIQ 57

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           II+ +VFFLH+S+  +  W++ A++F  + V I   G+ W + HLN NMM   G
Sbjct: 58  IIIQIVFFLHLSSGPDAKWNLAALLFAAMCVFIIIGGTWWAISHLNYNMMGSSG 111


>gi|20378346|gb|AAM20917.1|AF439739_4 cytochrome bo subunit D [Vitreoscilla sp. C1]
          Length = 103

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 47/103 (45%), Positives = 67/103 (65%), Gaps = 2/103 (1%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + N H  G+ KQ +VGFI+S+ILT+IPFG+VM G    K I   T+V+   AQ+ V LVF
Sbjct: 3   SHNNHDAGSVKQYVVGFIISIILTVIPFGMVMGGM--PKGITVATLVITMFAQVWVQLVF 60

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLHM  +    W I +  +T + +AI FVGS+W++  L++ MM
Sbjct: 61  FLHMKREDAQRWHIASFWYTFLTIAILFVGSVWILSELHSFMM 103


>gi|319778050|ref|YP_004134480.1| cytochrome o ubiquinol oxidase subunit iv [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317171769|gb|ADV15306.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 136

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G     ++G+ L+++LTI  F            ++   +V  A+AQ+ VHLVFFLH++T 
Sbjct: 31  GGLLGYVIGYGLAILLTIASFLAAQTDLIYQPAVISALVV-LAVAQMGVHLVFFLHLTTG 89

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            ++  +I+A+ F +++VA+  +GS+W+M HLN NM +M   ++
Sbjct: 90  PDNTNNILALAFGVLIVALVVLGSVWIMAHLNENMAAMTAHQA 132


>gi|148254209|ref|YP_001238794.1| cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. BTAi1]
 gi|146406382|gb|ABQ34888.1| cytochrome bb3 quinol oxidase subunit 4 [Bradyrhizobium sp. BTAi1]
          Length = 130

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 37/116 (31%), Positives = 63/116 (54%), Gaps = 5/116 (4%)

Query: 8   NMNMHSYGTKKQ----CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
                 +G  +      + G  L+++LT   F I         +I    IV  AIAQ+ V
Sbjct: 15  APGEQQHGDLRSRILFHVAGLGLAVLLTAASFFIAGTNLVWQPSIPVALIV-LAIAQMGV 73

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           HLVFFLH++T  ++  +++A+ F +I+V +   GS+W+M +LN+NMM M+ +  + 
Sbjct: 74  HLVFFLHITTGPDNTNNVLALAFGLIIVFLVVGGSLWIMSNLNHNMMPMDPLMQMQ 129


>gi|240849796|ref|YP_002971184.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella grahamii
           as4aup]
 gi|240266919|gb|ACS50507.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella grahamii
           as4aup]
          Length = 182

 Score = 97.5 bits (242), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 8   NMNMHSYG-TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLT--IVLCAIAQIIVH 64
           +M   ++G +    LVGFIL++  T+  F  VM G      +      ++  AI QIIV 
Sbjct: 2   SMQNETHGPSTGSYLVGFILAVFFTLGSFVPVMYGMMESWAVSTKVAYLLGMAIIQIIVQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VFFLH+++  +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 62  IVFFLHLNSGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGGSG 111


>gi|260459333|ref|ZP_05807588.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium
           opportunistum WSM2075]
 gi|259034887|gb|EEW36143.1| cytochrome o ubiquinol oxidase subunit IV [Mesorhizobium
           opportunistum WSM2075]
          Length = 136

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 63/103 (61%), Gaps = 1/103 (0%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G     ++G+ L+++LTI  F            ++   +V  A+AQ+ VHLVFFLH++T 
Sbjct: 31  GGLLGYVIGYGLAILLTIASFLAAQTDLIYQPAVISALVV-LAVAQMGVHLVFFLHLTTG 89

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRS 117
            ++  +I+A+ F +++VA+  +GS+W+M HLN NM +M   ++
Sbjct: 90  PDNTNNILALAFGVLIVALVVLGSVWIMAHLNENMAAMTAHQA 132


>gi|308070783|ref|YP_003872388.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Paenibacillus polymyxa E681]
 gi|305860062|gb|ADM71850.1| Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Paenibacillus polymyxa E681]
          Length = 111

 Score = 96.4 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 33/95 (34%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  S+G+ K  ++GFILS++LTIIP G+VM    L +    + I+  A+ Q +V L F
Sbjct: 11  HGHDDSHGSVKSYVIGFILSIVLTIIPLGVVMNHM-LSRTSTMVVILAAAVLQFLVQLFF 69

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           F+H+       W++M +IF ++++     GS+W+M
Sbjct: 70  FMHIRESNGPRWNVMTLIFGVVILLTVVGGSVWIM 104


>gi|323529725|ref|YP_004231877.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1001]
 gi|323386727|gb|ADX58817.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1001]
          Length = 110

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 60/103 (58%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
               ++G+ +  + GF+LS+ LT   F +VM+G F  +  M   + + A  QI+VHL FF
Sbjct: 8   SADSNHGSVRGYVCGFVLSVALTAAAFWLVMRGAFPAQTAMIA-LSVLAFVQIVVHLAFF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LH+       W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 67  LHVDMSARQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|170692897|ref|ZP_02884059.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia graminis
           C4D1M]
 gi|170142553|gb|EDT10719.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia graminis
           C4D1M]
          Length = 110

 Score = 95.6 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 37/103 (35%), Positives = 60/103 (58%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
                +G+ +  L GF+LS++LT   F +VM G F  +  M   + + A  QI+VHLVFF
Sbjct: 8   SADQGHGSLRGYLAGFVLSVVLTAAAFWLVMHGAFPAQTAMIA-LSVLAFVQIVVHLVFF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LH+       W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 67  LHIDMSAGQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|239906128|ref|YP_002952867.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio magneticus
           RS-1]
 gi|239795992|dbj|BAH74981.1| cytochrome o ubiquinol oxidase subunit IV [Desulfovibrio magneticus
           RS-1]
          Length = 107

 Score = 95.2 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 36/109 (33%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M +    N      GT K   +GF  S++LT++ FG+VM G  L +  + L +   A+ Q
Sbjct: 1   MSHSPTDNAGAAV-GTVKSYALGFAASVVLTLVSFGLVMGGA-LPRLPLILALFALAVIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           + V L +FLH+       W++MA++FT  ++ +   GS+W+MY L+  M
Sbjct: 59  LFVQLRYFLHVDRSSAMYWNLMALLFTFFLMFLFIGGSIWIMYGLHERM 107


>gi|313106309|ref|ZP_07792553.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           39016]
 gi|310879055|gb|EFQ37649.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas aeruginosa
           39016]
          Length = 111

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 39/110 (35%), Positives = 67/110 (60%), Gaps = 1/110 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
              H+ +   +G+     +GF+LS+ILT IPF +VM G F  ++   LT+V+  + Q++V
Sbjct: 3   SAAHDNHGAGHGSLGSYAIGFVLSVILTAIPFYMVMDGGF-SRHATILTMVVLGLVQVVV 61

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSME 113
           HL+ FLHM+   E  W++MA IF +I++ +    S+W+++  +  MM M 
Sbjct: 62  HLICFLHMNMSSEGRWNVMAFIFMVIVILLVVGLSLWIIFSADMLMMPMP 111


>gi|310644019|ref|YP_003948777.1| cytochrome o ubiquinol oxidase subunit iv [Paenibacillus polymyxa
           SC2]
 gi|309248969|gb|ADO58536.1| Cytochrome o ubiquinol oxidase subunit IV [Paenibacillus polymyxa
           SC2]
          Length = 111

 Score = 95.2 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 32/95 (33%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           + +  S+G+ K  ++GFILS++LTIIP  +VM    L +    + I+  A+ Q +V L F
Sbjct: 11  HGHDDSHGSVKSYVIGFILSIVLTIIPLFVVMNHM-LSRTSTMVVILAAAVLQFLVQLFF 69

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           F+H+       W++M +IF ++++     GS+W+M
Sbjct: 70  FMHIRESNGPRWNVMTLIFGVVILLTVVGGSVWIM 104


>gi|307725994|ref|YP_003909207.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1003]
 gi|307586519|gb|ADN59916.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1003]
          Length = 110

 Score = 94.8 bits (235), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 35/103 (33%), Positives = 59/103 (57%), Gaps = 1/103 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
                +G+    + GF+LS++LT   F +VM+G  L      + + + A  QI+VHLVFF
Sbjct: 8   SAESGHGSTGGYVCGFVLSVVLTAAAFWLVMRGA-LPAQTAMIALSVLAFVQIVVHLVFF 66

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           LH+       W++MA+ +T +       G++WVM++++ NMMS
Sbjct: 67  LHIDMSAGQRWNVMALAYTALAALFLIGGTVWVMHNVSMNMMS 109


>gi|293607262|ref|ZP_06689603.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter piechaudii
           ATCC 43553]
 gi|292814354|gb|EFF73494.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter piechaudii
           ATCC 43553]
          Length = 116

 Score = 94.4 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 40/105 (38%), Positives = 67/105 (63%), Gaps = 1/105 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V 
Sbjct: 9   HGHDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMHGA-LSHTITIIGVVALCVLQLLVQ 67

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LV+FLHM +  E   ++ A +FT++++AI   GS WV+Y++N NM
Sbjct: 68  LVYFLHMGSSKESRDNLSAFVFTVLIIAIIVGGSAWVLYNMNVNM 112


>gi|33519707|ref|NP_878539.1| cytochrome O ubiquinol oxidase subunit CyoD [Candidatus Blochmannia
           floridanus]
 gi|33504052|emb|CAD83313.1| cytochrome O ubiquinol oxidase subunit CyoD [Candidatus Blochmannia
           floridanus]
          Length = 100

 Score = 93.3 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 40/95 (42%), Positives = 63/95 (66%), Gaps = 1/95 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K   +GFILSLI TIIPF I+    F ++    + ++ CAI QI +HL++FLH++    
Sbjct: 7   IKHYCIGFILSLIFTIIPFYIIQHNCF-EQQTSYIIVIFCAITQIYIHLIYFLHLNQISN 65

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
             W+++++IFT  +V I   GS+W+M HL++N+MS
Sbjct: 66  QMWNVISLIFTTFIVLILITGSIWIMTHLHHNLMS 100


>gi|187477294|ref|YP_785318.1| cytochrome O ubiquinol oxidase subunit IV [Bordetella avium 197N]
 gi|115421880|emb|CAJ48399.1| cytochrome O ubiquinol oxidase subunit IV [Bordetella avium 197N]
          Length = 113

 Score = 93.3 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 69/110 (62%), Gaps = 1/110 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   +        +G+ K  ++GFILS+ILT+  F +VM G F  + ++   I++  + Q
Sbjct: 1   MSAHHDAAHADGGHGSLKSYIIGFILSIILTLGSFWLVMNGTF-SRPLVLGGILVLCVVQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           ++V LVFF+HM T   +  ++ A +FT++++AI   GS+WV++++N NM+
Sbjct: 60  LLVQLVFFMHMGTAKSEQDNLSAFLFTVMIIAIIVGGSIWVLHNMNANML 109


>gi|295701244|ref|YP_003610245.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
 gi|295441567|gb|ADG20734.1| cytochrome o ubiquinol oxidase subunit IV [Burkholderia sp.
           CCGE1002]
          Length = 108

 Score = 92.9 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 33/101 (32%), Positives = 58/101 (57%), Gaps = 1/101 (0%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
             S+G+  + L GF LS++LT   FG+ +     D     + I +    Q++VHLV FLH
Sbjct: 8   AGSHGSLTRYLAGFFLSVLLTAGAFGVGLYDAI-DATTAMIAIAVLGFLQVVVHLVCFLH 66

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++     GW+++++ +TI+  A   +G++WVM ++   MMS
Sbjct: 67  LTLSPGQGWNVLSLCYTILAAAFLILGTVWVMRNVEMLMMS 107


>gi|251794161|ref|YP_003008892.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus sp. JDR-2]
 gi|247541787|gb|ACS98805.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus sp. JDR-2]
          Length = 110

 Score = 92.5 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 32/105 (30%), Positives = 63/105 (60%), Gaps = 4/105 (3%)

Query: 1   MKYDNIHNMNM---HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCA 57
           M   N H        S+G+ K  ++GF++S++LTI+P  +V+    +DK    + I++ A
Sbjct: 1   MANPNTHGHGHDEHESHGSMKSYVIGFVISIVLTILPLVVVLNDM-MDKTPTLIFILIMA 59

Query: 58  IAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           + Q +V L FF+H+  + +  +++MA+IF ++++     GS+W+M
Sbjct: 60  VLQFVVQLFFFMHLREEKKPRYNVMALIFGLVILVTIIAGSIWIM 104


>gi|238791422|ref|ZP_04635060.1| hypothetical protein yinte0001_25730 [Yersinia intermedia ATCC
           29909]
 gi|238729038|gb|EEQ20554.1| hypothetical protein yinte0001_25730 [Yersinia intermedia ATCC
           29909]
          Length = 84

 Score = 92.1 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 1/82 (1%)

Query: 29  ILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTI 88
           ILT+IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT 
Sbjct: 2   ILTVIPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFTA 60

Query: 89  IMVAICFVGSMWVMYHLNNNMM 110
           +++AI  VGS+W+MY+LN NMM
Sbjct: 61  MIIAIVVVGSLWIMYNLNINMM 82


>gi|317403853|gb|EFV84327.1| cytochrome o ubiquinol oxidase subunit IV [Achromobacter
           xylosoxidans C54]
          Length = 116

 Score = 91.4 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 38/105 (36%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V 
Sbjct: 9   HGHDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMSGA-LSHTITIIGVVALCVLQLLVQ 67

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LV+FLHM        ++   +FT++++AI   GS WV+Y++N NM
Sbjct: 68  LVYFLHMGASKSARDNLATFVFTVMIIAIIVGGSAWVLYNMNVNM 112


>gi|57340142|gb|AAW50058.1| hypothetical protein FTT0284 [synthetic construct]
          Length = 145

 Score = 91.0 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M  +++++ +   +YGT K  + GF+LS+++T I F +V     L    +C+T+ + A+ 
Sbjct: 27  MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFK-LLSPVALCVTVAVLAVV 85

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+ V LVFFLH+ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 86  QLFVQLVFFLHLSTDSKARWNLVSAIFAIIVVVIVVAGTMWIMFDLYDMMM 136


>gi|311108452|ref|YP_003981305.1| cytochrome O ubiquinol oxidase subunit IV 1 [Achromobacter
           xylosoxidans A8]
 gi|310763141|gb|ADP18590.1| cytochrome O ubiquinol oxidase subunit IV 1 [Achromobacter
           xylosoxidans A8]
          Length = 116

 Score = 90.6 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 64/105 (60%), Gaps = 1/105 (0%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           + H+ +   +G+ K  ++GF+LSL+LT   FG+VM G  L   I  + +V   + Q++V 
Sbjct: 9   HGHDDHAADHGSLKSYIIGFVLSLLLTFGSFGLVMNGG-LSHTITIIGVVALCVLQLLVQ 67

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LV+FLHM        ++   +FT+++++I   GS WV+Y++N NM
Sbjct: 68  LVYFLHMGASKSARDNLATFVFTLMIISIIVGGSAWVLYNMNVNM 112


>gi|226310782|ref|YP_002770676.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
 gi|226093730|dbj|BAH42172.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
          Length = 105

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 61/102 (59%), Gaps = 2/102 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M     H  + HS+G+ K+ ++GFILS++LTIIP  +VM    L K    + I++ A+ Q
Sbjct: 1   MAQHQNHGGH-HSHGSMKEYVIGFILSIVLTIIPLVLVMN-SILSKTATMIAILVMAVLQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
            ++ LVFF+H+    +  +++  +I  +++V     GS+W+M
Sbjct: 59  FVIQLVFFMHIREGEKPRYNVQTLILGLVIVITIVAGSLWIM 100


>gi|329296774|ref|ZP_08254110.1| Cytochrome o ubiquinol oxidase protein cyoD [Plautia stali
           symbiont]
          Length = 91

 Score = 90.6 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 39/91 (42%), Positives = 67/91 (73%), Gaps = 1/91 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GFILS+ILT IPF +VM G      I+ + +V   +  ++VHLV+FLH+ +K E GW+
Sbjct: 1   MIGFILSIILTAIPFWMVMDGSASHGTILGVVLVCAVVQ-VLVHLVYFLHLDSKSEGGWN 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++A++F+ +++ I  +GS+W+M++LN NMM+
Sbjct: 60  MVAIVFSAVIILIVVIGSLWIMWNLNYNMMA 90


>gi|319760377|ref|YP_004124315.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           vafer str. BVAF]
 gi|318039091|gb|ADV33641.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           vafer str. BVAF]
          Length = 100

 Score = 90.2 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 43/100 (43%), Positives = 66/100 (66%), Gaps = 1/100 (1%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
           M++  +     +GF+LSLILTIIPF  +    F DK I+ +  + CA+ QI +HLV+FLH
Sbjct: 1   MNNNNSNTSYFIGFVLSLILTIIPFYTIQYNIF-DKKILLIITISCALIQIYIHLVYFLH 59

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           +    +  W I ++IFTI +V I  +GS+W+M HL++N+M
Sbjct: 60  LIHISDRKWIITSLIFTIFIVFILVLGSVWIMTHLHHNLM 99


>gi|49473795|ref|YP_031837.1| cytochrome o ubiquinol oxidase subunit IV [Bartonella quintana str.
           Toulouse]
 gi|49239298|emb|CAF25624.1| Cytochrome o ubiquinol oxidase subunit IV [Bartonella quintana str.
           Toulouse]
          Length = 168

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 8   NMNMHSY-GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLT--IVLCAIAQIIVH 64
           +M+  ++  +     VGFIL++  T+  F  VM G      I      ++  AI QIIV 
Sbjct: 2   SMHNETHIPSTSSYFVGFILAVFFTLGSFIPVMYGMMESWAISTKVAYLIGMAIIQIIVQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +VFFLH++   +  W++ A+ F  I V +   G+ W + HLN NMM   G
Sbjct: 62  IVFFLHLNAGPDAKWNLSALWFAAICVFVIIGGTWWAISHLNYNMMGSSG 111


>gi|162147816|ref|YP_001602277.1| cytochrome o ubiquinol oxidase protein cyoD [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209542439|ref|YP_002274668.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786393|emb|CAP55975.1| putative cytochrome o ubiquinol oxidase protein cyoD
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530116|gb|ACI50053.1| cytochrome o ubiquinol oxidase subunit IV [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 110

 Score = 89.8 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 20  CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGW 79
            L GF++S++LT   FG+VM   F     +    +L    Q++VHLVFFLHM+T  E  W
Sbjct: 19  YLTGFVISVVLTAAAFGVVMAHSFSPSGTIAAIAILA-AVQVVVHLVFFLHMNTSSEQRW 77

Query: 80  SIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           ++MA +FT+  V I  VG++++M+    NMMS
Sbjct: 78  NVMAFVFTVTAVLILIVGTVFIMHDTAINMMS 109


>gi|209808983|ref|YP_002264521.1| cytochrome o ubiquinol oxidase subunit CyoD [Aliivibrio salmonicida
           LFI1238]
 gi|208010545|emb|CAQ80914.1| cytochrome o ubiquinol oxidase subunit CyoD [Aliivibrio salmonicida
           LFI1238]
          Length = 109

 Score = 89.0 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 63/105 (60%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M    +   +    G  K  + GFI SLILT+IPF     G  L + +  + ++L AIAQ
Sbjct: 1   MANQFVSGSDQQDLG-AKGYITGFIASLILTMIPFYFAYTGV-LSREVTIVVLILSAIAQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           ++VHL +FLHM +  +  +++++ +FT ++V I   GS+W+M++L
Sbjct: 59  LVVHLFYFLHMDSTEKGRFNMLSFVFTAVIVFIVIAGSIWIMWNL 103


>gi|238759271|ref|ZP_04620438.1| hypothetical protein yaldo0001_8190 [Yersinia aldovae ATCC 35236]
 gi|238702558|gb|EEP95108.1| hypothetical protein yaldo0001_8190 [Yersinia aldovae ATCC 35236]
          Length = 80

 Score = 88.7 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 1/78 (1%)

Query: 33  IPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVA 92
           IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+ K E+ W+++A +FT +++A
Sbjct: 2   IPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGKSEERWNLVAFLFTAMIIA 60

Query: 93  ICFVGSMWVMYHLNNNMM 110
           I  VGS+W+MY+LN NMM
Sbjct: 61  IVVVGSLWIMYNLNINMM 78


>gi|209363942|ref|YP_002268300.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212212544|ref|YP_002303480.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuG_Q212]
 gi|212218407|ref|YP_002305194.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuK_Q154]
 gi|215919090|ref|YP_002332979.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii RSA 493]
 gi|206583975|gb|ACI15270.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii RSA 493]
 gi|207081875|gb|ACI23138.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212010954|gb|ACJ18335.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuG_Q212]
 gi|212012669|gb|ACJ20049.1| cytochrome O ubiquinol oxidase protein [Coxiella burnetii
           CbuK_Q154]
          Length = 111

 Score = 88.3 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 38/106 (35%), Positives = 61/106 (57%), Gaps = 6/106 (5%)

Query: 10  NMHSYGTKKQ----CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHL 65
           +  SYGT K+     +VG IL +ILT++ F  VM   F     +   I + A+ Q IV +
Sbjct: 6   SEESYGTGKKKLSIYIVGMILCVILTLVSFMTVMYSAFPP-TTLVAIIFVSALIQFIVQV 64

Query: 66  VFFLHMSTKVED-GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           V FL ++ K E    ++M+ IFTI+++ +   GS+W+M+ L+  MM
Sbjct: 65  VCFLRLNAKNEQSRMNLMSFIFTIVILFVLIGGSLWIMWSLHYRMM 110


>gi|260430480|ref|ZP_05784453.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
 gi|260418509|gb|EEX11766.1| cytOchrome o ubiquinol oxidase subunit IV [Citreicella sp. SE45]
          Length = 99

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 34/92 (36%), Positives = 57/92 (61%), Gaps = 1/92 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           +  LVGF L+L LT++PF +V  G  +    + +TI + A+AQI VHL FFLH+    + 
Sbjct: 9   RMYLVGFGLALTLTLVPFALVHWG-LMQGRTLAITIAVLAVAQIAVHLRFFLHIDLSRQK 67

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
              +  ++FT++++AI   G++W+M +L   M
Sbjct: 68  REDLQLILFTVLLLAIMAFGTLWIMGNLATRM 99


>gi|328675366|gb|AEB28041.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella cf. novicida
           3523]
          Length = 110

 Score = 87.9 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M  +++++ +   +YGT K  + GF+LS+++T I F +V     L    +C+T+ + A+ 
Sbjct: 1   MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFALVGFK-LLSPVALCVTVAVLAVV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+ V LVFFLH+ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 60  QLFVQLVFFLHLSTDSKARWNLVSAIFAIIVVIIVVAGTMWIMFDLYDMMM 110


>gi|21623361|gb|AAM67996.1| cytochrome o ubiquinol oxidase D [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 123

 Score = 87.9 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  +VGF+ SL LTIIPF   +   F  + I    I+LCA++QII+H ++FLH+    ++
Sbjct: 31  KSYIVGFLFSLFLTIIPFFCTLNHLF-SRKINFFVILLCALSQIIIHFIYFLHLDFSKKN 89

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
            W+I++++F +I+V I   GS+W+MY+LN+++
Sbjct: 90  SWNIISLLFILIIVFIIVFGSIWIMYNLNHHV 121


>gi|218514775|ref|ZP_03511615.1| putative cytochrome o ubiquinol oxidase protein CyoD [Rhizobium
          etli 8C-3]
          Length = 91

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 43/77 (55%)

Query: 2  KYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQI 61
           +    + +   +GT K  + GF+LS+ILT IPF +VM G      +  + ++     QI
Sbjct: 14 AHHGHSHGHQAGHGTFKSYMAGFVLSVILTAIPFWLVMSGVIASPALTAVLVMGLGAVQI 73

Query: 62 IVHLVFFLHMSTKVEDG 78
          +VH++FFLHM+T+    
Sbjct: 74 VVHMIFFLHMNTRERGR 90


>gi|110635861|ref|YP_676069.1| cytochrome C oxidase subunit IV [Mesorhizobium sp. BNC1]
 gi|110286845|gb|ABG64904.1| cytochrome bo3 quinol oxidase subunit 4 [Chelativorans sp. BNC1]
          Length = 103

 Score = 87.5 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 34/94 (36%), Positives = 53/94 (56%), Gaps = 1/94 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           +  Q L GF+L+L+LT IPF IV  G    +      + + A+ Q+ VHL +FLHM+   
Sbjct: 10  SLTQYLTGFVLALVLTAIPFAIVATGAA-PRAQSLAVVTVAAVVQVFVHLWYFLHMNFST 68

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
               +I+A  F  I++ I   GS W+M+ L++ M
Sbjct: 69  TPRENILAFAFAAILILIMLGGSFWIMFDLHSRM 102


>gi|238783618|ref|ZP_04627639.1| hypothetical protein yberc0001_14010 [Yersinia bercovieri ATCC
           43970]
 gi|238715496|gb|EEQ07487.1| hypothetical protein yberc0001_14010 [Yersinia bercovieri ATCC
           43970]
          Length = 80

 Score = 87.5 bits (216), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 56/78 (71%), Gaps = 1/78 (1%)

Query: 33  IPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVA 92
           IPF +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT +++A
Sbjct: 2   IPFAMVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFTAMIIA 60

Query: 93  ICFVGSMWVMYHLNNNMM 110
           I  VGS+W+MY+LN NMM
Sbjct: 61  IVVVGSLWIMYNLNINMM 78


>gi|146339413|ref|YP_001204461.1| cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. ORS278]
 gi|146192219|emb|CAL76224.1| Cytochrome O ubiquinol oxidase protein subunit IV [Bradyrhizobium
           sp. ORS278]
          Length = 135

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 33/89 (37%), Positives = 52/89 (58%), Gaps = 1/89 (1%)

Query: 31  TIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIM 90
           T   F I         +I    IV  AIAQ+ VHLVFFLH++T  ++  +++A+ F +I+
Sbjct: 47  TATSFFIAGTHLVWRPSIPVALIV-LAIAQMGVHLVFFLHITTGPDNTNNVLALAFGLII 105

Query: 91  VAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           V +   GS+W+M +LN+NMM M  +  + 
Sbjct: 106 VVLVVGGSLWIMANLNHNMMPMTQLMQMQ 134


>gi|149189685|ref|ZP_01867967.1| hypothetical protein VSAK1_06650 [Vibrio shilonii AK1]
 gi|148836497|gb|EDL53452.1| hypothetical protein VSAK1_06650 [Vibrio shilonii AK1]
          Length = 103

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 31/88 (35%), Positives = 54/88 (61%), Gaps = 2/88 (2%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK-VED 77
             + GF  +L+LT++PF +V     L  +     +  CAI Q+ VH  +FLHM  K  + 
Sbjct: 11  DYIKGFCAALVLTVVPFYLVWAQS-LPASTTYFVLFACAIVQVFVHFKYFLHMEAKTSDG 69

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            W++++++FTI++V I   GS+W+MY++
Sbjct: 70  QWNLVSLLFTIVVVFILIAGSLWIMYNM 97


>gi|30410824|ref|NP_660785.2| cytochrome O ubiquinol oxidase D [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
 gi|25008334|sp|Q8K996|CYOD_BUCAP RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
          Length = 108

 Score = 86.7 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 64/92 (69%), Gaps = 1/92 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           K  +VGF+ SL LTIIPF   +   F  + I    I+LCA++QII+H ++FLH+    ++
Sbjct: 16  KSYIVGFLFSLFLTIIPFFCTLNHLF-SRKINFFVILLCALSQIIIHFIYFLHLDFSKKN 74

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
            W+I++++F +I+V I   GS+W+MY+LN+++
Sbjct: 75  SWNIISLLFILIIVFIIVFGSIWIMYNLNHHV 106


>gi|254368561|ref|ZP_04984577.1| hypothetical protein FTAG_01545 [Francisella tularensis subsp.
           holarctica FSC022]
 gi|157121464|gb|EDO65655.1| hypothetical protein FTAG_01545 [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 110

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M  +++++ +   +YGT K  + GF+LS+++T I F +V     L    +C+T+ + A+ 
Sbjct: 1   MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFK-LLSPVALCVTVAVLAVV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+ V LVFFLH+ST  +  W++++ IF I++V I   G+MW+M+ L + MM
Sbjct: 60  QLFVQLVFFLHLSTDSKARWNLVSAIFAIVVVVIVVAGTMWIMFDLYDMMM 110


>gi|56707438|ref|YP_169334.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110669909|ref|YP_666466.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118496812|ref|YP_897862.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. novicida U112]
 gi|134302622|ref|YP_001122593.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|187932181|ref|YP_001892166.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194324507|ref|ZP_03058279.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida FTE]
 gi|208780573|ref|ZP_03247912.1| cytochrome o ubiquinol oxidase subunit IV [Francisella novicida
           FTG]
 gi|224456518|ref|ZP_03664991.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370869|ref|ZP_04986874.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC033]
 gi|254372176|ref|ZP_04987668.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida GA99-3549]
 gi|254373657|ref|ZP_04989141.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3548]
 gi|254874275|ref|ZP_05246985.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|54113735|gb|AAV29501.1| NT02FT0909 [synthetic construct]
 gi|56603930|emb|CAG44917.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis SCHU S4]
 gi|110320242|emb|CAL08300.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC198]
 gi|118422718|gb|ABK89108.1| cytochrome bo terminal oxidase subunit IV [Francisella novicida
           U112]
 gi|134050399|gb|ABO47470.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis WY96-3418]
 gi|151569112|gb|EDN34766.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis FSC033]
 gi|151569906|gb|EDN35560.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3549]
 gi|151571379|gb|EDN37033.1| cytochrome O ubiquinol oxidase subunit IV [Francisella novicida
           GA99-3548]
 gi|187713090|gb|ACD31387.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|194321342|gb|EDX18828.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. novicida FTE]
 gi|208743548|gb|EDZ89853.1| cytochrome o ubiquinol oxidase subunit IV [Francisella novicida
           FTG]
 gi|254840274|gb|EET18710.1| cytochrome bo terminal oxidase subunit IV [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|282158580|gb|ADA77971.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. tularensis NE061598]
 gi|328676274|gb|AEB27144.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella cf. novicida
           Fx1]
          Length = 110

 Score = 86.7 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/111 (36%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M  +++++ +   +YGT K  + GF+LS+++T I F +V     L    +C+T+ + A+ 
Sbjct: 1   MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFK-LLSPVALCVTVAVLAVV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+ V LVFFLH+ST  +  W++++ IF II+V I   G+MW+M+ L + MM
Sbjct: 60  QLFVQLVFFLHLSTDSKARWNLVSAIFAIIVVVIVVAGTMWIMFDLYDMMM 110


>gi|89255628|ref|YP_512989.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica LVS]
 gi|115314132|ref|YP_762855.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica OSU18]
 gi|156501577|ref|YP_001427642.1| cytochrome C oxidase/ubiquinol oxidase subunit IV [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167009930|ref|ZP_02274861.1| cytOchrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica FSC200]
 gi|254367022|ref|ZP_04983058.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica 257]
 gi|290953473|ref|ZP_06558094.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica URFT1]
 gi|295313271|ref|ZP_06803908.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica URFT1]
 gi|89143459|emb|CAJ78635.1| Cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica LVS]
 gi|115129031|gb|ABI82218.1| cytochrome o ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica OSU18]
 gi|134252848|gb|EBA51942.1| cytochrome O ubiquinol oxidase subunit IV [Francisella tularensis
           subsp. holarctica 257]
 gi|156252180|gb|ABU60686.1| cytochrome C oxidase/ubiquinol oxidase subunit IV [Francisella
           tularensis subsp. holarctica FTNF002-00]
          Length = 110

 Score = 86.3 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/111 (36%), Positives = 71/111 (63%), Gaps = 2/111 (1%)

Query: 1   MKYDNIHNMN-MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIA 59
           M  +++++ +   +YGT K  + GF+LS+++T I F +V     L    +C+T+ + A+ 
Sbjct: 1   MAKEHLYDHDTGAAYGTHKSYIQGFVLSVVITTIAFVLVGFK-LLSPVALCVTVAILAVV 59

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           Q+ V LVFFLH+ST  +  W++++ IF I++V I   G+MW+M+ L + MM
Sbjct: 60  QLFVQLVFFLHLSTDSKARWNLVSAIFAIVVVVIVVAGTMWIMFDLYDMMM 110


>gi|226314759|ref|YP_002774655.1| quinol oxidase polypeptide IV [Brevibacillus brevis NBRC 100599]
 gi|226097709|dbj|BAH46151.1| probable quinol oxidase polypeptide IV [Brevibacillus brevis NBRC
           100599]
          Length = 105

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 30/108 (27%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           +        +G+ K  ++GF+LSLI TIIP  + ++  +LD +   +  +  A+ Q IV 
Sbjct: 2   HGTTEQHGGHGSLKSYVIGFVLSLIFTIIP-ILALENGWLDSDKRLIIYLGAALFQFIVQ 60

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSM 112
           L FF+H+  + +  +++M+++  + +V +  +GS+W+M     NM+++
Sbjct: 61  LFFFMHLKEEDKPRYNLMSLLLGLFIVFLIVIGSIWIMM---YNMVAL 105


>gi|71892023|ref|YP_277753.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|71796129|gb|AAZ40880.1| cytochrome o ubiquinol oxidase, subunit IV [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 100

 Score = 85.6 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 67/95 (70%), Gaps = 1/95 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T+K  L+GF+LSL+LTI+PF +V       K ++ + +  C+I QII+HL+FFLH+    
Sbjct: 6   TQKSYLIGFVLSLVLTIVPFFMVTHDTINKKILINIIVF-CSIMQIIIHLIFFLHLGNVS 64

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W+++++IFTI +V I  +GS+W+M HL++N+M
Sbjct: 65  NQAWNLISLIFTIFIVFILVLGSVWIMTHLHHNLM 99


>gi|54296268|ref|YP_122637.1| cytochrome o ubiquinol oxidase subunit IV [Legionella pneumophila
           str. Paris]
 gi|53750053|emb|CAH11445.1| Cytochrome o ubiquinol oxidase subunit IV [Legionella pneumophila
           str. Paris]
          Length = 112

 Score = 85.2 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 35/111 (31%), Positives = 60/111 (54%), Gaps = 6/111 (5%)

Query: 5   NIHNMNMHSYGTKKQ----CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
             H +    YGT ++     LVGFI    LT+  F +VM   F    ++ L I   A  Q
Sbjct: 2   EHHGIKEPDYGTGQKKLGLYLVGFISCTFLTLFSFWVVMSHIFSKTEVLTL-IFSSACIQ 60

Query: 61  IIVHLVFFLHMSTKVEDGW-SIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
            +V ++ FL +ST+ + G  ++M  +FT +++    +GS+W+M++LN  M+
Sbjct: 61  FLVQVICFLRLSTQTQQGRTNVMTFLFTGVILTSIILGSLWIMWNLNYYMV 111


>gi|114330709|ref|YP_746931.1| cytochrome C oxidase subunit IV [Nitrosomonas eutropha C91]
 gi|114307723|gb|ABI58966.1| cytochrome bo3 quinol oxidase subunit 4 [Nitrosomonas eutropha C91]
          Length = 116

 Score = 84.0 bits (207), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 26/93 (27%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             + GF L+L LT++PF +V     + ++ + +TI + A+ Q +VH  +FLH+  K +  
Sbjct: 25  SYMWGFGLALGLTLVPFALVQWQA-MARDPLLITIAVLALVQTVVHFRYFLHLDRKRK-R 82

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
             ++ ++F+  ++ I   G++W+M +L   M  
Sbjct: 83  EDLLLVLFSTSLLIIMVAGTIWIMANLAERMTP 115


>gi|304407875|ref|ZP_07389526.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus
           curdlanolyticus YK9]
 gi|304343358|gb|EFM09201.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus
           curdlanolyticus YK9]
          Length = 109

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/87 (35%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           + K  ++GFI+S++LTIIP  +VM    + KN   + I++ A+ Q  V L FF+H+    
Sbjct: 17  SLKSYVIGFIMSIVLTIIPLVVVMNDM-MSKNGTIVLILILAVLQFAVQLWFFMHLKEGE 75

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
              W+I A++F I+++ +   GS+W+M
Sbjct: 76  NAKWNIAALLFAILILVVVVAGSIWIM 102


>gi|32490899|ref|NP_871153.1| hypothetical protein WGLp150 [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|25166105|dbj|BAC24296.1| cyoD [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 109

 Score = 82.9 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 31/95 (32%), Positives = 57/95 (60%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
             K   +G+ILS   T IPF +++  + L   ++   I++CA +Q I+   FFL++    
Sbjct: 15  NNKSYFIGYILSFFFTCIPFLLIINKWNLYNELIYNLIIICAFSQAIIQFTFFLNIFDNS 74

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
              W ++++ FTI+++ I   GS+W+M HL++N+M
Sbjct: 75  RINWKLISLTFTILIIFILIFGSIWIMNHLHHNLM 109


>gi|118591209|ref|ZP_01548608.1| Prokaryotic Cytochrome C oxidase subunit IV [Stappia aggregata IAM
           12614]
 gi|118436285|gb|EAV42927.1| Prokaryotic Cytochrome C oxidase subunit IV [Stappia aggregata IAM
           12614]
          Length = 101

 Score = 82.5 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 32/101 (31%), Positives = 54/101 (53%), Gaps = 1/101 (0%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           MN  +  +    L GF+L+++LT IPF +V  G      +  +  V   +  +IVHLVFF
Sbjct: 1   MNHSAERSLSTYLTGFVLAVLLTAIPFALVWGGLLAGSAVYAVIAVAAVLQ-VIVHLVFF 59

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           LH+  K     ++  + F  +++ I   GS+W+M  L++ M
Sbjct: 60  LHIDLKSTPAENLFFLAFAAVLIFIMVGGSLWIMMDLHHRM 100


>gi|238795551|ref|ZP_04639066.1| hypothetical protein ymoll0001_11420 [Yersinia mollaretii ATCC
           43969]
 gi|238720670|gb|EEQ12471.1| hypothetical protein ymoll0001_11420 [Yersinia mollaretii ATCC
           43969]
          Length = 75

 Score = 81.7 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 36/74 (48%), Positives = 53/74 (71%), Gaps = 1/74 (1%)

Query: 37  IVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFV 96
           +VM G      I+  T+V  A+ QIIVHLV+FLHM+   E+ W+++A +FT +++AI  V
Sbjct: 1   MVMSGTASHTTILA-TVVGLAVVQIIVHLVYFLHMNGSSEERWNLVAFLFTAMIIAIVVV 59

Query: 97  GSMWVMYHLNNNMM 110
           GS+W+MY+LN NMM
Sbjct: 60  GSLWIMYNLNINMM 73


>gi|254472570|ref|ZP_05085969.1| cytochrome o ubiquinol oxidase subunit IV [Pseudovibrio sp. JE062]
 gi|211958034|gb|EEA93235.1| cytochrome o ubiquinol oxidase subunit IV [Pseudovibrio sp. JE062]
          Length = 99

 Score = 81.3 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 34/102 (33%), Positives = 59/102 (57%), Gaps = 3/102 (2%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
           M+  S+ + K+ + GFIL+L LT+IPF  V    F    +    I LCA+ Q+ VHL +F
Sbjct: 1   MHPQSH-SAKRLITGFILALALTLIPFAAVWTMAF-PVELTFGIIALCALVQVGVHLHYF 58

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           L + ++     +++AM F  +++ +   G++W+M+ L   MM
Sbjct: 59  LGIDSRT-PIENVLAMSFAGVLIFLMVGGTLWIMFDLYERMM 99


>gi|330993478|ref|ZP_08317413.1| Cytochrome o ubiquinol oxidase protein CyoD [Gluconacetobacter sp.
           SXCC-1]
 gi|329759508|gb|EGG76017.1| Cytochrome o ubiquinol oxidase protein CyoD [Gluconacetobacter sp.
           SXCC-1]
          Length = 84

 Score = 81.0 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 33/83 (39%), Positives = 53/83 (63%), Gaps = 1/83 (1%)

Query: 29  ILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTI 88
           ILT+  FG+VM    +  +     I L A+ QI+VHL++FLHM+   E  W++MA +FT+
Sbjct: 2   ILTVAAFGLVMSHA-MSPSATGGAIALLAVVQIVVHLIYFLHMNGSSEQRWNVMAFVFTV 60

Query: 89  IMVAICFVGSMWVMYHLNNNMMS 111
           + V +   G+M++M+  + NMMS
Sbjct: 61  LSVLVLVAGTMFIMHDTSINMMS 83


>gi|294851454|ref|ZP_06792127.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
 gi|294820043|gb|EFG37042.1| conserved hypothetical protein [Brucella sp. NVSL 07-0026]
          Length = 73

 Score = 80.2 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 48/62 (77%)

Query: 51  LTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + ++  A  QI+VHL++FLH+  K E GW+++A++FT I++AI  +GS+W+MYHL+ NMM
Sbjct: 1   MIVLAIAAVQILVHLIYFLHLDPKSEGGWNMLALVFTGIILAIVLIGSIWIMYHLDTNMM 60

Query: 111 SM 112
            M
Sbjct: 61  PM 62


>gi|315646201|ref|ZP_07899321.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus vortex
           V453]
 gi|315278400|gb|EFU41716.1| cytochrome o ubiquinol oxidase subunit IV [Paenibacillus vortex
           V453]
          Length = 107

 Score = 79.4 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 28/102 (27%), Positives = 60/102 (58%), Gaps = 2/102 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M   N H      +G+ K   +GF  S+ILT+IP  +VM  + L+     + ++  A+ Q
Sbjct: 1   MVPSNSH-QTPEGHGSFKSYTIGFFCSIILTLIPITVVMNDW-LEGTWNSVVLMTAAVLQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           ++V L+FF+H+  + +  +++++++  ++++ +   GSMW+M
Sbjct: 59  LMVQLLFFMHLREENKPRYNLISLVLGLVILLVIVAGSMWIM 100


>gi|332187380|ref|ZP_08389118.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
 gi|332012541|gb|EGI54608.1| cytochrome o ubiquinol oxidase subunit IV [Sphingomonas sp. S17]
          Length = 127

 Score = 78.3 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 32/115 (27%), Positives = 61/115 (53%), Gaps = 5/115 (4%)

Query: 1   MKYDNIHNMNMHSY----GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLC 56
           M  D         +    G  +  ++G   + +LT   F +V         +    ++  
Sbjct: 9   MARDETAPGEESEHDSIAGGVRSYVIGLAAAAVLTAASFALVQMDIIWGPAV-PAALLAL 67

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS 111
           AI Q+ VHLVFFLH++T  ++  +++A++F +++V +  +GS+W+M HLN+N+M 
Sbjct: 68  AIGQMGVHLVFFLHITTGPDNSNNVLALLFGVLIVTLVLLGSIWIMGHLNHNLMG 122


>gi|254488164|ref|ZP_05101369.1| cytochrome o ubiquinol oxidase subunit IV [Roseobacter sp. GAI101]
 gi|214045033|gb|EEB85671.1| cytochrome o ubiquinol oxidase subunit IV [Roseobacter sp. GAI101]
          Length = 103

 Score = 78.3 bits (192), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 27/94 (28%), Positives = 49/94 (52%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            +    GF L++ LT + F   +   F     +  T+ + AIAQ++VH  FFLH+    +
Sbjct: 11  LRMYFTGFGLAVTLTALSFLTAILQPFGPVG-LFATLAVLAIAQVVVHFRFFLHIDLSRQ 69

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
               +  ++FT +++AI   G++W++  L   MM
Sbjct: 70  AREDLQLILFTGLLIAIMVAGTIWILGDLMTRMM 103


>gi|126642214|ref|YP_001085198.1| cytochrome o ubiquinol oxidase subunit IV [Acinetobacter baumannii
           ATCC 17978]
          Length = 74

 Score = 77.9 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 31/74 (41%), Positives = 53/74 (71%), Gaps = 1/74 (1%)

Query: 37  IVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFV 96
           +VM G F  + ++   I + A+AQ++V LV+FLHM+T  E  W+++A I+TI+ +A+  +
Sbjct: 1   MVMAGGF-SRGLLVTVIAITAVAQVLVQLVYFLHMNTSSEQRWNMIAFIYTILCIAVLLI 59

Query: 97  GSMWVMYHLNNNMM 110
           GS+W+M +L+ NMM
Sbjct: 60  GSVWIMNYLHYNMM 73


>gi|85717119|ref|ZP_01048079.1| Cytochrome C oxidase subunit IV [Nitrobacter sp. Nb-311A]
 gi|85696079|gb|EAQ33977.1| Cytochrome C oxidase subunit IV [Nitrobacter sp. Nb-311A]
          Length = 102

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 28/88 (31%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  LVG +L+ +LT IPFG V          + + I + A+AQ++VHL +FL +  K  
Sbjct: 2   LKSYLVGVLLASVLTAIPFGFVATRTLPPGQTL-IVIGVAAVAQVVVHLRYFLRLDLKSR 60

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYH 104
                +A+ F   ++ I   G++W+M+ 
Sbjct: 61  SQDKFIALCFAATVLFILVGGTLWIMFD 88


>gi|27377828|ref|NP_769357.1| cytochrome O ubiquinol oxidase protein [Bradyrhizobium japonicum
           USDA 110]
 gi|7451519|pir||JC5902 ubiquinol oxidase (EC 1.-.-.-) IV - Bradyrhizobium japonicum
 gi|27350973|dbj|BAC47982.1| cytochrome O ubiquinol oxidase protein [Bradyrhizobium japonicum
           USDA 110]
          Length = 129

 Score = 76.3 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 30/82 (36%), Positives = 49/82 (59%), Gaps = 1/82 (1%)

Query: 34  PFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAI 93
            F I         +I    IV  AIAQ+ VHLVFFLH++T  ++  +++A+ F +++V +
Sbjct: 44  SFFIAGTDLVWQPSIPVALIV-LAIAQMGVHLVFFLHITTGPDNTNNVLALAFGLLVVFL 102

Query: 94  CFVGSMWVMYHLNNNMMSMEGM 115
              G++W+M HLN NM  M+ +
Sbjct: 103 VVGGTVWIMSHLNGNMPPMDQI 124


>gi|254512695|ref|ZP_05124761.1| Prokaryotic Cytochrome C oxidase subunit IV superfamily
           [Rhodobacteraceae bacterium KLH11]
 gi|221532694|gb|EEE35689.1| Prokaryotic Cytochrome C oxidase subunit IV superfamily
           [Rhodobacteraceae bacterium KLH11]
          Length = 102

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 27/92 (29%), Positives = 55/92 (59%), Gaps = 1/92 (1%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           ++ ++G+  SL+LT + FGI    F ++   + +TI L  +AQ++V LV+FLH+  +   
Sbjct: 7   RRYVIGYGGSLLLTFVVFGIA-YQFGIETPGVYMTIGLLGLAQLVVQLVYFLHIDRRRSS 65

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
              +  ++F+ +++ I   G++WV+ +L   M
Sbjct: 66  REDLDLILFSTLVLLIIIGGTIWVLGNLAMRM 97


>gi|296284679|ref|ZP_06862677.1| hypothetical protein CbatJ_13713 [Citromicrobium bathyomarinum
           JL354]
          Length = 132

 Score = 72.5 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 49/103 (47%), Gaps = 3/103 (2%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           +   ++    +    GF++SL+LT+  F  ++    L        I   A+ QI+ HL  
Sbjct: 10  DPQGNAASEIRSYATGFVISLLLTVGAFAALLSD--LPTTWKIALICGAALIQIVAHLRN 67

Query: 68  FLHMSTKVEDG-WSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           FLH+S         ++ ++F++ ++AI   G+ ++M  L   M
Sbjct: 68  FLHLSLADAQSEEDLLLVLFSVCLLAIMAGGTWYIMSDLGGRM 110


>gi|219682374|ref|YP_002468758.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|219622107|gb|ACL30263.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           Tuc7 (Acyrthosiphon pisum)]
 gi|311086195|gb|ADP66277.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           LL01 (Acyrthosiphon pisum)]
 gi|311086771|gb|ADP66852.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           TLW03 (Acyrthosiphon pisum)]
 gi|311087359|gb|ADP67439.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           JF99 (Acyrthosiphon pisum)]
 gi|311087857|gb|ADP67936.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           JF98 (Acyrthosiphon pisum)]
          Length = 105

 Score = 72.1 bits (176), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  L+GF+ S +LT +PF + ++ FF    +  +  +LCAI+QII+H V+FLH+S   E
Sbjct: 13  IKSYLLGFLFSSLLTTLPFLLAIEKFFCS-EVNYIIFLLCAISQIIIHFVYFLHLSFDPE 71

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + W+++ ++F II++ I   GS+W+M++LN+N M
Sbjct: 72  ERWNLITLLFVIIIIFIVVFGSIWIMFNLNHNTM 105


>gi|94495037|ref|ZP_01301618.1| cytochrome o ubiquinol oxidase, subunit IV [Sphingomonas sp. SKA58]
 gi|94425303|gb|EAT10323.1| cytochrome o ubiquinol oxidase, subunit IV [Sphingomonas sp. SKA58]
          Length = 103

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 50/103 (48%), Gaps = 1/103 (0%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
           N N       +  LVG+  ++++T + F IV       K +    ++  A  QI++    
Sbjct: 2   NGNDERRAEVRSYLVGYAGAIVMTGVAFAIVQWPIASPK-LTFAAVLTLAFTQIVLQFRC 60

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           FLH+S +      +  ++F+ ++VA+   G++ ++ +L   MM
Sbjct: 61  FLHISLRRSARDDLQLILFSTLVVALMVGGTLVILLNLRERMM 103


>gi|15617067|ref|NP_240280.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219681819|ref|YP_002468205.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
 gi|257471521|ref|ZP_05635520.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           LSR1 (Acyrthosiphon pisum)]
 gi|11386746|sp|P57541|CYOD_BUCAI RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
 gi|25331171|pir||F84984 cytochrome o ubiquinol oxidase subunit IV [imported] - Buchnera sp.
           (strain APS)
 gi|10039132|dbj|BAB13166.1| cytochrome o ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           APS (Acyrthosiphon pisum)]
 gi|219624662|gb|ACL30817.1| cytochrome O ubiquinol oxidase subunit IV [Buchnera aphidicola str.
           5A (Acyrthosiphon pisum)]
          Length = 105

 Score = 71.7 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 38/94 (40%), Positives = 65/94 (69%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  L+GF+ S +LT +PF + ++ FF    +  +  +LCAI+QII+H V+FLH+S   E
Sbjct: 13  MKSYLLGFLFSSLLTTLPFLLAIEKFFCS-EVNYIIFLLCAISQIIIHFVYFLHLSFDPE 71

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           + W+++ ++F II++ I   GS+W+M++LN+N M
Sbjct: 72  ERWNLITLLFVIIIIFIVVFGSIWIMFNLNHNTM 105


>gi|94498851|ref|ZP_01305392.1| Prokaryotic Cytochrome C oxidase subunit IV [Sphingomonas sp.
           SKA58]
 gi|94421692|gb|EAT06752.1| Prokaryotic Cytochrome C oxidase subunit IV [Sphingomonas sp.
           SKA58]
          Length = 85

 Score = 70.9 bits (173), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 36/66 (54%), Positives = 49/66 (74%)

Query: 51  LTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           L I+  A  Q++VH+++FLHM+++VE GWS MAM+ TI++V I   GSMWVMYHLN NMM
Sbjct: 1   LLILAFAAVQVVVHMIYFLHMNSRVEGGWSFMAMMLTIVLVVIVLSGSMWVMYHLNANMM 60

Query: 111 SMEGMR 116
               M+
Sbjct: 61  PHADMQ 66


>gi|294498633|ref|YP_003562333.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|295703992|ref|YP_003597067.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
 gi|294348570|gb|ADE68899.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|294801651|gb|ADF38717.1| cytochrome o quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
          Length = 98

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 33/92 (35%), Positives = 56/92 (60%), Gaps = 1/92 (1%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
           M ++G+ K   +GFI S+ILT+IP  +V+   F  KNI+  +I+  A+ Q  + L FF+H
Sbjct: 1   MENHGSLKAYTIGFIFSIILTVIPLMLVLNHVFA-KNILLASILGMAVLQFFIQLFFFMH 59

Query: 71  MSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +    +  +++MA+I  I+ V     GS+W+M
Sbjct: 60  IKDGEKPRYNVMALILGIVFVITIVAGSIWIM 91


>gi|330950891|gb|EGH51151.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae Cit
           7]
          Length = 78

 Score = 70.2 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 24/78 (30%), Positives = 46/78 (58%), Gaps = 1/78 (1%)

Query: 34  PFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAI 93
           PF +VM    L K++    +++ AI QI+VHL +FLH+        ++MA  FT +++ +
Sbjct: 1   PFALVMSPS-LPKDMTIAIVLVFAIIQILVHLHYFLHLDFTSVQRNNVMAFAFTTMVIVL 59

Query: 94  CFVGSMWVMYHLNNNMMS 111
               S+W+++ ++  MM+
Sbjct: 60  LVGLSLWIIFSVHREMMA 77


>gi|207744471|ref|YP_002260863.1| hypothetical ubiquinol oxidase subunit ( partial sequence) protein
           [Ralstonia solanacearum IPO1609]
 gi|206595877|emb|CAQ62804.1| hypothetical ubiquinol oxidase subunit ( partial sequence) protein
           [Ralstonia solanacearum IPO1609]
          Length = 56

 Score = 70.2 bits (171), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 42/54 (77%)

Query: 57  AIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           A+ QI+VHL++FLH+       W++MA +FT++++AI  VGS+WVM+++N NMM
Sbjct: 1   AVVQIVVHLIYFLHLDGSSAQRWNVMAFLFTLLILAIVIVGSLWVMHNMNINMM 54


>gi|157694209|ref|YP_001488671.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus pumilus
           SAFR-032]
 gi|157682967|gb|ABV64111.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus pumilus
           SAFR-032]
          Length = 126

 Score = 68.2 bits (166), Expect = 4e-10,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
             H+   H +   K  +VGFILS++LT++ F I + G  +  +     I   A  Q  + 
Sbjct: 4   KTHSSAEHEHFPWK-HVVGFILSIVLTVLAFWIAI-GAEIGSSAKLWIIFGFAFIQAFLQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           L  F+HM+        +   +F +    I  +GS+W+
Sbjct: 62  LFMFMHMTESENGTVQVGNTLFGLFCAIIFVIGSVWI 98


>gi|126730195|ref|ZP_01746007.1| cytochrome O ubiquinol oxidase subunit IV [Sagittula stellata E-37]
 gi|126709575|gb|EBA08629.1| cytochrome O ubiquinol oxidase subunit IV [Sagittula stellata E-37]
          Length = 103

 Score = 67.1 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 1/94 (1%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            +    GF  +++LT + F   +   F    I   ++ + A  Q++VH  FFLH+    +
Sbjct: 11  LRMYFTGFAAAIVLTALSFATAILQPFGPMGI-FASLAVLAAVQVVVHFRFFLHIDFSRQ 69

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
               +  ++FT +++AI   G++WV+ +L   MM
Sbjct: 70  KREDLQLILFTGLIIAIMVAGTVWVLGNLMARMM 103


>gi|260430762|ref|ZP_05784734.1| cytochrome C oxidase subunit IV [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260418203|gb|EEX11461.1| cytochrome C oxidase subunit IV [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 93

 Score = 66.3 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 26/89 (29%), Positives = 50/89 (56%), Gaps = 1/89 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++G+  SL+LT+  F  V       + +  LTI L  +AQ+IV LV+FLH+  +      
Sbjct: 1   MIGYGSSLLLTLAMFATVHWFGIETRGV-YLTIGLLGLAQLIVQLVYFLHIDRRRSSRED 59

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           +  ++F+ +++ I   G++W++ +L   M
Sbjct: 60  LDLVLFSTLVLLIIIGGTVWILGNLAMRM 88


>gi|194016546|ref|ZP_03055160.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus pumilus ATCC
           7061]
 gi|194012019|gb|EDW21587.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus pumilus ATCC
           7061]
          Length = 126

 Score = 65.2 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 2/97 (2%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
             ++   H +   K  +VGFILS++LTI+ F I + G  +  +     I   A  Q  + 
Sbjct: 4   KTNSSAEHEHFPWK-HVVGFILSIVLTILAFWIAI-GAEIGSSAKLWIIFGFAFIQAFLQ 61

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           L  F+HM+        +   +F +    I  +GS+W+
Sbjct: 62  LFMFMHMTESENGTVQVGNTLFGLFCAIIFVIGSVWI 98


>gi|27904893|ref|NP_778019.1| cytochrome O ubiquinol oxidase protein CyoD [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
 gi|46395812|sp|Q89AA6|CYOD_BUCBP RecName: Full=Cytochrome o ubiquinol oxidase protein CyoD
 gi|27904291|gb|AAO27124.1| cytochrome O ubiquinol oxidase protein CyoD [Buchnera aphidicola
           str. Bp (Baizongia pistaciae)]
          Length = 100

 Score = 62.8 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 44/65 (67%)

Query: 45  DKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYH 104
            +N +   I++C   QI+ H+ FFL++   +E  W ++++IF++++  I  +GS+WV+ +
Sbjct: 33  SRNYLYAFIIVCLFFQILAHIKFFLNLDFSLEQRWKLISVIFSLVVGLIILLGSIWVIKN 92

Query: 105 LNNNM 109
           LNNN+
Sbjct: 93  LNNNL 97


>gi|299820826|ref|ZP_07052715.1| quinol oxidase subunit IV [Listeria grayi DSM 20601]
 gi|299817847|gb|EFI85082.1| quinol oxidase subunit IV [Listeria grayi DSM 20601]
          Length = 109

 Score = 61.7 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 28/111 (25%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +        ++G  +  ++GF LS+ILT++   + +    LD ++  + I + A  Q
Sbjct: 1   MAENKNSTQTHKAHGPWQ-HIIGFALSIILTLLAVWVALYST-LDHSVKVVIIFIFAFIQ 58

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM--YHLNNNM 109
            ++ L  F+HM+   +   +   ++F + +  I  +GS WVM   H+N+ M
Sbjct: 59  AMLQLFMFMHMTEGKDGKVNTSGILFALFIAIIVVIGSYWVMEIGHMNHLM 109


>gi|258510524|ref|YP_003183958.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257477250|gb|ACV57569.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 107

 Score = 59.8 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 15  GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           G   + ++G+ LSLI T I F + +      +  + + + + A  QI V L FF+H++  
Sbjct: 13  GGLAKYIIGYGLSLIFTAIAFWLALSHAMSIRP-LIILLFVLAALQIGVQLFFFMHVTEG 71

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMWVM 102
               +  + ++  +I      + SMW+M
Sbjct: 72  DGPPYHALLLLLGMIFTFAVAMMSMWIM 99


>gi|218289388|ref|ZP_03493622.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius LAA1]
 gi|258510664|ref|YP_003184098.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
 gi|218240494|gb|EED07675.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius LAA1]
 gi|257477390|gb|ACV57709.1| cytochrome aa3 quinol oxidase, subunit IV [Alicyclobacillus
           acidocaldarius subsp. acidocaldarius DSM 446]
          Length = 106

 Score = 59.4 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 18/72 (25%), Positives = 35/72 (48%), Gaps = 1/72 (1%)

Query: 31  TIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIM 90
           T I F + +        ++   IV+  + Q++V L  F+H +   +  W + A+ F + +
Sbjct: 29  TAIAFWLALA-THQPPALVITIIVILGVGQLLVQLYMFMHFTESDDRAWQVPAIYFGLFI 87

Query: 91  VAICFVGSMWVM 102
           V     GS+W+M
Sbjct: 88  VFCVVGGSIWIM 99


>gi|289433389|ref|YP_003463261.1| quinol oxidase AA3, subunit IV [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
 gi|289169633|emb|CBH26167.1| quinol oxidase AA3, subunit IV [Listeria seeligeri serovar 1/2b
           str. SLCC3954]
          Length = 110

 Score = 59.4 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +       N+  + I + A  Q
Sbjct: 1   MAQNNKSNAAHAESGIPWKHIVGFALSIILTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM--YHLNNNM 109
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+ M
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNHLM 110


>gi|313640101|gb|EFS04727.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria seeligeri FSL
           S4-171]
          Length = 110

 Score = 59.0 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 53/111 (47%), Gaps = 3/111 (2%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +       N+  + I + A  Q
Sbjct: 1   MAQNNKSNTAHAEGGIPWKHIVGFALSIILTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM--YHLNNNM 109
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   H+N+ M
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMNHLM 110


>gi|254992950|ref|ZP_05275140.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes FSL J2-064]
          Length = 110

 Score = 58.6 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +       N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   + N
Sbjct: 60  AALQLLMFMHMTEGRDGKIQISNILFAAFIAIVVVIGSYWVMEIGHMN 107


>gi|46906242|ref|YP_012631.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47093031|ref|ZP_00230810.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 4b
           H7858]
 gi|116871439|ref|YP_848220.1| quinol oxidase AA3, subunit IV [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217965918|ref|YP_002351596.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria monocytogenes
           HCC23]
 gi|226222656|ref|YP_002756763.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes Clip81459]
 gi|254824761|ref|ZP_05229762.1| quinol oxidase AA3 [Listeria monocytogenes FSL J1-194]
 gi|254851825|ref|ZP_05241173.1| quinol oxidase AA3 [Listeria monocytogenes FSL R2-503]
 gi|254930850|ref|ZP_05264209.1| quinol oxidase AA3 [Listeria monocytogenes HPB2262]
 gi|255519797|ref|ZP_05387034.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes FSL J1-175]
 gi|290892054|ref|ZP_06555051.1| quinol oxidase AA3 [Listeria monocytogenes FSL J2-071]
 gi|300763371|ref|ZP_07073369.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes FSL N1-017]
 gi|315273206|ref|ZP_07869233.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria marthii FSL
           S4-120]
 gi|46879506|gb|AAT02808.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|47018599|gb|EAL09353.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 4b
           H7858]
 gi|116740317|emb|CAK19435.1| quinol oxidase AA3, subunit IV [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|217335188|gb|ACK40982.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria monocytogenes
           HCC23]
 gi|225875118|emb|CAS03808.1| Putative quinol oxidase aa3-600 chain IV [Listeria monocytogenes
           serotype 4b str. CLIP 80459]
 gi|258605117|gb|EEW17725.1| quinol oxidase AA3 [Listeria monocytogenes FSL R2-503]
 gi|290558648|gb|EFD92165.1| quinol oxidase AA3 [Listeria monocytogenes FSL J2-071]
 gi|293582394|gb|EFF94426.1| quinol oxidase AA3 [Listeria monocytogenes HPB2262]
 gi|293594000|gb|EFG01761.1| quinol oxidase AA3 [Listeria monocytogenes FSL J1-194]
 gi|300515648|gb|EFK42697.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes FSL N1-017]
 gi|307569539|emb|CAR82718.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes L99]
 gi|313616168|gb|EFR89266.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria marthii FSL
           S4-120]
 gi|313621617|gb|EFR92434.1| cytochrome aa3 quinol oxidase, subunit IV [Listeria innocua FSL
           S4-378]
 gi|328468340|gb|EGF39346.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes 1816]
 gi|328476159|gb|EGF46865.1| quinol oxidase aa3-600 chain IV [Listeria monocytogenes 220]
 gi|332310354|gb|EGJ23449.1| Quinol oxidase subunit 4 [Listeria monocytogenes str. Scott A]
          Length = 110

 Score = 58.6 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +       N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVILTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   + N
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMN 107


>gi|16802064|ref|NP_463549.1| hypothetical protein lmo0016 [Listeria monocytogenes EGD-e]
 gi|47095077|ref|ZP_00232689.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 1/2a
           F6854]
 gi|224498292|ref|ZP_03666641.1| hypothetical protein LmonF1_00795 [Listeria monocytogenes Finland
           1988]
 gi|224503060|ref|ZP_03671367.1| hypothetical protein LmonFR_11156 [Listeria monocytogenes FSL
           R2-561]
 gi|254827441|ref|ZP_05232128.1| quinol oxidase AA3 [Listeria monocytogenes FSL N3-165]
 gi|254830691|ref|ZP_05235346.1| hypothetical protein Lmon1_05004 [Listeria monocytogenes 10403S]
 gi|254899669|ref|ZP_05259593.1| hypothetical protein LmonJ_07646 [Listeria monocytogenes J0161]
 gi|254913128|ref|ZP_05263140.1| qoxD [Listeria monocytogenes J2818]
 gi|254937509|ref|ZP_05269206.1| quinol oxidase AA3 [Listeria monocytogenes F6900]
 gi|284803249|ref|YP_003415114.1| hypothetical protein LM5578_3006 [Listeria monocytogenes 08-5578]
 gi|284996390|ref|YP_003418158.1| hypothetical protein LM5923_2955 [Listeria monocytogenes 08-5923]
 gi|16409375|emb|CAC98231.1| qoxD [Listeria monocytogenes EGD-e]
 gi|47016422|gb|EAL07343.1| quinol oxidase AA3, subunit IV [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258599818|gb|EEW13143.1| quinol oxidase AA3 [Listeria monocytogenes FSL N3-165]
 gi|258610110|gb|EEW22718.1| quinol oxidase AA3 [Listeria monocytogenes F6900]
 gi|284058811|gb|ADB69752.1| hypothetical protein LM5578_3006 [Listeria monocytogenes 08-5578]
 gi|284061857|gb|ADB72796.1| hypothetical protein LM5923_2955 [Listeria monocytogenes 08-5923]
 gi|293591130|gb|EFF99464.1| qoxD [Listeria monocytogenes J2818]
          Length = 110

 Score = 58.2 bits (140), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 27/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS++LT++   + +       N+  + I + A  Q
Sbjct: 1   MTQNNKSNAAHAEGGIPWKHIVGFALSVVLTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   + N
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMN 107


>gi|229541706|ref|ZP_04430766.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus coagulans 36D1]
 gi|229326126|gb|EEN91801.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus coagulans 36D1]
          Length = 94

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/85 (28%), Positives = 45/85 (52%), Gaps = 1/85 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             ++GF+LS++LT++   + +    L K  +  TI   A  Q  V L  F+H+       
Sbjct: 10  GHIIGFLLSIVLTLVALYVALY-TNLSKTAIIWTIGFFAFLQAGVQLFMFMHVKEGESGK 68

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMY 103
            ++  MI++II+  +   G++WVM+
Sbjct: 69  INVGNMIYSIIIAIVVVYGTIWVMH 93


>gi|16799095|ref|NP_469363.1| hypothetical protein lin0016 [Listeria innocua Clip11262]
 gi|16412437|emb|CAC95249.1| qoxD [Listeria innocua Clip11262]
          Length = 110

 Score = 57.8 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 28/108 (25%), Positives = 50/108 (46%), Gaps = 1/108 (0%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N  N      G   + +VGF LS+ILT++   + +       N+  + I + A  Q
Sbjct: 1   MAQNNKSNAAHAEGGIPWKHIVGFALSIILTLLAVWVAIYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
             + L+ F+HM+   +    I  ++F   +  +  +GS WVM   + N
Sbjct: 60  AALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMN 107


>gi|154687939|ref|YP_001423100.1| QoxD [Bacillus amyloliquefaciens FZB42]
 gi|154353790|gb|ABS75869.1| QoxD [Bacillus amyloliquefaciens FZB42]
          Length = 122

 Score = 56.7 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
              HS+   K  +VGF LS+ILT++   + +    L  +     I   A  Q  + L+ F
Sbjct: 5   SAEHSHFPWK-HIVGFALSIILTLLALWVAVY-TELSPSAKLWIIFGFAFIQAGLQLLMF 62

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           +HM+     G  +   +F      +  +GS+W+
Sbjct: 63  MHMTESENGGIQVGNTLFGFFGAIVIILGSIWI 95


>gi|56421991|ref|YP_149309.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus kaustophilus
           HTA426]
 gi|56381833|dbj|BAD77741.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus kaustophilus
           HTA426]
          Length = 99

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 41/82 (50%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LSL+LT     + +      K +  + IVL AI Q  + L  F+H++        
Sbjct: 15  IIGFLLSLVLTFAALWVALSSGLPLKAV-IVIIVLFAIIQASLQLFLFMHVNESDSGKVQ 73

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              M+++  +  +   GS+WVM
Sbjct: 74  TFNMVYSFFIAVVVVAGSIWVM 95


>gi|167463408|ref|ZP_02328497.1| hypothetical protein Plarl_12766 [Paenibacillus larvae subsp.
           larvae BRL-230010]
 gi|322382243|ref|ZP_08056155.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
 gi|321153791|gb|EFX46160.1| cytochrome quinol oxidase-like protein [Paenibacillus larvae subsp.
           larvae B-3650]
          Length = 106

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/104 (22%), Positives = 49/104 (47%), Gaps = 1/104 (0%)

Query: 4   DNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIV 63
            N H+ +    G   + +VG+++S++LT++    V        N++   I + A  Q  +
Sbjct: 2   SNSHDTSAEHKGFPWKHVVGYLVSIVLTLLALW-VAFKSGFSINVLMTFIYILAFLQAAL 60

Query: 64  HLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
            L+ F+HM+      +    M++ + +  +   GS+WVM   + 
Sbjct: 61  QLLMFMHMTESSNGKYQTGTMLYAVFIAIVIAAGSVWVMSSGHA 104


>gi|308175541|ref|YP_003922246.1| cytochrome aa3-600 quinol oxidase subunit IV [Bacillus
           amyloliquefaciens DSM 7]
 gi|307608405|emb|CBI44776.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus
           amyloliquefaciens DSM 7]
 gi|328555519|gb|AEB26011.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus
           amyloliquefaciens TA208]
 gi|328913891|gb|AEB65487.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus
           amyloliquefaciens LL3]
          Length = 122

 Score = 56.3 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
              HS+   K  +VGF LS+ILT++   + +    L  +     I   A  Q  + L+ F
Sbjct: 5   SAEHSHFPWK-HIVGFALSIILTLLALWVAVY-TDLSSSAKLWIIFGFAFIQAGLQLLMF 62

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           +HM+     G  +   +F      +  +GS+W+
Sbjct: 63  MHMTESENGGIQVGNTLFGFFGAIVIILGSIWI 95


>gi|296331456|ref|ZP_06873928.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305676443|ref|YP_003868115.1| cytochrome aa3-600 quinol oxidase subunit IV [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|317411865|sp|E0TW64|QOX4_BACPZ RecName: Full=Quinol oxidase subunit 4; AltName: Full=Quinol
           oxidase aa3-600, subunit qoxD; AltName: Full=Quinol
           oxidase polypeptide IV
 gi|296151571|gb|EFG92448.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. spizizenii ATCC 6633]
 gi|305414687|gb|ADM39806.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 124

 Score = 55.9 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
              HS+   K  +VGF LS++LT++   + +    L  +     I   A  Q  + L+ F
Sbjct: 5   SAEHSHFPWK-HIVGFALSIVLTLLALWVAVY-TDLSSSAKLWIIFGFAFIQAALQLLMF 62

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           +HM+     G  +   +F      +  +GS+W+
Sbjct: 63  MHMTESENGGIQVGNTLFGFFGAIVIVLGSIWI 95


>gi|16080865|ref|NP_391693.1| cytochrome aa3-600 quinol oxidase subunit IV [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221311779|ref|ZP_03593626.1| cytochrome aa3 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|221316104|ref|ZP_03597909.1| cytochrome aa3 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. subtilis str. NCIB 3610]
 gi|221321017|ref|ZP_03602311.1| cytochrome aa3 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. subtilis str. JH642]
 gi|221325301|ref|ZP_03606595.1| cytochrome aa3 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. subtilis str. SMY]
 gi|321313371|ref|YP_004205658.1| cytochrome aa3-600 quinol oxidase subunit IV [Bacillus subtilis
           BSn5]
 gi|464515|sp|P34959|QOX4_BACSU RecName: Full=Quinol oxidase subunit 4; AltName: Full=Quinol
           oxidase aa3-600, subunit QoxD; AltName: Full=Quinol
           oxidase polypeptide IV
 gi|143399|gb|AAA22689.1| quinol oxidase [Bacillus subtilis]
 gi|413964|emb|CAA51596.1| ipa-40d qoxD [Bacillus subtilis subsp. subtilis str. 168]
 gi|2636349|emb|CAB15840.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus subtilis
           subsp. subtilis str. 168]
 gi|291486405|dbj|BAI87480.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus subtilis subsp.
           natto BEST195]
 gi|320019645|gb|ADV94631.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus subtilis
           BSn5]
          Length = 124

 Score = 55.5 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/93 (24%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
              HS+   K  +VGFILS++LT++   + +    L  +     I   A  Q  + L+ F
Sbjct: 5   SAEHSHFPWK-HIVGFILSIVLTLLALWVAVY-TDLSSSAKLWIIFGFAFIQAALQLLMF 62

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           +HM+        +   +F      +  +GS+W+
Sbjct: 63  MHMTESENGTIQVGNTLFGFFGAIVIVLGSIWI 95


>gi|255019614|ref|ZP_05291695.1| hypothetical protein ACA_2321 [Acidithiobacillus caldus ATCC 51756]
 gi|254970958|gb|EET28439.1| hypothetical protein ACA_2321 [Acidithiobacillus caldus ATCC 51756]
          Length = 121

 Score = 55.1 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 23/105 (21%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           +++  L GFIL+ +L  +   +V         ++   I+ CA   +I  + F LH+    
Sbjct: 18  SRRGYLTGFILASVLMALATFLVSSHALPPFALLLA-IMACAGFAVIAQVYFLLHIDISE 76

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMS-MEGMRSIH 119
            + W+ +A++  + +  I    + W+   L    M  + GM  +H
Sbjct: 77  HNIWNTVALVAFVPLFVITIGLTWWMFSQLYLRTMPSIPGMPGMH 121


>gi|319652991|ref|ZP_08007096.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. 2_A_57_CT2]
 gi|317395340|gb|EFV76073.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. 2_A_57_CT2]
          Length = 101

 Score = 54.4 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             ++GF++SL+LT    GIV+    L   ++   I   A+ Q  + L  F+H+    +  
Sbjct: 12  SHVIGFVVSLVLTFAAAGIVL-KTNLSFKVIMWIIGSLAVIQAGMQLFMFMHLREGEDGK 70

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
            +++ MI+ + MV +  VGS+WV+   + 
Sbjct: 71  TNLVNMIYAVFMVIVIVVGSIWVLTSGHA 99


>gi|149182658|ref|ZP_01861126.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. SG-1]
 gi|148849627|gb|EDL63809.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. SG-1]
          Length = 100

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 41/89 (46%), Gaps = 1/89 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
              VGFI+SL+LT      V     L   ++   I   A+ Q  + L  F+H++   +  
Sbjct: 11  SHFVGFIMSLVLTFAAAW-VALKTSLSFTVVMWVIGTLAVVQAGLQLFMFMHVNEGEDGK 69

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
             I+ +I+ +    +  +GS+WV+   + 
Sbjct: 70  VQIINIIYAVFCAVVIVIGSIWVLTSGHA 98


>gi|138897017|ref|YP_001127470.1| cytochrome aa3 quinol oxidase polypeptide IV [Geobacillus
           thermodenitrificans NG80-2]
 gi|134268530|gb|ABO68725.1| Cytochrome aa3 quinol oxidase polypeptide IV [Geobacillus
           thermodenitrificans NG80-2]
          Length = 99

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           L+GF+LSL+LT     + +      K +  + IVL A+ Q  + L  F+H+         
Sbjct: 15  LIGFVLSLLLTFAALWVALSSGLPLKAV-IVVIVLFAMIQASLQLFMFMHVVESDSGKVQ 73

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              M+++  +  I   GS+WVM
Sbjct: 74  TFNMVYSFFIAVIVVAGSVWVM 95


>gi|311070325|ref|YP_003975248.1| cytochrome aa3-600 quinol oxidase subunit IV [Bacillus atrophaeus
           1942]
 gi|310870842|gb|ADP34317.1| cytochrome aa3-600 quinol oxidase (subunit IV) [Bacillus atrophaeus
           1942]
          Length = 122

 Score = 54.0 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/94 (23%), Positives = 41/94 (43%), Gaps = 2/94 (2%)

Query: 8   NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
             N H++   K  +VGF LS++LT++   + +    L  +     I   A  Q  + L+ 
Sbjct: 2   ATNEHNHFPWK-HIVGFALSIVLTLLALWVAVY-TELSPSAKLWIIFGFAFIQAALQLLM 59

Query: 68  FLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWV 101
           F+HM         +   +F      +  +GS+W+
Sbjct: 60  FMHMRESENGTIQVGNTLFGFFGAIVIVLGSVWI 93


>gi|289807956|ref|ZP_06538585.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
           subsp. enterica serovar Typhi str. AG3]
          Length = 41

 Score = 52.1 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 31/37 (83%)

Query: 74  KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMM 110
           K ++GW++ A IFT++++AI  VGS+W+M++LN NMM
Sbjct: 3   KSDEGWNMTAFIFTVLIIAILVVGSIWIMWNLNYNMM 39


>gi|319892052|ref|YP_004148927.1| quinol oxidase polypeptide IV QoxD [Staphylococcus pseudintermedius
           HKU10-03]
 gi|317161748|gb|ADV05291.1| quinol oxidase polypeptide IV QoxD [Staphylococcus pseudintermedius
           HKU10-03]
 gi|323464839|gb|ADX76992.1| quinol oxidase subunit IV [Staphylococcus pseudintermedius ED99]
          Length = 96

 Score = 51.7 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  +GFI S+ILT++   + +    L        I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTIGFIASIILTLLAVFVTLY-TSLSFQAKVTIIFGFAFIQAFLQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +    +  +IF II+  I  +G+ WVM
Sbjct: 62  DGRVQLAKVIFAIIITLITVIGTYWVM 88


>gi|294499883|ref|YP_003563583.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus megaterium QM
           B1551]
 gi|295705268|ref|YP_003598343.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus megaterium DSM
           319]
 gi|294349820|gb|ADE70149.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus megaterium QM
           B1551]
 gi|294802927|gb|ADF39993.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus megaterium DSM
           319]
          Length = 102

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 43/84 (51%), Gaps = 1/84 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             + G ILSL LT    G+V+    L ++I    I++ A+ Q  + LV F+HM+      
Sbjct: 14  SHVFGLILSLALTFAALGLVVL-ADLSRSITMTLIMILALLQAAMQLVMFMHMTESENGK 72

Query: 79  WSIMAMIFTIIMVAICFVGSMWVM 102
             +  ++++  +     VG++W++
Sbjct: 73  VQVANILYSFFIALCIVVGTLWIL 96


>gi|212638124|ref|YP_002314644.1| cytochrome aa3 quinol oxidase subunit IV [Anoxybacillus
           flavithermus WK1]
 gi|212559604|gb|ACJ32659.1| Cytochrome aa3 quinol oxidase subunit IV [Anoxybacillus
           flavithermus WK1]
          Length = 99

 Score = 51.3 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             +VGF+ SLILT +    V     +   I+   I   A+ Q  + L  F+H++   +  
Sbjct: 10  SHVVGFLFSLILTFVA-VFVALKMNVSYTIVMWIIGSLAVIQAGLQLFMFMHVTEGEDGK 68

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHLNN 107
            +++ M + + +  +   GS+WV+   + 
Sbjct: 69  TNVINMAYAVFVAIVIVAGSIWVLTSGHA 97


>gi|47568830|ref|ZP_00239524.1| quinol oxidase, subunit IV [Bacillus cereus G9241]
 gi|47554506|gb|EAL12863.1| quinol oxidase, subunit IV [Bacillus cereus G9241]
          Length = 103

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MSQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|295402443|ref|ZP_06812396.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|312112704|ref|YP_003991020.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus sp. Y4.1MC1]
 gi|294975534|gb|EFG51159.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus
           thermoglucosidasius C56-YS93]
 gi|311217805|gb|ADP76409.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp. Y4.1MC1]
          Length = 99

 Score = 51.3 bits (122), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           +VGFI SL+LT     + +    L    +   IV+ A+ Q  + L  F+HM+        
Sbjct: 15  IVGFIFSLLLTFAALWVALS-SGLSTGAIIGIIVILAVIQASLQLFMFMHMTESDSGKIQ 73

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
            + M ++  +  +  VGS+W M
Sbjct: 74  TINMAYSFFIAVVVVVGSIWTM 95


>gi|52082323|ref|YP_081114.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus licheniformis
           ATCC 14580]
 gi|52787714|ref|YP_093543.1| QoxD [Bacillus licheniformis ATCC 14580]
 gi|319648197|ref|ZP_08002414.1| QoxD protein [Bacillus sp. BT1B_CT2]
 gi|52005534|gb|AAU25476.1| cytochrome aa3 quinol oxidase (subunit IV) [Bacillus licheniformis
           ATCC 14580]
 gi|52350216|gb|AAU42850.1| QoxD [Bacillus licheniformis ATCC 14580]
 gi|317389832|gb|EFV70642.1| QoxD protein [Bacillus sp. BT1B_CT2]
          Length = 121

 Score = 50.9 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 3/100 (3%)

Query: 9   MNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFF 68
              HS+   K  +VGF+LS++LT++   ++     L        I   AI Q  + L+ F
Sbjct: 6   SAEHSHFPWKH-IVGFVLSIVLTLLALWVIYTD--LSMAAKLWIIFGFAIIQAGLQLLMF 62

Query: 69  LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
           +HM+        +   +F   +      GS+W+    N +
Sbjct: 63  MHMTESDSGKIQVGNTLFAAFIAVAIIAGSVWIFAAHNYH 102


>gi|229056467|ref|ZP_04195879.1| Quinol oxidase, subunit IV [Bacillus cereus AH603]
 gi|228720864|gb|EEL72414.1| Quinol oxidase, subunit IV [Bacillus cereus AH603]
          Length = 103

 Score = 50.9 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/103 (25%), Positives = 50/103 (48%), Gaps = 3/103 (2%)

Query: 4   DNIHNMNMHSYGTKK-QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            N +  N H +       + GFILSL LT +   + +        I+  TI++ A+AQ +
Sbjct: 3   QNNNQANGHGHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQAL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           + L+ F+H+    E    I+ MI++  + A     ++W+ + +
Sbjct: 62  LQLIMFMHLKEG-EGRIQILTMIYSFFVAAATVGLTVWIFFSM 103


>gi|229165640|ref|ZP_04293412.1| Quinol oxidase, subunit IV [Bacillus cereus AH621]
 gi|228617814|gb|EEK74867.1| Quinol oxidase, subunit IV [Bacillus cereus AH621]
          Length = 103

 Score = 50.9 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        I+  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  + A     ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRIQILTMIYSFFVAAATVGLTVWIFFSM 103


>gi|229195023|ref|ZP_04321800.1| Quinol oxidase, subunit IV [Bacillus cereus m1293]
 gi|228588458|gb|EEK46499.1| Quinol oxidase, subunit IV [Bacillus cereus m1293]
          Length = 103

 Score = 50.9 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 4   DNIHNMNMHSYGTKK-QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            N +  N H++       + GFILSL LT +   + +    L  + +  TI++ A+AQ +
Sbjct: 3   QNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TDLPLSTILTTIIVMAVAQAL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           + L+ F+H+    E    ++ MI++  +       ++W+ + +
Sbjct: 62  LQLIMFMHLKEG-EGRVQVLTMIYSFFVATATVGLTVWIFFSM 103


>gi|229028499|ref|ZP_04184619.1| Quinol oxidase, subunit IV [Bacillus cereus AH1271]
 gi|228732812|gb|EEL83674.1| Quinol oxidase, subunit IV [Bacillus cereus AH1271]
          Length = 103

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MDQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIVMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|222094455|ref|YP_002528514.1| quinol oxidase, subunit iv (cytochrome c oxidase, subunit iv)
           [Bacillus cereus Q1]
 gi|221238512|gb|ACM11222.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus Q1]
          Length = 103

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 51/103 (49%), Gaps = 3/103 (2%)

Query: 4   DNIHNMNMHSYGTKK-QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            N +  N H++       + GFILSL LT +   + +    L  + +  TI++ A+AQ +
Sbjct: 3   QNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-SDLPLSTILTTIIVMAVAQAL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           + L+ F+H+    E    ++ MI++  +       ++W+ + +
Sbjct: 62  LQLIMFMHLKEG-EGRVQVLTMIYSFFVATATVGLTVWIFFSM 103


>gi|229016029|ref|ZP_04172985.1| Quinol oxidase, subunit IV [Bacillus cereus AH1273]
 gi|229022248|ref|ZP_04178793.1| Quinol oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228739051|gb|EEL89502.1| Quinol oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228745262|gb|EEL95308.1| Quinol oxidase, subunit IV [Bacillus cereus AH1273]
          Length = 103

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIVMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    ++ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRIQVLTMIYSFFVATATVGLTVWIFFSM 103


>gi|228963800|ref|ZP_04124940.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar sotto
           str. T04001]
 gi|228795871|gb|EEM43339.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar sotto
           str. T04001]
          Length = 103

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        ++  TI++ A+AQ
Sbjct: 1   MAQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTVLT-TIIITAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|163938624|ref|YP_001643508.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus
           weihenstephanensis KBAB4]
 gi|229131647|ref|ZP_04260528.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST196]
 gi|163860821|gb|ABY41880.1| Cytochrome aa3 quinol oxidase subunit IV [Bacillus
           weihenstephanensis KBAB4]
 gi|228651795|gb|EEL07751.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST196]
          Length = 103

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/103 (23%), Positives = 50/103 (48%), Gaps = 3/103 (2%)

Query: 4   DNIHNMNMHSYGTKK-QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
            N +  N H +       + GFILSL LT +   + +    L  + +  TI++ A+AQ +
Sbjct: 3   QNNNQANGHGHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIIMAVAQAL 61

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
           + L+ F+H+    E    ++ MI++  +       ++W+ + +
Sbjct: 62  LQLIMFMHLKEG-EGRIQVLTMIYSFFVATATVGLTVWIFFSM 103


>gi|269940554|emb|CBI48933.1| putative quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus TW20]
          Length = 92

 Score = 50.9 bits (121), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
            VGFI S++LT++   + +      +  +   I   A  Q  + L+ F+H++   +    
Sbjct: 4   TVGFIASIVLTLLAVYVTLYTSLTFQAKLT-IIFGFAFVQAGLQLLMFMHLTEGKDGRLQ 62

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              +IF +++     VG+ WVM
Sbjct: 63  TFKVIFALVITLCFVVGTYWVM 84


>gi|30260850|ref|NP_843227.1| quinol oxidase, subunit IV [Bacillus anthracis str. Ames]
 gi|47525981|ref|YP_017330.1| quinol oxidase subunit IV [Bacillus anthracis str. 'Ames Ancestor']
 gi|49183691|ref|YP_026943.1| quinol oxidase subunit IV [Bacillus anthracis str. Sterne]
 gi|65318128|ref|ZP_00391087.1| COG3125: Heme/copper-type cytochrome/quinol oxidase, subunit 4
           [Bacillus anthracis str. A2012]
 gi|170709009|ref|ZP_02899440.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0389]
 gi|229601937|ref|YP_002865295.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0248]
 gi|254762357|ref|ZP_05214201.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Australia 94]
 gi|30254299|gb|AAP24713.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Ames]
 gi|47501129|gb|AAT29805.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           'Ames Ancestor']
 gi|49177618|gb|AAT52994.1| quinol oxidase, subunit IV [Bacillus anthracis str. Sterne]
 gi|170126111|gb|EDS95007.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0389]
 gi|229266345|gb|ACQ47982.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0248]
          Length = 103

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI+  A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIAMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|30018877|ref|NP_830508.1| cytochrome aa3 quinol oxidase polypeptide IV [Bacillus cereus ATCC
           14579]
 gi|75762631|ref|ZP_00742476.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218233610|ref|YP_002365494.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus B4264]
 gi|218895753|ref|YP_002444164.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus G9842]
 gi|228899383|ref|ZP_04063644.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 4222]
 gi|228906453|ref|ZP_04070334.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228942998|ref|ZP_04105503.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228951198|ref|ZP_04113313.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228957118|ref|ZP_04118888.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228975946|ref|ZP_04136467.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228977447|ref|ZP_04137841.1| Quinol oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|229042561|ref|ZP_04190304.1| Quinol oxidase, subunit IV [Bacillus cereus AH676]
 gi|229068384|ref|ZP_04201687.1| Quinol oxidase, subunit IV [Bacillus cereus F65185]
 gi|229078011|ref|ZP_04210620.1| Quinol oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|229108307|ref|ZP_04237926.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|229126126|ref|ZP_04255147.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|229143424|ref|ZP_04271853.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|229149038|ref|ZP_04277282.1| Quinol oxidase, subunit IV [Bacillus cereus m1550]
 gi|229177228|ref|ZP_04304615.1| Quinol oxidase, subunit IV [Bacillus cereus 172560W]
 gi|29894419|gb|AAP07709.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus cereus ATCC
           14579]
 gi|74489878|gb|EAO53249.1| Cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar israelensis ATCC 35646]
 gi|218161567|gb|ACK61559.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus B4264]
 gi|218545032|gb|ACK97426.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus G9842]
 gi|228606234|gb|EEK63668.1| Quinol oxidase, subunit IV [Bacillus cereus 172560W]
 gi|228634420|gb|EEK91005.1| Quinol oxidase, subunit IV [Bacillus cereus m1550]
 gi|228640052|gb|EEK96453.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|228657333|gb|EEL13150.1| Quinol oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|228675144|gb|EEL30369.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|228705349|gb|EEL57726.1| Quinol oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|228714845|gb|EEL66717.1| Quinol oxidase, subunit IV [Bacillus cereus F65185]
 gi|228726780|gb|EEL77994.1| Quinol oxidase, subunit IV [Bacillus cereus AH676]
 gi|228782271|gb|EEM30455.1| Quinol oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|228783782|gb|EEM31840.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228802565|gb|EEM49412.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|228808495|gb|EEM54999.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar kurstaki
           str. T03a001]
 gi|228816662|gb|EEM62782.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar berliner
           ATCC 10792]
 gi|228853180|gb|EEM97956.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228860237|gb|EEN04636.1| Quinol oxidase, subunit IV [Bacillus thuringiensis IBL 4222]
 gi|326938472|gb|AEA14368.1| cytochrome aa3 quinol oxidase polypeptide IV [Bacillus
           thuringiensis serovar chinensis CT-43]
          Length = 103

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        ++  TI++ A+AQ
Sbjct: 1   MAQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTVLT-TIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|52144611|ref|YP_082217.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus E33L]
 gi|206977797|ref|ZP_03238687.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           H3081.97]
 gi|217958284|ref|YP_002336830.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH187]
 gi|229154400|ref|ZP_04282519.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|301052349|ref|YP_003790560.1| quinol oxidase subunit IV [Bacillus anthracis CI]
 gi|51978080|gb|AAU19630.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus cereus E33L]
 gi|206743994|gb|EDZ55411.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           H3081.97]
 gi|217064048|gb|ACJ78298.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH187]
 gi|228629048|gb|EEK85756.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|300374518|gb|ADK03422.1| quinol oxidase, subunit IV [Bacillus cereus biovar anthracis str.
           CI]
 gi|324324741|gb|ADY20001.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus thuringiensis
           serovar finitimus YBT-020]
          Length = 103

 Score = 50.5 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    ++ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQVLTMIYSFFVATATVGLTVWIFFSM 103


>gi|49480257|ref|YP_034956.1| quinol oxidase subunit IV (cytochrome C oxidase subunit IV)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|165872915|ref|ZP_02217539.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0488]
 gi|167635163|ref|ZP_02393479.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0442]
 gi|167641836|ref|ZP_02400076.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0193]
 gi|170689434|ref|ZP_02880625.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0465]
 gi|177652861|ref|ZP_02935234.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0174]
 gi|190568522|ref|ZP_03021428.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis
           Tsiankovskii-I]
 gi|196035699|ref|ZP_03103102.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus W]
 gi|227816429|ref|YP_002816438.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CDC 684]
 gi|254684223|ref|ZP_05148083.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CNEVA-9066]
 gi|254725885|ref|ZP_05187667.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A1055]
 gi|254734415|ref|ZP_05192128.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Western North America USA6153]
 gi|254742101|ref|ZP_05199788.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Kruger B]
 gi|254755777|ref|ZP_05207810.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           Vollum]
 gi|49331813|gb|AAT62459.1| quinol oxidase, subunit IV (cytochrome C oxidase, subunit IV)
           [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|164711328|gb|EDR16881.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0488]
 gi|167510184|gb|EDR85590.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0193]
 gi|167529422|gb|EDR92173.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0442]
 gi|170666596|gb|EDT17368.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0465]
 gi|172081895|gb|EDT66964.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           A0174]
 gi|190560316|gb|EDV14295.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis
           Tsiankovskii-I]
 gi|195991666|gb|EDX55631.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus W]
 gi|227006937|gb|ACP16680.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus anthracis str.
           CDC 684]
          Length = 103

 Score = 50.5 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIVMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|56963899|ref|YP_175630.1| cytochrome aa3 quinol oxidase subunit IV QoxD [Bacillus clausii
          KSM-K16]
 gi|56910142|dbj|BAD64669.1| cytochrome aa3 quinol oxidase subunit IV QoxD [Bacillus clausii
          KSM-K16]
          Length = 104

 Score = 50.5 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 1/91 (1%)

Query: 8  NMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVF 67
              + +G   + ++GF+LS++LT++    VM    L  ++  + + + A  Q+ V L  
Sbjct: 6  ETAANHHGFPWKHVIGFVLSIVLTLLAVW-VMSQTNLAWDVRIIIVFVFAFIQMTVQLHM 64

Query: 68 FLHMSTKVEDGWSIMAMIFTIIMVAICFVGS 98
          F+H+         +    F II+  I  +GS
Sbjct: 65 FMHIGEGKAGYVQVGHTWFAIIIAVIIVIGS 95


>gi|229171483|ref|ZP_04299067.1| Quinol oxidase, subunit IV [Bacillus cereus MM3]
 gi|228612021|gb|EEK69259.1| Quinol oxidase, subunit IV [Bacillus cereus MM3]
          Length = 103

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        ++  TI++ A+AQ
Sbjct: 1   MDQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTVLT-TIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|196047111|ref|ZP_03114329.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB108]
 gi|225862678|ref|YP_002748056.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB102]
 gi|196022092|gb|EDX60781.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB108]
 gi|225788629|gb|ACO28846.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus 03BB102]
          Length = 103

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TNLPLSTILTTIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|198282920|ref|YP_002219241.1| hypothetical protein Lferr_0784 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667693|ref|YP_002425123.1| cytochrome o ubiquinol oxidase, subunit IV [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247441|gb|ACH83034.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519906|gb|ACK80492.1| cytochrome o ubiquinol oxidase, subunit IV [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 118

 Score = 50.1 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 25/113 (22%), Positives = 45/113 (39%), Gaps = 1/113 (0%)

Query: 3   YDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQII 62
           +D+          T +    GF +S IL  +   +V          + + I +CA   II
Sbjct: 5   HDDPTLHPEVQMSTSRGYFSGFAISSILMFVATFLVASRAVPPFG-LLMVISVCAGIAII 63

Query: 63  VHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGM 115
             + F LH+     + W+ +A++  + +  I    + W+   L    M M GM
Sbjct: 64  AQIYFLLHIDVSEHNIWNTVALVLFMPLFLITIGLTWWMFSQLYLRTMIMPGM 116


>gi|196042071|ref|ZP_03109356.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           NVH0597-99]
 gi|218901894|ref|YP_002449728.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH820]
 gi|228925886|ref|ZP_04088970.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|229089761|ref|ZP_04221021.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-42]
 gi|229120349|ref|ZP_04249599.1| Quinol oxidase, subunit IV [Bacillus cereus 95/8201]
 gi|229183032|ref|ZP_04310264.1| Quinol oxidase, subunit IV [Bacillus cereus BGSC 6E1]
 gi|196027096|gb|EDX65718.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus
           NVH0597-99]
 gi|218538317|gb|ACK90715.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH820]
 gi|228600489|gb|EEK58077.1| Quinol oxidase, subunit IV [Bacillus cereus BGSC 6E1]
 gi|228663159|gb|EEL18749.1| Quinol oxidase, subunit IV [Bacillus cereus 95/8201]
 gi|228693569|gb|EEL47272.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-42]
 gi|228833901|gb|EEM79454.1| Quinol oxidase, subunit IV [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
          Length = 103

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 47/105 (44%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        I+  +I+  A+AQ
Sbjct: 1   MGQNNTQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTSLPLSTILT-SIIAMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRIQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|57650251|ref|YP_185931.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           COL]
 gi|87161285|ref|YP_493658.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194755|ref|YP_499551.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|257795210|ref|ZP_05644189.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9781]
 gi|269202669|ref|YP_003281938.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           ED98]
 gi|57284437|gb|AAW36531.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           COL]
 gi|87127259|gb|ABD21773.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87202313|gb|ABD30123.1| quinol oxidase, subunit IV, putative [Staphylococcus aureus subsp.
           aureus NCTC 8325]
 gi|257789182|gb|EEV27522.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9781]
 gi|262074959|gb|ACY10932.1| quinol oxidase, subunit IV [Staphylococcus aureus subsp. aureus
           ED98]
 gi|283470269|emb|CAQ49480.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus ST398]
 gi|302750883|gb|ADL65060.1| putative quinol oxidase polypeptide IV QoxD [Staphylococcus aureus
           subsp. aureus str. JKD6008]
 gi|312829452|emb|CBX34294.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus ECT-R 2]
 gi|323438881|gb|EGA96617.1| quinol oxidase polypeptide IV [Staphylococcus aureus O11]
 gi|323441726|gb|EGA99370.1| quinol oxidase polypeptide IV [Staphylococcus aureus O46]
 gi|329313727|gb|AEB88140.1| Probable quinol oxidase subunit 4 [Staphylococcus aureus subsp.
           aureus T0131]
 gi|329727950|gb|EGG64398.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus 21189]
 gi|329728296|gb|EGG64735.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus 21172]
 gi|329729021|gb|EGG65433.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus 21193]
          Length = 92

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
            VGFI S++LT++   + +         +   I   A  Q  + L+ F+H++   +    
Sbjct: 4   TVGFIASIVLTLLAVYVTLYTSLTFHAKLT-IIFGFAFVQAGLQLLMFMHLTEGKDGRLQ 62

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              +IF +++     VG+ WVM
Sbjct: 63  TFKVIFALVITLCFVVGTYWVM 84


>gi|42779847|ref|NP_977094.1| quinol oxidase, subunit IV [Bacillus cereus ATCC 10987]
 gi|42735764|gb|AAS39702.1| quinol oxidase, subunit IV [Bacillus cereus ATCC 10987]
          Length = 103

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        I+  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTILT-TIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|73663042|ref|YP_301823.1| quinol oxidase polypeptide IV [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|123642234|sp|Q49WI1|QOX4_STAS1 RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|72495557|dbj|BAE18878.1| quinol oxidase polypeptide IV [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 96

 Score = 50.1 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LTI+   + +    +  N     I   A  Q  V L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTILAVFVTLY-TSMALNAKITIIFGFAFIQAAVQLLMFMHLTESK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       ++F II+  I  +G+ WVM
Sbjct: 62  DGNLQTFKVLFAIIITLITVIGTYWVM 88


>gi|206967909|ref|ZP_03228865.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH1134]
 gi|229095349|ref|ZP_04226341.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-29]
 gi|229101460|ref|ZP_04232201.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-28]
 gi|229114299|ref|ZP_04243719.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|229188906|ref|ZP_04315939.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|206736829|gb|EDZ53976.1| cytochrome aa3 quinol oxidase, subunit IV [Bacillus cereus AH1134]
 gi|228594611|gb|EEK52397.1| Quinol oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|228669137|gb|EEL24559.1| Quinol oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|228681948|gb|EEL36084.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-28]
 gi|228688208|gb|EEL42094.1| Quinol oxidase, subunit IV [Bacillus cereus Rock3-29]
          Length = 103

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 24/105 (22%), Positives = 48/105 (45%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +        ++  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALYTTLPLSTVLT-TIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|229159779|ref|ZP_04287787.1| Quinol oxidase, subunit IV [Bacillus cereus R309803]
 gi|228623716|gb|EEK80534.1| Quinol oxidase, subunit IV [Bacillus cereus R309803]
          Length = 103

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 25/105 (23%), Positives = 49/105 (46%), Gaps = 2/105 (1%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           M  +N         G     + GFILSL LT +   + +    L  + +  TI++ A+AQ
Sbjct: 1   MGQNNNQANGHAHSGFPWSHVFGFILSLALTFLALYVALY-TSLPLSTVLTTIIIMAVAQ 59

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL 105
            ++ L+ F+H+    E    I+ MI++  +       ++W+ + +
Sbjct: 60  ALLQLIMFMHLKEG-EGRVQILTMIYSFFVATATVGLTVWIFFSM 103


>gi|295695109|ref|YP_003588347.1| cytochrome C oxidase subunit IV [Bacillus tusciae DSM 2912]
 gi|295410711|gb|ADG05203.1| cytochrome C oxidase subunit IV [Bacillus tusciae DSM 2912]
          Length = 104

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/96 (18%), Positives = 45/96 (46%), Gaps = 2/96 (2%)

Query: 5   NIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVH 64
           N    +   +G+ ++ ++ F + ++ T+I F +V  G  +   ++   I+  A+ Q+I+ 
Sbjct: 10  NTGTESASGHGSVRKHIISFAIMILFTVIAFAMV--GAGMSPTVVIPVILALAVIQVILQ 67

Query: 65  LVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMW 100
           L  F+H++ K     ++      ++      V  +W
Sbjct: 68  LWDFMHLNQKGHSFPTLFIASGAMLGFIFVLVLVLW 103


>gi|257427775|ref|ZP_05604173.1| CyoD protein [Staphylococcus aureus subsp. aureus 65-1322]
 gi|257274616|gb|EEV06103.1| CyoD protein [Staphylococcus aureus subsp. aureus 65-1322]
          Length = 92

 Score = 49.8 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
            VGFI S++LT++   + +         +   I   A  Q  + L+ F+H++   +    
Sbjct: 4   TVGFIASIVLTLLAVYVTLYTSLTFHAKLT-IIFGFAFIQAGLQLLMFMHLTEGKDGRLQ 62

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              +IF +++     VG+ WVM
Sbjct: 63  TFKVIFALVITLCFVVGTYWVM 84


>gi|15924048|ref|NP_371582.1| putative quinol oxidase polypeptide IV QoxD [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|15926644|ref|NP_374177.1| hypothetical protein SA0910 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282670|ref|NP_645758.1| hypothetical protein MW0941 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49485897|ref|YP_043118.1| putative quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|82750668|ref|YP_416409.1| quinol oxidase polypeptide IV [Staphylococcus aureus RF122]
 gi|148267550|ref|YP_001246493.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus JH9]
 gi|150393606|ref|YP_001316281.1| cytochrome aa3 quinol oxidase subunit IV [Staphylococcus aureus
           subsp. aureus JH1]
 gi|151221139|ref|YP_001331961.1| quinol oxidase polypeptide IV [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156979381|ref|YP_001441640.1| hypothetical protein SAHV_1050 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161509242|ref|YP_001574901.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus USA300_TCH1516]
 gi|221141967|ref|ZP_03566460.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus str. JKD6009]
 gi|253316215|ref|ZP_04839428.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus str. CF-Marseille]
 gi|253731666|ref|ZP_04865831.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253732579|ref|ZP_04866744.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|255005845|ref|ZP_05144446.2| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus Mu50-omega]
 gi|258407081|ref|ZP_05680230.1| quinol oxidase subunit 4 [Staphylococcus aureus A9763]
 gi|258421827|ref|ZP_05684748.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9719]
 gi|258435225|ref|ZP_05688964.1| quinol oxidase polypeptide IV [Staphylococcus aureus A9299]
 gi|258443320|ref|ZP_05691663.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8115]
 gi|258446917|ref|ZP_05695070.1| quinol oxidase polypeptide IV [Staphylococcus aureus A6300]
 gi|258449895|ref|ZP_05697993.1| quinol oxidase polypeptide IV [Staphylococcus aureus A6224]
 gi|258454993|ref|ZP_05702956.1| quinol oxidase polypeptide IV [Staphylococcus aureus A5937]
 gi|262049396|ref|ZP_06022269.1| hypothetical protein SAD30_2047 [Staphylococcus aureus D30]
 gi|262052834|ref|ZP_06025020.1| hypothetical protein SA930_1112 [Staphylococcus aureus 930918-3]
 gi|282894083|ref|ZP_06302314.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A8117]
 gi|282925070|ref|ZP_06332731.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9765]
 gi|282927279|ref|ZP_06334901.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A10102]
 gi|284023984|ref|ZP_06378382.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus 132]
 gi|294848045|ref|ZP_06788792.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A9754]
 gi|295405862|ref|ZP_06815671.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8819]
 gi|296277098|ref|ZP_06859605.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus MR1]
 gi|297208308|ref|ZP_06924738.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297245453|ref|ZP_06929324.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8796]
 gi|300912384|ref|ZP_07129827.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381387|ref|ZP_07364039.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|81649532|sp|Q6GAF5|QOX4_STAAS RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|81704532|sp|Q7A184|QOX4_STAAW RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|81705893|sp|Q7A6A1|QOX4_STAAN RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|81781806|sp|Q99V39|QOX4_STAAM RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|123548916|sp|Q2YX17|QOX4_STAAB RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|125987514|sp|Q2FI20|QOX4_STAA3 RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|125987515|sp|Q2FZK2|QOX4_STAA8 RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|125987516|sp|Q5HH26|QOX4_STAAC RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|13700859|dbj|BAB42155.1| SA0910 [Staphylococcus aureus subsp. aureus N315]
 gi|14246828|dbj|BAB57220.1| putative quinol oxidase polypeptide IV QoxD [Staphylococcus aureus
           subsp. aureus Mu50]
 gi|21204108|dbj|BAB94806.1| MW0941 [Staphylococcus aureus subsp. aureus MW2]
 gi|49244340|emb|CAG42768.1| putative quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus MSSA476]
 gi|82656199|emb|CAI80612.1| probable quinol oxidase polypeptide IV [Staphylococcus aureus
           RF122]
 gi|147740619|gb|ABQ48917.1| Cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus JH9]
 gi|149946058|gb|ABR51994.1| Cytochrome aa3 quinol oxidase subunit IV [Staphylococcus aureus
           subsp. aureus JH1]
 gi|150373939|dbj|BAF67199.1| quinol oxidase polypeptide IV [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|156721516|dbj|BAF77933.1| hypothetical protein [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368051|gb|ABX29022.1| possible cytochrome c oxidase subunit IV [Staphylococcus aureus
           subsp. aureus USA300_TCH1516]
 gi|253724665|gb|EES93394.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus USA300_TCH959]
 gi|253729357|gb|EES98086.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus TCH130]
 gi|257841236|gb|EEV65681.1| quinol oxidase subunit 4 [Staphylococcus aureus A9763]
 gi|257842160|gb|EEV66588.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9719]
 gi|257848886|gb|EEV72869.1| quinol oxidase polypeptide IV [Staphylococcus aureus A9299]
 gi|257851410|gb|EEV75349.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8115]
 gi|257854249|gb|EEV77199.1| quinol oxidase polypeptide IV [Staphylococcus aureus A6300]
 gi|257856815|gb|EEV79718.1| quinol oxidase polypeptide IV [Staphylococcus aureus A6224]
 gi|257862873|gb|EEV85638.1| quinol oxidase polypeptide IV [Staphylococcus aureus A5937]
 gi|259159282|gb|EEW44340.1| hypothetical protein SA930_1112 [Staphylococcus aureus 930918-3]
 gi|259162505|gb|EEW47074.1| hypothetical protein SAD30_2047 [Staphylococcus aureus D30]
 gi|282590968|gb|EFB96043.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A10102]
 gi|282592668|gb|EFB97676.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9765]
 gi|282763569|gb|EFC03698.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A8117]
 gi|285816736|gb|ADC37223.1| quinol oxidase polypeptide IV QoxD [Staphylococcus aureus 04-02981]
 gi|294824845|gb|EFG41267.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A9754]
 gi|294969297|gb|EFG45317.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8819]
 gi|296887047|gb|EFH25950.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297177756|gb|EFH37006.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus A8796]
 gi|298694295|gb|ADI97517.1| probable quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus ED133]
 gi|300886630|gb|EFK81832.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302332668|gb|ADL22861.1| putative quinol oxidase polypeptide IV QoxD [Staphylococcus aureus
           subsp. aureus JKD6159]
 gi|304340062|gb|EFM06004.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|315130358|gb|EFT86345.1| possible cytochrome c oxidase subunit IV [Staphylococcus aureus
           subsp. aureus CGS03]
 gi|315197481|gb|EFU27817.1| possible cytochrome c oxidase subunit IV [Staphylococcus aureus
           subsp. aureus CGS01]
 gi|320141126|gb|EFW32973.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus MRSA131]
 gi|320143183|gb|EFW34973.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus MRSA177]
          Length = 96

 Score = 49.4 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  + L+ F+H++   
Sbjct: 3   TIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLT-IIFGFAFVQAGLQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF +++     VG+ WVM
Sbjct: 62  DGRLQTFKVIFALVITLCFVVGTYWVM 88


>gi|258451993|ref|ZP_05700009.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A5948]
 gi|257860208|gb|EEV83040.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A5948]
          Length = 96

 Score = 49.4 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  + L+ F+H++   
Sbjct: 3   TIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLT-IIFGFAFVQAGLQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF +++     VG+ WVM
Sbjct: 62  DGRLQTFKVIFALVITLCFIVGTYWVM 88


>gi|152974414|ref|YP_001373931.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023166|gb|ABS20936.1| Cytochrome aa3 quinol oxidase subunit IV [Bacillus cytotoxicus NVH
           391-98]
          Length = 98

 Score = 49.4 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             + GFILSL LT +   + +    L  + +  +I+  A+AQ  + LV F+HM    E  
Sbjct: 14  SHVFGFILSLALTFLALYVALY-TSLPLSTVLTSIIAMAVAQAALQLVMFMHMKEG-EGI 71

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHL 105
              +AM+F+  +  +   G++W+ + +
Sbjct: 72  AQTIAMLFSFFIAVVTVAGTVWIFFSM 98


>gi|49483222|ref|YP_040446.1| quinol oxidase polypeptide IV [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425112|ref|ZP_05601538.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257430409|ref|ZP_05606791.1| quinol oxidase subunit 4 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433112|ref|ZP_05609470.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257436010|ref|ZP_05612057.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M876]
 gi|258423559|ref|ZP_05686449.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9635]
 gi|282903607|ref|ZP_06311495.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C160]
 gi|282905377|ref|ZP_06313232.1| cytochrome aa3 quinol oxidase subunit IV [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282908349|ref|ZP_06316180.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282910636|ref|ZP_06318439.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282913833|ref|ZP_06321620.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M899]
 gi|282916309|ref|ZP_06324071.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus D139]
 gi|282918758|ref|ZP_06326493.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C427]
 gi|282923880|ref|ZP_06331556.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C101]
 gi|283770121|ref|ZP_06343013.1| quinol oxidase subunit 4 [Staphylococcus aureus subsp. aureus H19]
 gi|283957804|ref|ZP_06375255.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|293500871|ref|ZP_06666722.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|293509827|ref|ZP_06668536.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M809]
 gi|293526413|ref|ZP_06671098.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M1015]
 gi|295427547|ref|ZP_06820179.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591502|ref|ZP_06950140.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus MN8]
 gi|81651376|sp|Q6GI26|QOX4_STAAR RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|49241351|emb|CAG40035.1| putative quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus MRSA252]
 gi|257272088|gb|EEV04220.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257278537|gb|EEV09156.1| quinol oxidase subunit 4 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281205|gb|EEV11342.1| cytochrome c oxidase subunit IV [Staphylococcus aureus subsp.
           aureus E1410]
 gi|257284292|gb|EEV14412.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M876]
 gi|257846260|gb|EEV70284.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           A9635]
 gi|282313852|gb|EFB44244.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C101]
 gi|282316568|gb|EFB46942.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C427]
 gi|282319749|gb|EFB50097.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus D139]
 gi|282321901|gb|EFB52225.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M899]
 gi|282325241|gb|EFB55550.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus WBG10049]
 gi|282328014|gb|EFB58296.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus WW2703/97]
 gi|282330669|gb|EFB60183.1| cytochrome aa3 quinol oxidase subunit IV [Staphylococcus aureus
           subsp. aureus Btn1260]
 gi|282595225|gb|EFC00189.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus C160]
 gi|283460268|gb|EFC07358.1| quinol oxidase subunit 4 [Staphylococcus aureus subsp. aureus H19]
 gi|283789953|gb|EFC28770.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus A017934/97]
 gi|290920485|gb|EFD97548.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M1015]
 gi|291095876|gb|EFE26137.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus 58-424]
 gi|291467277|gb|EFF09794.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus aureus
           subsp. aureus M809]
 gi|295127905|gb|EFG57539.1| cytochrome aa3 quinol oxidase [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576388|gb|EFH95104.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus MN8]
 gi|312438567|gb|ADQ77638.1| quinol oxidase subunit IV [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315193726|gb|EFU24121.1| putative quinol oxidase polypeptide IV [Staphylococcus aureus
           subsp. aureus CGS00]
          Length = 96

 Score = 49.0 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  + L+ F+H++   
Sbjct: 3   TIMKHTVGFIASIVLTLLAVYVTLYTSLTFHAKLT-IIFGFAFIQAGLQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF +++     VG+ WVM
Sbjct: 62  DGRLQTFKVIFALVITLCFVVGTYWVM 88


>gi|15614630|ref|NP_242933.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus halodurans
          C-125]
 gi|10174686|dbj|BAB05786.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus halodurans
          C-125]
          Length = 136

 Score = 49.0 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 28/98 (28%), Positives = 41/98 (41%), Gaps = 2/98 (2%)

Query: 1  MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
          M ++       HS+      +VGF LS+I T++    VM       N+  + I + A  Q
Sbjct: 1  MAHEKE-TTATHSHSFPWMHVVGFALSIIFTLLAVW-VMSQTHWSWNVRVIVIFIFAFIQ 58

Query: 61 IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGS 98
          + V L  F+HM         I    F I +  I  VGS
Sbjct: 59 MTVQLHMFMHMGEGKSGTVQIGHTWFAIAIAVIIVVGS 96


>gi|289811051|ref|ZP_06541680.1| cytochrome o ubiquinol oxidase subunit IV [Salmonella enterica
          subsp. enterica serovar Typhi str. AG3]
          Length = 40

 Score = 48.6 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15 GTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIV 54
          G+ K  + GFILS+ILT+IPF +VM G      I+   + 
Sbjct: 1  GSVKTYMTGFILSVILTVIPFWMVMTGAASPAVILGSILA 40


>gi|261420865|ref|YP_003254547.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus sp. Y412MC61]
 gi|297531650|ref|YP_003672925.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus sp. C56-T3]
 gi|319768536|ref|YP_004134037.1| cytochrome aa3 quinol oxidase subunit IV [Geobacillus sp. Y412MC52]
 gi|261377322|gb|ACX80065.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp.
           Y412MC61]
 gi|297254902|gb|ADI28348.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp. C56-T3]
 gi|317113402|gb|ADU95894.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp.
           Y412MC52]
          Length = 99

 Score = 48.2 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 21/82 (25%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+LSL+LT     + +    L    + + IV+ A+ Q  + L  F+H++        
Sbjct: 15  IIGFLLSLVLTFAALWVALS-SGLPLKAVIVIIVVFAVIQASLQLFMFMHVNESDSGRIQ 73

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              M ++  +  +   GS+WVM
Sbjct: 74  TFNMAYSFFIAIVVVAGSIWVM 95


>gi|229541232|ref|ZP_04430292.1| cytochrome c oxidase, subunit IV [Bacillus coagulans 36D1]
 gi|229325652|gb|EEN91327.1| cytochrome c oxidase, subunit IV [Bacillus coagulans 36D1]
          Length = 109

 Score = 47.8 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 24/80 (30%), Positives = 36/80 (45%), Gaps = 2/80 (2%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  +V FIL + LTII F  V     L K      I+L A  Q++  L +F+HM+ K  
Sbjct: 25  MKYQVVSFILMMFLTIIAFWAVHAH--LSKWFTIPVILLLAAIQVVFQLFYFMHMNHKHH 82

Query: 77  DGWSIMAMIFTIIMVAICFV 96
           +G  +     T++       
Sbjct: 83  EGPKLFIFGGTLVAFVTVLA 102


>gi|330684199|gb|EGG95943.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis VCU121]
          Length = 96

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  V L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTSMTFHAKVT-IIFGFAFIQAAVQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+     VG+ WVM
Sbjct: 62  DGRVQSFKVIFAIIITLAIVVGTYWVM 88


>gi|228474443|ref|ZP_04059178.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus hominis
           SK119]
 gi|314936751|ref|ZP_07844098.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus hominis
           subsp. hominis C80]
 gi|228271802|gb|EEK13149.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus hominis
           SK119]
 gi|313655370|gb|EFS19115.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus hominis
           subsp. hominis C80]
          Length = 96

 Score = 47.8 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +             I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKTT-IIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  I  +G+ WVM
Sbjct: 62  DGRLQSAKVIFAIIITLITVIGTYWVM 88


>gi|242373278|ref|ZP_04818852.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis
           M23864:W1]
 gi|242348988|gb|EES40590.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis
           M23864:W1]
          Length = 96

 Score = 47.4 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  V L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTSMTFHAKVT-IIFGFAFIQAAVQLLMFMHLTEGR 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+     +G+ WVM
Sbjct: 62  DGRLQSFKVIFAIIITLAIVIGTYWVM 88


>gi|242242362|ref|ZP_04796807.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis W23144]
 gi|242234169|gb|EES36481.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis W23144]
 gi|319401615|gb|EFV89825.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis FRI909]
          Length = 96

 Score = 47.4 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +    +  +     I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLY-TNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  I  +G+ WVM
Sbjct: 62  DGRLQSFKVIFAIIITLITVIGTYWVM 88


>gi|223043905|ref|ZP_03613947.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus capitis
           SK14]
 gi|314933254|ref|ZP_07840619.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus caprae
           C87]
 gi|222442809|gb|EEE48912.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus capitis
           SK14]
 gi|313653404|gb|EFS17161.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus caprae
           C87]
          Length = 96

 Score = 47.4 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +         +   I   A  Q  V L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTSMTFHAKVT-IIFGFAFIQAAVQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+     +G+ WVM
Sbjct: 62  DGRVQSFKVIFAIIITLAIVIGTYWVM 88


>gi|70726905|ref|YP_253819.1| hypothetical protein SH1904 [Staphylococcus haemolyticus JCSC1435]
 gi|123659872|sp|Q4L562|QOX4_STAHJ RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|68447629|dbj|BAE05213.1| unnamed protein product [Staphylococcus haemolyticus JCSC1435]
          Length = 96

 Score = 46.7 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 40/87 (45%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +             I   A  Q  V L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTNMTFHAKTT-IIFGFAFIQAAVQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  +  +G+ WVM
Sbjct: 62  DGQVQSFKVIFAIIITLVTVIGTYWVM 88


>gi|299535601|ref|ZP_07048922.1| cytochrome aa3 quinol oxidase, subunit IV [Lysinibacillus
           fusiformis ZC1]
 gi|298728801|gb|EFI69355.1| cytochrome aa3 quinol oxidase, subunit IV [Lysinibacillus
           fusiformis ZC1]
          Length = 94

 Score = 46.7 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/85 (25%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 18  KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
           KQ ++GF  SL+LTI+   +V   F +  N+    +++ A+AQ  V LV F+H+    + 
Sbjct: 7   KQHVMGFGFSLLLTIVALAVV--KFDMSLNMAFGILLVTALAQATVQLVLFMHIGESEDK 64

Query: 78  GWSIMAMIFTIIMVAICFVGSMWVM 102
                 +++++ +  +  +G+++ M
Sbjct: 65  KTLYTTILYSVFVGVVTIIGTLFAM 89


>gi|27467674|ref|NP_764311.1| putative quinol oxidase polypeptide IV QoxD [Staphylococcus
           epidermidis ATCC 12228]
 gi|57866535|ref|YP_188228.1| quinol oxidase, subunit IV [Staphylococcus epidermidis RP62A]
 gi|251810511|ref|ZP_04824984.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282876584|ref|ZP_06285449.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis SK135]
 gi|293366954|ref|ZP_06613629.1| quinol oxidase subunit IV [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|81675020|sp|Q5HQB2|QOX4_STAEQ RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|81842949|sp|Q8CPP9|QOX4_STAES RecName: Full=Probable quinol oxidase subunit 4; AltName:
           Full=Quinol oxidase polypeptide IV
 gi|27315218|gb|AAO04353.1|AE016746_143 putative quinol oxidase polypeptide IV QoxD [Staphylococcus
           epidermidis ATCC 12228]
 gi|57637193|gb|AAW53981.1| quinol oxidase, subunit IV [Staphylococcus epidermidis RP62A]
 gi|251805922|gb|EES58579.1| cytochrome c oxidase subunit IV [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281294672|gb|EFA87201.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis SK135]
 gi|291318929|gb|EFE59300.1| quinol oxidase subunit IV [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|329732860|gb|EGG69206.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis VCU144]
 gi|329734218|gb|EGG70534.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis VCU028]
 gi|329735521|gb|EGG71809.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus
           epidermidis VCU045]
          Length = 96

 Score = 46.7 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/87 (25%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +    +  +     I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLY-TNMTFHAKVTIIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  +  +G+ WVM
Sbjct: 62  DGRLQSFKVIFAIIITLVTVIGTYWVM 88


>gi|251799267|ref|YP_003013998.1| cytochrome C oxidase subunit IV [Paenibacillus sp. JDR-2]
 gi|247546893|gb|ACT03912.1| cytochrome C oxidase subunit IV [Paenibacillus sp. JDR-2]
          Length = 105

 Score = 46.7 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 48/80 (60%), Gaps = 2/80 (2%)

Query: 18 KQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVED 77
          K+ +V FI S++LT+I F  V  G  ++ + + + ++ CAI Q+ V + F++HM  +   
Sbjct: 21 KKHIVAFIFSILLTLIAFAAV-AGGEINTDFIYIILIGCAILQVFVQMAFWMHMKDR-GH 78

Query: 78 GWSIMAMIFTIIMVAICFVG 97
           ++I+ ++F + +V  C + 
Sbjct: 79 TFAIIGILFGVFVVFTCVIM 98


>gi|218288765|ref|ZP_03493028.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           LAA1]
 gi|218241123|gb|EED08299.1| cytochrome C oxidase subunit IV [Alicyclobacillus acidocaldarius
           LAA1]
          Length = 106

 Score = 45.9 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/84 (27%), Positives = 42/84 (50%), Gaps = 1/84 (1%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
           Q + G++LSL+LT I F +V         ++ L + L A+  ++V L  F+H++      
Sbjct: 17  QYVTGYVLSLVLTAIAFVLVAFHVLPVPLLLVLLMALAALQ-VLVQLFLFMHVTEGDGSR 75

Query: 79  WSIMAMIFTIIMVAICFVGSMWVM 102
              +AM   +       +GS+W+M
Sbjct: 76  VKGLAMGLGLFFTLAIALGSIWIM 99


>gi|228989831|ref|ZP_04149811.1| Quinol oxidase, subunit IV [Bacillus pseudomycoides DSM 12442]
 gi|228996022|ref|ZP_04155677.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|229003638|ref|ZP_04161453.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228757604|gb|EEM06834.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228763718|gb|EEM12610.1| Quinol oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|228769978|gb|EEM18561.1| Quinol oxidase, subunit IV [Bacillus pseudomycoides DSM 12442]
          Length = 101

 Score = 45.9 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 2/87 (2%)

Query: 19  QCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDG 78
             + GFILSL LT +   + +        I+   I++ A+AQ  +  V F+HM T+ E  
Sbjct: 17  SHVFGFILSLALTFLAVYVTLYTSLPLSTILTA-ILVMAVAQAALQFVMFMHM-TEGEGV 74

Query: 79  WSIMAMIFTIIMVAICFVGSMWVMYHL 105
              + ++F   + A+  VG++W+ + +
Sbjct: 75  IQTITIVFHFFIAAVTVVGTVWIFFSM 101


>gi|226314593|ref|YP_002774489.1| cytochrome c oxidase polypeptide IVB [Brevibacillus brevis NBRC
           100599]
 gi|226097543|dbj|BAH45985.1| cytochrome c oxidase polypeptide IVB [Brevibacillus brevis NBRC
           100599]
          Length = 105

 Score = 45.9 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/90 (32%), Positives = 40/90 (44%), Gaps = 3/90 (3%)

Query: 14  YGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMST 73
           +   K+ LV FI SL+LT + F  V              IV  A  Q    L  ++HM  
Sbjct: 17  HEGPKRHLVAFIGSLVLTALAFIAVAYEAIPS-GFTVPFIVALAFVQAFFQLYVWMHMDQ 75

Query: 74  KVED--GWSIMAMIFTIIMVAICFVGSMWV 101
           K  +    SI A +F I+M  I F+  +WV
Sbjct: 76  KGHEFARISIFAGLFVIMMAIIVFIFWVWV 105


>gi|289551130|ref|YP_003472034.1| quinol oxidase polypeptide IV QoxD [Staphylococcus lugdunensis
           HKU09-01]
 gi|315658631|ref|ZP_07911501.1| quinol oxidase subunit IV [Staphylococcus lugdunensis M23590]
 gi|289180662|gb|ADC87907.1| quinol oxidase polypeptide IV QoxD [Staphylococcus lugdunensis
           HKU09-01]
 gi|315496262|gb|EFU84587.1| quinol oxidase subunit IV [Staphylococcus lugdunensis M23590]
          Length = 96

 Score = 45.5 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/87 (24%), Positives = 41/87 (47%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  +GFI S++LT++   + +         +   I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTIGFIASIVLTLLAVFVTLYTTLTFHAKVT-IIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  +  +G+ WVM
Sbjct: 62  DGQVQSFKVIFAIIITLVTVIGTYWVM 88


>gi|224476168|ref|YP_002633774.1| putative quinol oxidase polypeptide IV [Staphylococcus carnosus
           subsp. carnosus TM300]
 gi|222420775|emb|CAL27589.1| putative quinol oxidase polypeptide IV [Staphylococcus carnosus
           subsp. carnosus TM300]
          Length = 96

 Score = 45.5 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/87 (28%), Positives = 42/87 (48%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +    L  N     I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLY-TSLTLNAKITIIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +       +IF II+  +  +GS WVM
Sbjct: 62  DGQAQSFKVIFAIIITLVTVIGSYWVM 88


>gi|206978404|ref|ZP_03239274.1| cytochrome c oxidase, subunit IVB [Bacillus cereus H3081.97]
 gi|217961426|ref|YP_002339994.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH187]
 gi|222097389|ref|YP_002531446.1| cytochrome c oxidase, subunit iv [Bacillus cereus Q1]
 gi|229031571|ref|ZP_04187571.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1271]
 gi|229140669|ref|ZP_04269217.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST26]
 gi|229174608|ref|ZP_04302137.1| Cytochrome c oxidase, subunit IV [Bacillus cereus MM3]
 gi|229198057|ref|ZP_04324769.1| Cytochrome c oxidase, subunit IV [Bacillus cereus m1293]
 gi|206743384|gb|EDZ54821.1| cytochrome c oxidase, subunit IVB [Bacillus cereus H3081.97]
 gi|217066356|gb|ACJ80606.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH187]
 gi|221241447|gb|ACM14157.1| cytochrome c oxidase, subunit IV [Bacillus cereus Q1]
 gi|228585415|gb|EEK43521.1| Cytochrome c oxidase, subunit IV [Bacillus cereus m1293]
 gi|228608860|gb|EEK66153.1| Cytochrome c oxidase, subunit IV [Bacillus cereus MM3]
 gi|228642741|gb|EEK99024.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST26]
 gi|228729860|gb|EEL80840.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1271]
 gi|324327841|gb|ADY23101.1| cytochrome c oxidase, subunit IVB [Bacillus thuringiensis serovar
          finitimus YBT-020]
          Length = 110

 Score = 45.5 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFAAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|229075697|ref|ZP_04208679.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock4-18]
 gi|229098411|ref|ZP_04229356.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-29]
 gi|229117437|ref|ZP_04246813.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|228666047|gb|EEL21513.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock1-3]
 gi|228685028|gb|EEL38961.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-29]
 gi|228707473|gb|EEL59664.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock4-18]
          Length = 110

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|47565816|ref|ZP_00236855.1| cytochrome o ubiquinol oxidase, protein CyoD, putative [Bacillus
          cereus G9241]
 gi|75762089|ref|ZP_00741995.1| Cytochrome c oxidase polypeptide IVB [Bacillus thuringiensis
          serovar israelensis ATCC 35646]
 gi|218899097|ref|YP_002447508.1| cytochrome c oxidase, subunit IVB [Bacillus cereus G9842]
 gi|228902447|ref|ZP_04066601.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis IBL
          4222]
 gi|228909767|ref|ZP_04073590.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228941102|ref|ZP_04103658.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228966962|ref|ZP_04128000.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          sotto str. T04001]
 gi|228974034|ref|ZP_04134607.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228980626|ref|ZP_04140934.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|228987084|ref|ZP_04147209.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|229157518|ref|ZP_04285595.1| Cytochrome c oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|47557096|gb|EAL15425.1| cytochrome o ubiquinol oxidase, protein CyoD, putative [Bacillus
          cereus G9241]
 gi|74490423|gb|EAO53733.1| Cytochrome c oxidase polypeptide IVB [Bacillus thuringiensis
          serovar israelensis ATCC 35646]
 gi|218545539|gb|ACK97933.1| cytochrome c oxidase, subunit IVB [Bacillus cereus G9842]
 gi|228625968|gb|EEK82718.1| Cytochrome c oxidase, subunit IV [Bacillus cereus ATCC 4342]
 gi|228772678|gb|EEM21119.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228779094|gb|EEM27353.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis Bt407]
 gi|228785670|gb|EEM33676.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228792696|gb|EEM40260.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          sotto str. T04001]
 gi|228818555|gb|EEM64624.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228850056|gb|EEM94887.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis IBL 200]
 gi|228857191|gb|EEN01697.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis IBL
          4222]
 gi|326941713|gb|AEA17609.1| cytochrome c oxidase polypeptide IVB [Bacillus thuringiensis
          serovar chinensis CT-43]
          Length = 110

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|30264012|ref|NP_846389.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. Ames]
 gi|47529449|ref|YP_020798.1| cytochrome c oxidase subunit IVB [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49186851|ref|YP_030103.1| cytochrome c oxidase subunit IVB [Bacillus anthracis str. Sterne]
 gi|49479382|ref|YP_038003.1| cytochrome c oxidase subunit IV [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52141546|ref|YP_085282.1| cytochrome c oxidase, subunit IV [Bacillus cereus E33L]
 gi|65321336|ref|ZP_00394295.1| COG3125: Heme/copper-type cytochrome/quinol oxidase, subunit 4
          [Bacillus anthracis str. A2012]
 gi|165872200|ref|ZP_02216839.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0488]
 gi|167633708|ref|ZP_02392032.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0442]
 gi|167641026|ref|ZP_02399283.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0193]
 gi|170688777|ref|ZP_02879981.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0465]
 gi|170705699|ref|ZP_02896162.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0389]
 gi|177654357|ref|ZP_02936286.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0174]
 gi|190565970|ref|ZP_03018889.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis
          Tsiankovskii-I]
 gi|196035905|ref|ZP_03103307.1| cytochrome c oxidase, subunit IVB [Bacillus cereus W]
 gi|196038632|ref|ZP_03105940.1| cytochrome c oxidase, subunit IVB [Bacillus cereus NVH0597-99]
 gi|196045812|ref|ZP_03113041.1| cytochrome c oxidase, subunit IVB [Bacillus cereus 03BB108]
 gi|218905072|ref|YP_002452906.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH820]
 gi|225865923|ref|YP_002751301.1| cytochrome c oxidase, subunit IVB [Bacillus cereus 03BB102]
 gi|227816715|ref|YP_002816724.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. CDC
          684]
 gi|228916578|ref|ZP_04080144.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228928988|ref|ZP_04092020.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228935256|ref|ZP_04098082.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228947660|ref|ZP_04109950.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|229092990|ref|ZP_04224121.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-42]
 gi|229123462|ref|ZP_04252661.1| Cytochrome c oxidase, subunit IV [Bacillus cereus 95/8201]
 gi|229186181|ref|ZP_04313350.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BGSC 6E1]
 gi|229604459|ref|YP_002868241.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0248]
 gi|254683708|ref|ZP_05147568.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str.
          CNEVA-9066]
 gi|254721543|ref|ZP_05183332.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A1055]
 gi|254736053|ref|ZP_05193759.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str.
          Western North America USA6153]
 gi|254743944|ref|ZP_05201627.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. Kruger
          B]
 gi|254754277|ref|ZP_05206312.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str.
          Vollum]
 gi|254758032|ref|ZP_05210059.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str.
          Australia 94]
 gi|301055432|ref|YP_003793643.1| cytochrome c oxidase subunit IV [Bacillus anthracis CI]
 gi|30258657|gb|AAP27875.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. Ames]
 gi|47504597|gb|AAT33273.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|49180778|gb|AAT56154.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str.
          Sterne]
 gi|49330938|gb|AAT61584.1| cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|51975015|gb|AAU16565.1| cytochrome c oxidase, subunit IV [Bacillus cereus E33L]
 gi|164712147|gb|EDR17685.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0488]
 gi|167511076|gb|EDR86465.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0193]
 gi|167531114|gb|EDR93801.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0442]
 gi|170129239|gb|EDS98103.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0389]
 gi|170667293|gb|EDT18052.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0465]
 gi|172080847|gb|EDT65928.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0174]
 gi|190562889|gb|EDV16855.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis
          Tsiankovskii-I]
 gi|195991554|gb|EDX55520.1| cytochrome c oxidase, subunit IVB [Bacillus cereus W]
 gi|196023252|gb|EDX61930.1| cytochrome c oxidase, subunit IVB [Bacillus cereus 03BB108]
 gi|196030355|gb|EDX68954.1| cytochrome c oxidase, subunit IVB [Bacillus cereus NVH0597-99]
 gi|218538510|gb|ACK90908.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH820]
 gi|225788317|gb|ACO28534.1| cytochrome c oxidase, subunit IVB [Bacillus cereus 03BB102]
 gi|227005660|gb|ACP15403.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. CDC
          684]
 gi|228597357|gb|EEK55008.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BGSC 6E1]
 gi|228659949|gb|EEL15590.1| Cytochrome c oxidase, subunit IV [Bacillus cereus 95/8201]
 gi|228690361|gb|EEL44147.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-42]
 gi|228812180|gb|EEM58511.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228824421|gb|EEM70227.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228830795|gb|EEM76400.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228843157|gb|EEM88239.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|229268867|gb|ACQ50504.1| cytochrome c oxidase, subunit IVB [Bacillus anthracis str. A0248]
 gi|300377601|gb|ADK06505.1| cytochrome c oxidase, subunit IV [Bacillus cereus biovar
          anthracis str. CI]
          Length = 110

 Score = 44.4 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|239826489|ref|YP_002949113.1| cytochrome C oxidase subunit IV [Geobacillus sp. WCH70]
 gi|239806782|gb|ACS23847.1| cytochrome c oxidase, subunit IV [Geobacillus sp. WCH70]
          Length = 110

 Score = 44.0 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 39/84 (46%), Gaps = 6/84 (7%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  ++ F+L ++ T+I F  V    F         I+L A+ Q++  L +F+HMS K  
Sbjct: 25  MKHQVISFVLMILFTLIAFTAVGYDKFSPW-FSVPFILLLAVVQVLFQLYYFMHMSHK-- 81

Query: 77  DGWSIMAMIFTIIMVAICFVGSMW 100
                   ++  I+VA     ++W
Sbjct: 82  GHEMPALFMYGGILVAFV---TIW 102


>gi|255025410|ref|ZP_05297396.1| hypothetical protein LmonocytFSL_02104 [Listeria monocytogenes
          FSL J2-003]
          Length = 77

 Score = 44.0 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%)

Query: 1  MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
          M  +N  N      G   + +VGF LS++LT++   + +       N+  + I + A  Q
Sbjct: 1  MTQNNKSNAAHAEGGIPWKHIVGFALSVVLTLLAVWVALYSTLT-TNVKVVIIFIFAFIQ 59

Query: 61 IIVHLVFFLHMSTKVEDG 78
            + L+ F+HM+   +  
Sbjct: 60 AALQLLMFMHMTEGRDGK 77


>gi|228922692|ref|ZP_04085991.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228836966|gb|EEM82308.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
          Length = 110

 Score = 43.6 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           +  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MRHQVITFALMIFLTLVAFVAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|152976355|ref|YP_001375872.1| cytochrome c oxidase subunit IV [Bacillus cereus subsp. cytotoxis
          NVH 391-98]
 gi|152025107|gb|ABS22877.1| Cytochrome c oxidase subunit IV bacillaceae [Bacillus cytotoxicus
          NVH 391-98]
          Length = 112

 Score = 43.6 bits (102), Expect = 0.010,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F L + LTI+ F  V              I+L A+ Q+I  L +F+HMS K
Sbjct: 26 MKHQVITFGLMIFLTIVAFVAVAYPKTFSPIFSVPFILLLAVVQVIFQLYYFMHMSHK 83


>gi|229019143|ref|ZP_04175977.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1273]
 gi|229025386|ref|ZP_04181804.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228735971|gb|EEL86548.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1272]
 gi|228742159|gb|EEL92325.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH1273]
          Length = 110

 Score = 43.2 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAFPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|229086505|ref|ZP_04218677.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-44]
 gi|228696822|gb|EEL49635.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-44]
          Length = 112

 Score = 43.2 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           +  ++ F L + LTI+ F  V              I+L A+ Q+I  L +F+HMS K
Sbjct: 26 MRHQVITFGLMIFLTIVAFAAVAYPKTFSPLFSVPFILLLAVVQVIFQLYYFMHMSHK 83


>gi|229162875|ref|ZP_04290832.1| Cytochrome c oxidase, subunit IV [Bacillus cereus R309803]
 gi|228620757|gb|EEK77626.1| Cytochrome c oxidase, subunit IV [Bacillus cereus R309803]
          Length = 110

 Score = 43.2 bits (101), Expect = 0.013,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAYPKTFSPIFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|42783036|ref|NP_980283.1| cytochrome c oxidase, subunit IVB [Bacillus cereus ATCC 10987]
 gi|42738963|gb|AAS42891.1| cytochrome c oxidase, subunit IVB [Bacillus cereus ATCC 10987]
          Length = 110

 Score = 42.8 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MKHQVITFALMIFLTLVAFVAVAYPKTFSPIFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|172057994|ref|YP_001814454.1| cytochrome C oxidase subunit IV [Exiguobacterium sibiricum 255-15]
 gi|171990515|gb|ACB61437.1| cytochrome C oxidase subunit IV [Exiguobacterium sibiricum 255-15]
          Length = 109

 Score = 42.8 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/82 (26%), Positives = 35/82 (42%), Gaps = 3/82 (3%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           L  F L + LT+I FG VM             +++ AI Q+ + L  F+HM+ K      
Sbjct: 29  LTSFALMIFLTLIAFGAVMAELMPHWAA-GGFLIIMAIVQVYLQLYMFMHMNNKGNTWVK 87

Query: 81  IMAM--IFTIIMVAICFVGSMW 100
           +M    IF  + +       +W
Sbjct: 88  VMMALGIFVALTIVATLRLLIW 109


>gi|311029887|ref|ZP_07707977.1| cytochrome c oxidase, subunit IVB [Bacillus sp. m3-13]
          Length = 110

 Score = 42.8 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 39/78 (50%), Gaps = 4/78 (5%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  +V F+L + LT++ F  V  G  + K  +   I+L AI Q I  L +F+HM+ K  
Sbjct: 26 MKYQVVSFVLMIFLTLLAFLAV--GAEMSKYFIVPFIILMAIVQCIFQLYYFMHMNHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ + V + 
Sbjct: 82 GHETPALFLYSGLAVGLI 99


>gi|229104503|ref|ZP_04235170.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-28]
 gi|228678945|gb|EEL33155.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock3-28]
          Length = 100

 Score = 42.8 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 14 MKHQVITFALMIFLTLVAFVAVAYPKTFSPTFSVPFILLLAVVQVIFQLYYFMHMSHK-- 71

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 72 GHEAASFFLYSGLLIGLI 89


>gi|228992677|ref|ZP_04152603.1| Cytochrome c oxidase, subunit IV [Bacillus pseudomycoides DSM
          12442]
 gi|228998721|ref|ZP_04158308.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|229006223|ref|ZP_04163909.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228755064|gb|EEM04423.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides Rock1-4]
 gi|228761189|gb|EEM10148.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides Rock3-17]
 gi|228767009|gb|EEM15646.1| Cytochrome c oxidase, subunit IV [Bacillus pseudomycoides DSM
          12442]
          Length = 112

 Score = 42.4 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           +  ++ F L + LTI+ F  V              I+L A+ Q+I  L +F+HMS K
Sbjct: 26 MRHQVITFGLMIFLTIVAFVAVAYPKTFSPLFSVPFILLLAVVQVIFQLYYFMHMSHK 83


>gi|154685911|ref|YP_001421072.1| CtaF [Bacillus amyloliquefaciens FZB42]
 gi|308173457|ref|YP_003920162.1| cytochrome caa3 oxidase subunit IV [Bacillus amyloliquefaciens DSM
           7]
 gi|154351762|gb|ABS73841.1| CtaF [Bacillus amyloliquefaciens FZB42]
 gi|307606321|emb|CBI42692.1| cytochrome caa3 oxidase (subunit IV) [Bacillus amyloliquefaciens
           DSM 7]
 gi|328553614|gb|AEB24106.1| cytochrome c oxidase, subunit IVB [Bacillus amyloliquefaciens
           TA208]
 gi|328911592|gb|AEB63188.1| cytochrome c oxidase subunit IV [Bacillus amyloliquefaciens LL3]
          Length = 110

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 3/86 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  ++ F L + LT++ F  V          M   I+  A+ Q+I  L +F+HMS K  
Sbjct: 25  MKYQVISFGLMIGLTLVAFLTVAADGIAGWFTMPFLIL-LAVIQVIFQLFYFMHMSQKGH 83

Query: 77  DGWSIM--AMIFTIIMVAICFVGSMW 100
           +  S+   + IF   +  + FV  +W
Sbjct: 84  EAPSLFLYSGIFVAFITVLAFVTIIW 109


>gi|311068009|ref|YP_003972932.1| cytochrome c oxidase, subunit IVB [Bacillus atrophaeus 1942]
 gi|310868526|gb|ADP32001.1| cytochrome c oxidase, subunit IVB [Bacillus atrophaeus 1942]
          Length = 110

 Score = 42.4 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK-- 74
            K  ++ F L + LT++ F  V      +       I+L A+ Q+I  L +F+HM+ K  
Sbjct: 25  MKYQVLSFGLMIGLTLVAFLTVASDDIGNW-FTIPFIILLAVIQVIFQLFYFMHMNQKGH 83

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMW 100
                 + + IF   +  + FV  +W
Sbjct: 84  EAPALFLYSGIFVAFITVLAFVTIIW 109


>gi|163941680|ref|YP_001646564.1| cytochrome c oxidase subunit IV [Bacillus weihenstephanensis
          KBAB4]
 gi|229013146|ref|ZP_04170290.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides DSM 2048]
 gi|229061604|ref|ZP_04198946.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH603]
 gi|229134749|ref|ZP_04263558.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST196]
 gi|229168680|ref|ZP_04296402.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH621]
 gi|163863877|gb|ABY44936.1| Cytochrome c oxidase subunit IV bacillaceae [Bacillus
          weihenstephanensis KBAB4]
 gi|228614836|gb|EEK71939.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH621]
 gi|228648795|gb|EEL04821.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST196]
 gi|228717695|gb|EEL69348.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH603]
 gi|228748096|gb|EEL97957.1| Cytochrome c oxidase, subunit IV [Bacillus mycoides DSM 2048]
          Length = 110

 Score = 42.0 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 28/58 (48%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  +V F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K
Sbjct: 24 MKHQVVTFSLMIFLTLVAFAAVAYPKTFSPIFSVPFILLLAVIQVIFQLYYFMHMSHK 81


>gi|295698392|ref|YP_003603047.1| hypothetical protein RIEPE_0169 [Candidatus Riesia pediculicola
           USDA]
 gi|291157309|gb|ADD79754.1| hypothetical protein RIEPE_0169 [Candidatus Riesia pediculicola
           USDA]
          Length = 70

 Score = 42.0 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 36/59 (61%)

Query: 51  LTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNM 109
           + I + +IA+I +H + FL++    E  + I  ++F II+  I   GS+W+M+HL  NM
Sbjct: 1   MIIFISSIARISIHFLVFLNLKLFKEKIYKISFLMFFIIISFILSSGSLWIMHHLRTNM 59


>gi|206971011|ref|ZP_03231962.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH1134]
 gi|218236053|ref|YP_002368741.1| cytochrome c oxidase, subunit IVB [Bacillus cereus B4264]
 gi|228954217|ref|ZP_04116245.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228960202|ref|ZP_04121859.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|229047626|ref|ZP_04193215.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH676]
 gi|229071440|ref|ZP_04204662.1| Cytochrome c oxidase, subunit IV [Bacillus cereus F65185]
 gi|229081193|ref|ZP_04213703.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|229111411|ref|ZP_04240963.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|229129218|ref|ZP_04258191.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|229146512|ref|ZP_04274883.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|229152139|ref|ZP_04280333.1| Cytochrome c oxidase, subunit IV [Bacillus cereus m1550]
 gi|229180216|ref|ZP_04307560.1| Cytochrome c oxidase, subunit IV [Bacillus cereus 172560W]
 gi|229192149|ref|ZP_04319117.1| Cytochrome c oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|296504435|ref|YP_003666135.1| cytochrome c oxidase polypeptide IVB [Bacillus thuringiensis
          BMB171]
 gi|206733783|gb|EDZ50954.1| cytochrome c oxidase, subunit IVB [Bacillus cereus AH1134]
 gi|218164010|gb|ACK64002.1| cytochrome c oxidase, subunit IVB [Bacillus cereus B4264]
 gi|228591356|gb|EEK49207.1| Cytochrome c oxidase, subunit IV [Bacillus cereus ATCC 10876]
 gi|228603425|gb|EEK60902.1| Cytochrome c oxidase, subunit IV [Bacillus cereus 172560W]
 gi|228631331|gb|EEK87966.1| Cytochrome c oxidase, subunit IV [Bacillus cereus m1550]
 gi|228637145|gb|EEK93604.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-ST24]
 gi|228654455|gb|EEL10320.1| Cytochrome c oxidase, subunit IV [Bacillus cereus BDRD-Cer4]
 gi|228672027|gb|EEL27319.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock1-15]
 gi|228702237|gb|EEL54713.1| Cytochrome c oxidase, subunit IV [Bacillus cereus Rock4-2]
 gi|228711731|gb|EEL63684.1| Cytochrome c oxidase, subunit IV [Bacillus cereus F65185]
 gi|228723720|gb|EEL75076.1| Cytochrome c oxidase, subunit IV [Bacillus cereus AH676]
 gi|228799470|gb|EEM46430.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228805537|gb|EEM52128.1| Cytochrome c oxidase, subunit IV [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|296325487|gb|ADH08415.1| cytochrome c oxidase polypeptide IVB [Bacillus thuringiensis
          BMB171]
          Length = 110

 Score = 42.0 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           +  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MRHQVITFALMIFLTLVAFVAVAYPKTFSPIFSVPFILLLAVVQVIFQLYYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|167461104|ref|ZP_02326193.1| hypothetical protein Plarl_00788 [Paenibacillus larvae subsp.
          larvae BRL-230010]
          Length = 104

 Score = 42.0 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 51/88 (57%), Gaps = 2/88 (2%)

Query: 12 HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
          H +   +  ++ +I+SL+LT++ F  V+ G  LDK  + L ++L  + Q+I  LV+++HM
Sbjct: 14 HKHEGPRNHIISYIISLLLTMLAFAAVLYGG-LDKTFLYLFLLLLGVVQVIFQLVYWMHM 72

Query: 72 STKVEDGWSIMAMIFTIIMVAICFVGSM 99
            K      I+++IF ++++      ++
Sbjct: 73 KEK-GHVLPIISLIFGVVVMLTAVAAAV 99


>gi|330950892|gb|EGH51152.1| cytochrome o ubiquinol oxidase subunit IV [Pseudomonas syringae
          Cit 7]
          Length = 31

 Score = 42.0 bits (98), Expect = 0.029,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 4  DNIHNMNMHSYGTKKQCLVGFILSLILT 31
          ++ H+   +S+G+ K  ++GF+LS+ILT
Sbjct: 3  NSHHSAEDNSHGSVKSYVIGFVLSIILT 30


>gi|30022029|ref|NP_833660.1| cytochrome c oxidase polypeptide IVB [Bacillus cereus ATCC 14579]
 gi|29897585|gb|AAP10861.1| Cytochrome c oxidase polypeptide IVB [Bacillus cereus ATCC 14579]
          Length = 110

 Score = 42.0 bits (98), Expect = 0.030,   Method: Composition-based stats.
 Identities = 17/78 (21%), Positives = 36/78 (46%), Gaps = 2/78 (2%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           +  ++ F L + LT++ F  V              I+L A+ Q+I  L +F+HMS K  
Sbjct: 24 MRHQVITFALMIFLTLVAFVAVAYPKTFSPIFSVPFILLLAVVQVIFQLCYFMHMSHK-- 81

Query: 77 DGWSIMAMIFTIIMVAIC 94
             +    +++ +++ + 
Sbjct: 82 GHEAASFFLYSGLLIGLI 99


>gi|212639691|ref|YP_002316211.1| cytochrome caa3 oxidase subunit IV [Anoxybacillus flavithermus
          WK1]
 gi|212561171|gb|ACJ34226.1| Cytochrome caa3 oxidase (subunit IV) [Anoxybacillus flavithermus
          WK1]
          Length = 110

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F L + LT+I F  V    F         I+L A+ Q+I  L +F+HMS K
Sbjct: 25 MKHQIISFTLMIFLTLIAFFAVGYEGFSAW-FSVPFILLLAVVQVIFQLYYFMHMSHK 81


>gi|295399680|ref|ZP_06809661.1| cytochrome c oxidase, subunit IV [Geobacillus thermoglucosidasius
          C56-YS93]
 gi|294978083|gb|EFG53680.1| cytochrome c oxidase, subunit IV [Geobacillus thermoglucosidasius
          C56-YS93]
          Length = 110

 Score = 41.7 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F L ++LT+I F  V    F         I+L AI Q++  L +F+HMS K
Sbjct: 25 MKHQVISFTLMILLTLISFFAVGYDKFSHW-FSVPFILLLAIVQVMFQLYYFMHMSHK 81


>gi|332969497|gb|EGK08516.1| prokaryotic cytochrome C oxidase subunit IV superfamily protein
           [Desmospora sp. 8437]
          Length = 105

 Score = 41.3 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 22/90 (24%), Positives = 42/90 (46%), Gaps = 9/90 (10%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           ++ + ++ F+  L+ T I F +V     L +N++   I+L A  Q+++ L  F+H+  K 
Sbjct: 21  SEGRYMLSFVWMLLFTGISFVLV-GMNLLPENLIIPAILLLAALQVLMQLFTFMHLDFK- 78

Query: 76  EDGWSIMAMIFT----IIMVAICFVGSMWV 101
              W + A +F     I+          WV
Sbjct: 79  ---WYLTATVFMGSGCIVAATAIIAMLYWV 105


>gi|461802|sp|Q03440|COX4_BACP3 RecName: Full=Cytochrome c oxidase subunit 4B; AltName:
          Full=Cytochrome aa3 subunit 4B; AltName:
          Full=Cytochrome c oxidase polypeptide IVB
 gi|77451|pir||JX0143 cytochrome-c oxidase (EC 1.9.3.1) chain IV precursor -
          thermophilic bacterium PS-3
 gi|217152|dbj|BAA03048.1| cytochrome c oxidase subunit 4 [Bacillus sp. PS3]
          Length = 110

 Score = 41.3 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           +  ++ F+L ++LT+I F  V    F     +   I+L A  Q+   L +F+HMS K
Sbjct: 25 MRHQMIAFVLMILLTLIAFAAVGYEEFSHW-FVVPFILLLAAVQVAFQLYYFMHMSHK 81


>gi|138894620|ref|YP_001125073.1| cytochrome caa3-type oxidase IV [Geobacillus thermodenitrificans
           NG80-2]
 gi|196247771|ref|ZP_03146473.1| cytochrome c oxidase, subunit IV [Geobacillus sp. G11MC16]
 gi|1841880|dbj|BAA11114.1| cytochrome c oxidase subunit IV [Geobacillus stearothermophilus]
 gi|134266133|gb|ABO66328.1| Cytochrome caa3-type oxidase IV [Geobacillus thermodenitrificans
           NG80-2]
 gi|196212555|gb|EDY07312.1| cytochrome c oxidase, subunit IV [Geobacillus sp. G11MC16]
          Length = 110

 Score = 41.3 bits (96), Expect = 0.044,   Method: Composition-based stats.
 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 3/80 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            +  ++ F+L ++LT+I F  V    F    ++   I+L A  Q+   L +F+HMS K  
Sbjct: 25  MRHQVIAFVLMILLTLIAFAAVGYEEFSHWFVIP-FILLLAGVQVAFQLYYFMHMSHK-- 81

Query: 77  DGWSIMAMIFTIIMVAICFV 96
                   I+  ++V +  V
Sbjct: 82  GHEFPALFIYGGVLVMLVLV 101


>gi|317129343|ref|YP_004095625.1| cytochrome C oxidase subunit IV [Bacillus cellulosilyticus DSM
           2522]
 gi|315474291|gb|ADU30894.1| cytochrome C oxidase subunit IV [Bacillus cellulosilyticus DSM
           2522]
          Length = 116

 Score = 41.3 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 19/83 (22%), Positives = 42/83 (50%), Gaps = 3/83 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            ++ L+ F+  + LT + F  +              I+L A+ Q+++ L  F+H++ +  
Sbjct: 28  MRKQLISFVFMIFLTSMAFISIASDAI-PATFAIPFILLLAVIQVVLQLYVFMHLNERGN 86

Query: 77  DGWSIMAMIFTIIMVAICFVGSM 99
              +IM  I+T +++AI  V ++
Sbjct: 87  GWTNIM--IWTGVLIAILTVATL 107


>gi|261419282|ref|YP_003252964.1| cytochrome C oxidase subunit IV [Geobacillus sp. Y412MC61]
 gi|297530748|ref|YP_003672023.1| cytochrome C oxidase subunit IV [Geobacillus sp. C56-T3]
 gi|319766098|ref|YP_004131599.1| cytochrome C oxidase subunit IV [Geobacillus sp. Y412MC52]
 gi|261375739|gb|ACX78482.1| cytochrome c oxidase, subunit IV [Geobacillus sp. Y412MC61]
 gi|297254000|gb|ADI27446.1| cytochrome c oxidase, subunit IV [Geobacillus sp. C56-T3]
 gi|317110964|gb|ADU93456.1| cytochrome c oxidase, subunit IV [Geobacillus sp. Y412MC52]
          Length = 110

 Score = 41.3 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           +  ++ F+L ++LT+I F  V    F     +   I+L A  Q+   L +F+HMS K
Sbjct: 25 MRHQMIAFVLMILLTLIAFAAVGYEEFSHW-FVVPFILLLAAVQVAFQLYYFMHMSHK 81


>gi|56419620|ref|YP_146938.1| cytochrome c oxidase subunit IV [Geobacillus kaustophilus HTA426]
 gi|56379462|dbj|BAD75370.1| cytochrome c oxidase subunit IV [Geobacillus kaustophilus HTA426]
          Length = 110

 Score = 41.3 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           +  ++ F+L ++LT+I F  V    F     +   I+L A  Q+   L +F+HMS K
Sbjct: 25 MRHQMIAFVLMILLTLIAFAAVGYEEFSHW-FVVPFILLLAAVQVAFQLYYFMHMSHK 81


>gi|218671103|ref|ZP_03520774.1| hypothetical protein RetlG_05283 [Rhizobium etli GR56]
          Length = 41

 Score = 41.3 bits (96), Expect = 0.050,   Method: Composition-based stats.
 Identities = 21/34 (61%), Positives = 27/34 (79%)

Query: 81  IMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114
           +MA+IFT+I+VAI   GS+WVM+HLN NMM M  
Sbjct: 1   MMALIFTLIIVAIALSGSLWVMHHLNTNMMPMSP 34


>gi|16078556|ref|NP_389375.1| cytochrome caa3 oxidase subunit IV [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221309362|ref|ZP_03591209.1| cytochrome caa3 oxidase (subunit IV) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313689|ref|ZP_03595494.1| cytochrome caa3 oxidase (subunit IV) [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318611|ref|ZP_03599905.1| cytochrome caa3 oxidase (subunit IV) [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322885|ref|ZP_03604179.1| cytochrome caa3 oxidase (subunit IV) [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|321315254|ref|YP_004207541.1| cytochrome c oxidase subunit IVB [Bacillus subtilis BSn5]
 gi|117084|sp|P24013|COX4_BACSU RecName: Full=Cytochrome c oxidase subunit 4B; AltName:
           Full=Caa-3605 subunit 4B; AltName: Full=Cytochrome aa3
           subunit 4B; AltName: Full=Cytochrome c oxidase
           polypeptide IVB
 gi|39872|emb|CAA38079.1| cytochrome-c oxidase subunit IVB [Bacillus subtilis]
 gi|2339995|emb|CAB11345.1| cytochrome c oxidase subunit IV, aa3 type [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|2633863|emb|CAB13365.1| cytochrome caa3 oxidase (subunit IV) [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|320021528|gb|ADV96514.1| cytochrome c oxidase, subunit IVB [Bacillus subtilis BSn5]
          Length = 110

 Score = 41.3 bits (96), Expect = 0.050,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK-- 74
            K  ++ F L + LTI+ F  V          +   I+L AI Q+I  L +F+HM+ K  
Sbjct: 25  MKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFIILLAAI-QVIFQLYYFMHMNQKGH 83

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMW 100
                 + + +F   +  + FV  +W
Sbjct: 84  EAPALFLYSGVFVAFITVLAFVTIIW 109


>gi|23099711|ref|NP_693177.1| cytochrome aa3 quinol oxidase subunit IV [Oceanobacillus iheyensis
           HTE831]
 gi|22777941|dbj|BAC14212.1| cytochrome aa3 quinol oxidase subunit IV [Oceanobacillus iheyensis
           HTE831]
          Length = 94

 Score = 41.3 bits (96), Expect = 0.051,   Method: Composition-based stats.
 Identities = 18/80 (22%), Positives = 37/80 (46%), Gaps = 2/80 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GFI SL+LT+I   + +    +   +    +++ A  Q  V L+ F+H     + G    
Sbjct: 12  GFIFSLLLTVI--ALSVYFLDMSFAMGLTILIVTAFIQAGVQLIVFMHAGESEDKGTIYT 69

Query: 83  AMIFTIIMVAICFVGSMWVM 102
           ++ +  ++  +   GS+  M
Sbjct: 70  SIYYGALIALLTVFGSLLAM 89


>gi|291484041|dbj|BAI85116.1| cytochrome caa3 oxidase subunit IV [Bacillus subtilis subsp. natto
           BEST195]
          Length = 110

 Score = 40.9 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK-- 74
            K  ++ F L + LTI+ F  V          +   I+L AI Q+I  L +F+HM+ K  
Sbjct: 25  MKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFIILLAAI-QVIFQLYYFMHMNQKGH 83

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMW 100
                 + + +F   +  + FV  +W
Sbjct: 84  EAPALFLYSGVFVAFITVLAFVTIIW 109


>gi|319654028|ref|ZP_08008120.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp.
          2_A_57_CT2]
 gi|317394221|gb|EFV74967.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp.
          2_A_57_CT2]
          Length = 94

 Score = 40.9 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 14/79 (17%), Positives = 35/79 (44%), Gaps = 2/79 (2%)

Query: 21 LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
          ++GF+ S++LT+I   + +    +   +    +++ A  Q  V LV F+H     +    
Sbjct: 10 VLGFVFSIMLTVI--ALSVYFLDMSFELAMTILLITAFIQAAVQLVVFMHAGESKDKKSI 67

Query: 81 IMAMIFTIIMVAICFVGSM 99
             + +   +  +   G++
Sbjct: 68 YTTLYYGFFIALVTVFGTL 86


>gi|295703492|ref|YP_003596567.1| cytochrome c oxidase subunit IV [Bacillus megaterium DSM 319]
 gi|294801151|gb|ADF38217.1| cytochrome c oxidase, subunit IV [Bacillus megaterium DSM 319]
          Length = 110

 Score = 40.9 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F + L LT+I F  V + F      +   IVL A+ Q+I  L +F+HM+ K
Sbjct: 26 MKMQVISFGMMLFLTLIAFFAVYQEF--SGWYIMPVIVLLAVVQVIFQLYYFMHMNHK 81


>gi|15615175|ref|NP_243478.1| cytochrome caa3 oxidase (subunit IV) [Bacillus halodurans C-125]
 gi|10175233|dbj|BAB06331.1| cytochrome caa3 oxidase (subunit IV) [Bacillus halodurans C-125]
          Length = 114

 Score = 40.9 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 5/79 (6%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           ++  + F L + LTII F  V       +      ++L A+ Q  + L+FF+HM  K +
Sbjct: 26 IRRQFIVFALMIFLTIIAFLTVAADVV-PRTFAIPFVLLLALIQFTLQLLFFMHMKDK-D 83

Query: 77 DGWSIMAMIFTIIMVAICF 95
           GW   A +F I  + +  
Sbjct: 84 HGW---ANVFMITGIFVTV 99


>gi|255028385|ref|ZP_05300336.1| hypothetical protein LmonL_02601 [Listeria monocytogenes LO28]
          Length = 71

 Score = 40.9 bits (95), Expect = 0.064,   Method: Composition-based stats.
 Identities = 17/65 (26%), Positives = 31/65 (47%)

Query: 44  LDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103
           L  N+  + I + A  Q  + L+ F+HM+   +    I  ++F   +  +  +GS WVM 
Sbjct: 4   LTTNVKVVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVME 63

Query: 104 HLNNN 108
             + N
Sbjct: 64  IGHMN 68


>gi|312111801|ref|YP_003990117.1| cytochrome C oxidase subunit IV [Geobacillus sp. Y4.1MC1]
 gi|311216902|gb|ADP75506.1| cytochrome c oxidase, subunit IV [Geobacillus sp. Y4.1MC1]
          Length = 110

 Score = 40.5 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F L ++LT+I F  V    F         I+L AI Q++  L +F+HMS K
Sbjct: 25 MKHQVISFTLMILLTLISFFAVGCDKFSHW-FSVPFILLLAIVQVMFQLYYFMHMSHK 81


>gi|322151|pir||F45335 cytochrome-c oxidase (EC 1.9.3.1) chain IVb - Bacillus firmus
 gi|142789|gb|AAA22367.1| cytochrome oxidase subunit IV [Bacillus firmus]
          Length = 114

 Score = 40.5 bits (94), Expect = 0.072,   Method: Composition-based stats.
 Identities = 22/79 (27%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           ++ +V F L + LT++ F  V       ++     I + A+ Q  + L FF+HM  K +
Sbjct: 26 IRKQIVAFALMIFLTLMSFMAVATDVI-PRSFAIPFIFILAVIQFALQLFFFMHMKDK-D 83

Query: 77 DGWSIMAMIFTIIMVAICF 95
           GW   A  F I  + I  
Sbjct: 84 HGW---ANAFMISGIFITV 99


>gi|23098895|ref|NP_692361.1| cytochrome c oxidase subunit IV [Oceanobacillus iheyensis HTE831]
 gi|22777122|dbj|BAC13396.1| cytochrome c oxidase subunit IV (aa3 type) [Oceanobacillus
           iheyensis HTE831]
          Length = 106

 Score = 40.5 bits (94), Expect = 0.087,   Method: Composition-based stats.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 4/86 (4%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K+ +V F L +  T+I F  VM    +DK  +   +++ A+ QI     +F+HM  K +
Sbjct: 22  MKKQIVTFALMIFFTLIAFFAVM--LEIDKMFVIPLLLILAVVQIAFQFFYFMHM--KDK 77

Query: 77  DGWSIMAMIFTIIMVAICFVGSMWVM 102
                  +I+  I V +  + +  V+
Sbjct: 78  GHEVPSQIIYGGIFVTMLVILTFTVI 103


>gi|239636439|ref|ZP_04677441.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus warneri
           L37603]
 gi|239597794|gb|EEQ80289.1| cytochrome aa3 quinol oxidase, subunit IV [Staphylococcus warneri
           L37603]
          Length = 96

 Score = 40.1 bits (93), Expect = 0.098,   Method: Composition-based stats.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 16  TKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKV 75
           T  +  VGFI S++LT++   + +      +  +   I   A  Q  + L+ F+H++   
Sbjct: 3   TIVKHTVGFIASIVLTLLAVFVTLYTSMTFQAKVT-IIFGFAFIQAALQLLMFMHLTEGK 61

Query: 76  EDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +    +  +IF II+  I  +G+ WVM
Sbjct: 62  DGRVQLFKVIFAIIITLIIVIGTYWVM 88


>gi|222150985|ref|YP_002560138.1| hypothetical protein MCCL_0735 [Macrococcus caseolyticus JCSC5402]
 gi|222120107|dbj|BAH17442.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 115

 Score = 40.1 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 8/82 (9%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           +  F + + LT + F +V  G  L K  +   ++L A+ Q+I+   +F+HM  K      
Sbjct: 30  VTTFAIMIFLTFVAFAMVAAG--LSKEFVIPAVLLLALIQVILQFYYFMHMKHKGHGTAQ 87

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
           +       ++  +   GS  VM
Sbjct: 88  LF------MLTGLFIAGSFIVM 103


>gi|294498141|ref|YP_003561841.1| cytochrome c oxidase subunit IV [Bacillus megaterium QM B1551]
 gi|294348078|gb|ADE68407.1| cytochrome c oxidase, subunit IV [Bacillus megaterium QM B1551]
          Length = 110

 Score = 40.1 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 2/58 (3%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  +V F + L LT+I F  V + F      +   IVL A+ Q+I  L +F+HM+ K
Sbjct: 26 MKMQVVSFAMMLFLTLIAFFAVYQEF--SGWYIMPVIVLLAVVQVIFQLYYFMHMNHK 81


>gi|319649711|ref|ZP_08003867.1| CtaF protein [Bacillus sp. 2_A_57_CT2]
 gi|317398873|gb|EFV79555.1| CtaF protein [Bacillus sp. 2_A_57_CT2]
          Length = 111

 Score = 39.7 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK 74
           K  ++ F L + LTI+ F       F    I+   I++ AI Q+I  L +F+HMS K
Sbjct: 26 MKHQVITFALMIFLTIVAFVAAGYEGFSGWFIVP-FILILAIVQVIFQLYYFMHMSHK 82


>gi|288553206|ref|YP_003425141.1| cytochrome caa3 subunit IV [Bacillus pseudofirmus OF4]
 gi|298286795|sp|Q04452|COX4_BACPE RecName: Full=Cytochrome c oxidase subunit 4B; AltName:
          Full=Cytochrome aa3 subunit 4B; AltName:
          Full=Cytochrome c oxidase polypeptide IVB
 gi|288544366|gb|ADC48249.1| cytochrome caa3 subunit IV [Bacillus pseudofirmus OF4]
          Length = 114

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 32/72 (44%), Gaps = 5/72 (6%)

Query: 24 FILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMA 83
          F L + LT++ F  V       ++     I + A+ Q  + L FF+HM  K + GW   A
Sbjct: 33 FALMIFLTLMSFMAVATDVI-PRSFAIPFIFILAVIQFALQLFFFMHMKDK-DHGW---A 87

Query: 84 MIFTIIMVAICF 95
            F I  + I  
Sbjct: 88 NAFMISGIFITV 99


>gi|296331067|ref|ZP_06873541.1| cytochrome c oxidase, subunit IVB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305674222|ref|YP_003865894.1| cytochrome c oxidase, subunit IVB [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151711|gb|EFG92586.1| cytochrome c oxidase, subunit IVB [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305412466|gb|ADM37585.1| cytochrome c oxidase, subunit IVB [Bacillus subtilis subsp.
           spizizenii str. W23]
          Length = 110

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 3/86 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK-- 74
            K  ++ F L + LTI+ F  V          +   I+L AI Q+I  L +F+HM+ K  
Sbjct: 25  MKYQVLSFGLMIGLTIVAFLTVATDGVGSWFTIPFIILLAAI-QVIFQLYYFMHMNQKGH 83

Query: 75  VEDGWSIMAMIFTIIMVAICFVGSMW 100
                 + + +F   +  + FV  +W
Sbjct: 84  EAPAMFLYSGMFVAFITVLAFVTIIW 109


>gi|304405376|ref|ZP_07387035.1| cytochrome C oxidase subunit IV [Paenibacillus curdlanolyticus YK9]
 gi|304345415|gb|EFM11250.1| cytochrome C oxidase subunit IV [Paenibacillus curdlanolyticus YK9]
          Length = 106

 Score = 39.7 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/89 (22%), Positives = 44/89 (49%), Gaps = 1/89 (1%)

Query: 12  HSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHM 71
           H +   ++ +V +I SL+LT+I F  VM G   + + +   +++ A  Q+ V + F++HM
Sbjct: 16  HKHEGPQKHIVAYIFSLLLTLIAFAAVMAGEV-NTSFIIFILLMMAGLQVFVQMGFWMHM 74

Query: 72  STKVEDGWSIMAMIFTIIMVAICFVGSMW 100
             +      I  +   +++  +  +   W
Sbjct: 75  KDRGHLYPIIGILTGVVVVFTMVIMAEYW 103


>gi|149181711|ref|ZP_01860203.1| CtaF [Bacillus sp. SG-1]
 gi|148850559|gb|EDL64717.1| CtaF [Bacillus sp. SG-1]
          Length = 110

 Score = 39.7 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 8/85 (9%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           +V F L + LT++ F  V  GF   K  +   I+L A+ Q+I  L +F+HMS K     +
Sbjct: 30  VVSFALMIFLTLVAFVAVGGGF--SKWFVVPFILLLAVVQLIFQLYYFMHMSHK--GHEA 85

Query: 81  IMAMIFTIIMVAICFVGS----MWV 101
               +++  +VA   V +    +W+
Sbjct: 86  PALFLYSGALVAFITVLTFLTIVWI 110


>gi|212224619|ref|YP_002307855.1| hypothetical membrane protein, conserved [Thermococcus onnurineus
          NA1]
 gi|212009576|gb|ACJ16958.1| hypothetical membrane protein, conserved [Thermococcus onnurineus
          NA1]
          Length = 345

 Score = 39.4 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 17 KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
           K  L+GF++++I  +I  GIV  G      ++   ++      + + L+FF  ++   E
Sbjct: 4  LKAYLIGFLIAVI--VIAAGIVWYGG---WKLLLQVVLALGFLSVTLMLLFFTALTFYAE 58

Query: 77 DGWSI--MAMIFTII 89
            W    +  IFT+I
Sbjct: 59 -SWKYGGILAIFTVI 72


>gi|205373049|ref|ZP_03225855.1| CtaF [Bacillus coahuilensis m4-4]
          Length = 109

 Score = 39.0 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/83 (27%), Positives = 41/83 (49%), Gaps = 4/83 (4%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTK--VEDG 78
           +V F L + LT++ F  V  GF   +  +   I+L A+ Q+I  L +F+HMS K      
Sbjct: 29  VVTFALMIFLTLVAFIAVAGGF--SEWFIFPFILLLAVIQVIFQLYYFMHMSHKGHEAPA 86

Query: 79  WSIMAMIFTIIMVAICFVGSMWV 101
             + +  F   +  + F+  +W+
Sbjct: 87  LFLYSGAFVAFLTVLAFITIVWI 109


>gi|157692165|ref|YP_001486627.1| cytochrome-c oxidase subunit IV [Bacillus pumilus SAFR-032]
 gi|194014575|ref|ZP_03053192.1| cytochrome c oxidase, subunit IV [Bacillus pumilus ATCC 7061]
 gi|157680923|gb|ABV62067.1| cytochrome-c oxidase subunit IV [Bacillus pumilus SAFR-032]
 gi|194013601|gb|EDW23166.1| cytochrome c oxidase, subunit IV [Bacillus pumilus ATCC 7061]
          Length = 109

 Score = 39.0 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 3/80 (3%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            K  L+ F L + LT + F  +      +       I+L A+ Q+   L +F+HM+ K  
Sbjct: 24  MKHQLISFGLMIGLTFVAFLTIASEDVGNW-FAVPFILLLAVIQVAFQLYYFMHMNQK-- 80

Query: 77  DGWSIMAMIFTIIMVAICFV 96
              +    +++ + VA   V
Sbjct: 81  GHETPALFLYSGVFVAFITV 100


>gi|313625762|gb|EFR95395.1| quinol oxidase subunit 4 [Listeria innocua FSL J1-023]
          Length = 62

 Score = 38.6 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 28/59 (47%)

Query: 50  CLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108
            + I + A  Q  + L+ F+HM+   +    I  ++F   +  +  +GS WVM   + N
Sbjct: 1   VVIIFIFAFIQAALQLLMFMHMTEGRDGKIQIGNILFAAFIAIVVVIGSYWVMEIGHMN 59


>gi|196249840|ref|ZP_03148536.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp.
          G11MC16]
 gi|196210716|gb|EDY05479.1| cytochrome aa3 quinol oxidase, subunit IV [Geobacillus sp.
          G11MC16]
          Length = 99

 Score = 38.6 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 20/90 (22%), Positives = 38/90 (42%), Gaps = 7/90 (7%)

Query: 1  MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
          M  +  H      +      L+GF+LSL+LT     + +      K +  + IVL A+ Q
Sbjct: 1  MGTNGHHESFPWKH------LIGFVLSLLLTFAALWVALSSGLPLKAV-IVVIVLFAMIQ 53

Query: 61 IIVHLVFFLHMSTKVEDGWSIMAMIFTIIM 90
            + L  F+H++           M+++  +
Sbjct: 54 ASLQLFMFMHVAESDSGKVQTFNMVYSFFI 83


>gi|323488487|ref|ZP_08093732.1| cytochrome caa3 oxidase (subunit IV) [Planococcus donghaensis
           MPA1U2]
 gi|323397855|gb|EGA90656.1| cytochrome caa3 oxidase (subunit IV) [Planococcus donghaensis
           MPA1U2]
          Length = 110

 Score = 38.6 bits (89), Expect = 0.32,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 17  KKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVE 76
            +  L  F + + LT+I F +V  GF     ++   I+L A  Q+++ L +F+HMS K  
Sbjct: 26  MRGHLATFAIMIFLTLIAFTMVAAGF--SVYLIVPIILLLAGIQVVLQLYYFMHMSGKGH 83

Query: 77  DGWSIMAMIFTIIMVAICFVGS 98
               I   +F+ + VA   V +
Sbjct: 84  GM--IAFFMFSGMFVAFITVLT 103


>gi|253574493|ref|ZP_04851834.1| cytochrome c oxidase subunit 4 [Paenibacillus sp. oral taxon 786
           str. D14]
 gi|251846198|gb|EES74205.1| cytochrome c oxidase subunit 4 [Paenibacillus sp. oral taxon 786
           str. D14]
          Length = 94

 Score = 38.2 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++G++ SLIL+ +   +V   + +   +    +++CA  Q+ V L  F+H+      G  
Sbjct: 10  VMGYVFSLILSAVALSVVF--WDMSFAVGMTILLVCAAVQMSVQLFMFMHIGENRSKGAL 67

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              +++ + +  +   G++  M
Sbjct: 68  YANLVYALFVGLVTVFGTLLTM 89


>gi|52080095|ref|YP_078886.1| cytochrome caa3 oxidase subunit IV [Bacillus licheniformis ATCC
           14580]
 gi|52785469|ref|YP_091298.1| CtaF [Bacillus licheniformis ATCC 14580]
 gi|319646130|ref|ZP_08000360.1| CtaF protein [Bacillus sp. BT1B_CT2]
 gi|52003306|gb|AAU23248.1| cytochrome caa3 oxidase (subunit IV) [Bacillus licheniformis ATCC
           14580]
 gi|52347971|gb|AAU40605.1| CtaF [Bacillus licheniformis ATCC 14580]
 gi|317391880|gb|EFV72677.1| CtaF protein [Bacillus sp. BT1B_CT2]
          Length = 109

 Score = 38.2 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 4/76 (5%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++ F L + LTI+ F  V              I+L A+ Q+   L +F+HM        +
Sbjct: 29  VISFGLMIGLTIVAFLTVASDA--GVWFTVPFILLLAVIQVAFQLYYFMHM--SQRGHEA 84

Query: 81  IMAMIFTIIMVAICFV 96
               +++ ++VA   V
Sbjct: 85  PTLFLYSGVLVAFVTV 100


>gi|261406336|ref|YP_003242577.1| cytochrome aa3 quinol oxidase subunit IV [Paenibacillus sp.
           Y412MC10]
 gi|329922313|ref|ZP_08277990.1| cytochrome aa3 quinol oxidase, subunit IV [Paenibacillus sp. HGF5]
 gi|261282799|gb|ACX64770.1| cytochrome aa3 quinol oxidase, subunit IV [Paenibacillus sp.
           Y412MC10]
 gi|328942176|gb|EGG38447.1| cytochrome aa3 quinol oxidase, subunit IV [Paenibacillus sp. HGF5]
          Length = 95

 Score = 38.2 bits (88), Expect = 0.42,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + G+I SL+L+ +   +++    +        +++ AI Q  V L+ F+H+    +    
Sbjct: 11  VAGYISSLVLSAVALVVLLD---MPAASKVAVLLVTAILQAAVQLMLFMHVGESEDKKSV 67

Query: 81  IMAMIFTIIMVAICFVGSMWV 101
            + + F + +  +   G++++
Sbjct: 68  YINIAFALFVGLVTIFGTLFI 88


>gi|229918525|ref|YP_002887171.1| cytochrome C oxidase subunit IV [Exiguobacterium sp. AT1b]
 gi|229469954|gb|ACQ71726.1| cytochrome C oxidase subunit IV [Exiguobacterium sp. AT1b]
          Length = 104

 Score = 37.8 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 18/76 (23%), Positives = 32/76 (42%), Gaps = 2/76 (2%)

Query: 21 LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
          L+ F + ++LT + FG V              I+  A+ Q+ + L  F+HM+    + W 
Sbjct: 24 LISFAMMILLTFVAFGAVYAELMPVWAAGGFLII-LAVIQVFLQLYIFMHMN-NRGNTWI 81

Query: 81 IMAMIFTIIMVAICFV 96
          +  M   I +  I   
Sbjct: 82 VGMMWLGIFVAIITVA 97


>gi|315646712|ref|ZP_07899828.1| cytochrome aa3 quinol oxidase, subunit IV [Paenibacillus vortex
           V453]
 gi|315277918|gb|EFU41241.1| cytochrome aa3 quinol oxidase, subunit IV [Paenibacillus vortex
           V453]
          Length = 95

 Score = 37.4 bits (86), Expect = 0.65,   Method: Composition-based stats.
 Identities = 14/81 (17%), Positives = 39/81 (48%), Gaps = 3/81 (3%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           + G+I SL+L+ +   +++    +        +++ AI Q  V L+ F+H+    +    
Sbjct: 11  VAGYISSLVLSAVALVVLLD---MPTASKFAILLVTAILQAAVQLMLFMHVGESDDKKSV 67

Query: 81  IMAMIFTIIMVAICFVGSMWV 101
            + + F + +  +   G++++
Sbjct: 68  YINIAFALFVGLVTIFGTLFI 88


>gi|332974251|gb|EGK11183.1| cytochrome c oxidase subunit 4B [Desmospora sp. 8437]
          Length = 101

 Score = 37.0 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 37/75 (49%), Gaps = 3/75 (4%)

Query: 20 CLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGW 79
           +  F++ L+LT + F  V     + ++ +   I+  A  Q+++    F+H+  K E   
Sbjct: 21 YVASFVVMLLLTGLSFAAV-AMNIVPQSWIIPLILALATVQVLMQFFSFMHLHLKKEAV- 78

Query: 80 SIMAMIFTIIMVAIC 94
           I++ +++ + + + 
Sbjct: 79 -IVSFMYSGVFLGLI 92


>gi|255020825|ref|ZP_05292881.1| hypothetical protein ACA_1047 [Acidithiobacillus caldus ATCC 51756]
 gi|254969616|gb|EET27122.1| hypothetical protein ACA_1047 [Acidithiobacillus caldus ATCC 51756]
          Length = 87

 Score = 37.0 bits (85), Expect = 0.80,   Method: Composition-based stats.
 Identities = 16/79 (20%), Positives = 30/79 (37%), Gaps = 1/79 (1%)

Query: 40  KGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSM 99
                    + L I +CA    I  + F LH+     + W+ ++++  I +  +    + 
Sbjct: 9   SSHAAPPFGLLLVITVCAGIATIAQIYFLLHIDISEHNIWNTVSLVAFIPLFVLTIGLTW 68

Query: 100 WVMYHLNNNMM-SMEGMRS 117
           W+   L    M  M GM  
Sbjct: 69  WMFSQLYLRTMPPMPGMHG 87


>gi|126651762|ref|ZP_01723964.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. B14905]
 gi|126591440|gb|EAZ85547.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. B14905]
          Length = 94

 Score = 36.7 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 19/82 (23%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF LS+ILTII     +  F +   I    +++ A  Q  + LV F+H     +    
Sbjct: 10  VMGFALSIILTII--AACVYFFQISMPITMTILLVTAFIQAGLQLVVFMHAGETNDKPAI 67

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              + + +++  +   G++  M
Sbjct: 68  YTNIYYGLVIALVTIFGTLLCM 89


>gi|327441187|dbj|BAK17552.1| heme/copper-type cytochrome/quinol oxidase, subunit 4 [Solibacillus
           silvestris StLB046]
          Length = 114

 Score = 36.7 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/94 (21%), Positives = 38/94 (40%), Gaps = 10/94 (10%)

Query: 11  MHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 70
            H+    ++ +V F + + LT I F  V+  F      +   I+L A  Q+++ L  F+H
Sbjct: 20  EHAKAHMRKQVVNFAIMIFLTFIAFAAVLADFAP--TFIIPIILLLAGVQVVLQLYAFMH 77

Query: 71  MSTKVEDG--------WSIMAMIFTIIMVAICFV 96
           +  +            WS   + FT  +     +
Sbjct: 78  LEDRTTHMVGVIEFFIWSAAFIAFTFFLAFTTII 111


>gi|89099674|ref|ZP_01172548.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. NRRL
           B-14911]
 gi|89085617|gb|EAR64744.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. NRRL
           B-14911]
          Length = 84

 Score = 36.7 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 19/80 (23%), Positives = 38/80 (47%), Gaps = 2/80 (2%)

Query: 23  GFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIM 82
           GF+ SLILT +   +++  F +   +    +V+ A  Q  + LV F+H     + G    
Sbjct: 2   GFVFSLILTAV--ALMVYFFDMSYAVGLTILVITAFIQAALQLVVFMHAGESDDKGTIFT 59

Query: 83  AMIFTIIMVAICFVGSMWVM 102
            + ++I +  +   G++  M
Sbjct: 60  NIYYSIFIALVTVFGTLLTM 79


>gi|126653832|ref|ZP_01725695.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. B14905]
 gi|126589669|gb|EAZ83806.1| cytochrome aa3 quinol oxidase subunit IV [Bacillus sp. B14905]
          Length = 93

 Score = 36.3 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 30/59 (50%)

Query: 44  LDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +   +    +++ A+AQ  V LV F+H+    +       +++++ +  +  +G+++ M
Sbjct: 31  MSYKVAFAILLVTALAQATVQLVLFMHIGESEDKKTLYTTILYSVFVGVVTIIGTLFAM 89


>gi|169829428|ref|YP_001699586.1| cytochrome aa3 quinol oxidase subunit IV [Lysinibacillus sphaericus
           C3-41]
 gi|168993916|gb|ACA41456.1| cytochrome aa3 quinol oxidase subunit IV [Lysinibacillus sphaericus
           C3-41]
          Length = 93

 Score = 35.5 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 10/59 (16%), Positives = 30/59 (50%)

Query: 44  LDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVM 102
           +   +    +++ A+AQ  V LV F+H+    +       +++++ +  +  +G+++ M
Sbjct: 31  MSYKMAFAILLVTALAQATVQLVLFMHIGESEDKKTLYTTILYSVFVGVVTIIGTLFAM 89


>gi|253574579|ref|ZP_04851920.1| cytochrome C oxidase subunit IV [Paenibacillus sp. oral taxon 786
          str. D14]
 gi|251846284|gb|EES74291.1| cytochrome C oxidase subunit IV [Paenibacillus sp. oral taxon 786
          str. D14]
          Length = 106

 Score = 35.5 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 13/65 (20%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 10 NMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFL 69
          +   +   ++ ++ FI S++LT+I     +    ++     + +++ A+ Q++V L +++
Sbjct: 14 HRQRHEGPEKHIIAFIFSIVLTLI-AFAAVAAGGVNTAFTVILLLVMAVLQVLVQLGYWM 72

Query: 70 HMSTK 74
          HM  K
Sbjct: 73 HMKDK 77


>gi|297625015|ref|YP_003706449.1| cytochrome c class I [Truepera radiovictrix DSM 17093]
 gi|297166195|gb|ADI15906.1| cytochrome c class I [Truepera radiovictrix DSM 17093]
          Length = 464

 Score = 35.5 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 13/84 (15%), Positives = 37/84 (44%), Gaps = 14/84 (16%)

Query: 3  YDNIHNMNMH-------SYGTKKQCLVGFILSL--ILTIIPFGIVMKG----FFLDKNIM 49
          +   H  + H       ++G+     + F+  +  I+T I F +V        ++ +  +
Sbjct: 2  HKPEHETSPHKPEGHPEAHGSSVGFYI-FVAVVLAIITYIEFALVEHQETWFAWMSRPWL 60

Query: 50 CLTIVLCAIAQIIVHLVFFLHMST 73
             +V+ +  + ++ ++FF+H+  
Sbjct: 61 FFWLVVLSAIKFLMVVMFFMHLKQ 84


>gi|327439286|dbj|BAK15651.1| heme/copper-type cytochrome/quinol oxidase, subunit 4 [Solibacillus
           silvestris StLB046]
          Length = 93

 Score = 35.5 bits (81), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/82 (19%), Positives = 41/82 (50%), Gaps = 2/82 (2%)

Query: 21  LVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWS 80
           ++GF+ SLILT+I   +++    +      + +++ A  Q  +  + F+H     +    
Sbjct: 10  IMGFVFSLILTVI--AMLVYFTDMSFTTGMVILLVTAFIQAGLQFIVFMHAGETNDKWAI 67

Query: 81  IMAMIFTIIMVAICFVGSMWVM 102
              +++ I +V +  +GS+ ++
Sbjct: 68  YSNIVYGIGLVVLTVLGSLLIL 89


>gi|78221313|ref|YP_383060.1| 2-acyl-glycerophospho-ethanolamine acyltransferase [Geobacter
           metallireducens GS-15]
 gi|78192568|gb|ABB30335.1| AMP-dependent synthetase and ligase [Geobacter metallireducens
           GS-15]
          Length = 1128

 Score = 35.1 bits (80), Expect = 3.2,   Method: Composition-based stats.
 Identities = 15/79 (18%), Positives = 32/79 (40%), Gaps = 1/79 (1%)

Query: 25  ILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM 84
           I ++ LT+  F + M    L   +  + +   +    IV L  F+ +    +    ++A 
Sbjct: 294 IGAVGLTVCSFVLAMMPASLWAVLAVVALFGVSAGLFIVPLQSFIQLRAPADRRGEVLAA 353

Query: 85  -IFTIIMVAICFVGSMWVM 102
             F   +  +   G +WV+
Sbjct: 354 SSFLSWVGVLLASGLLWVL 372


>gi|120435872|ref|YP_861558.1| hypothetical protein GFO_1518 [Gramella forsetii KT0803]
 gi|117578022|emb|CAL66491.1| conserved hypothetical protein, membrane [Gramella forsetii
          KT0803]
          Length = 367

 Score = 34.7 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 14/80 (17%)

Query: 17 KKQCLVGF-ILSLILTIIP-----FGIVMKGFFLDKNIMCLTIVLCAIAQIIVHLVFFLH 7