RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >3b9w_A Ammonium transporter family; membrane protein, ammonia transport, rhesus protein, transport protein; HET: BOG; 1.30A {Nitrosomonas europaea} PDB: 3bhs_A 3b9y_A* 3b9z_A* (A:39-167,A:295-407) Length = 242 Score = 24.8 bits (54), Expect = 3.6 Identities = 10/109 (9%), Positives = 27/109 (24%), Gaps = 17/109 (15%) Query: 21 LVGFILSLILTIIPFGIVMKGF--FLDKNIMCLTIVL-----CAIAQIIVHLVFFLHMST 73 ++ T +P I+++ F + +I + Sbjct: 7 ATTGTYLVVATGLPLYILLRANGIFGHALTPHSVDAVIYAEFAVATGLIAMGAVLGRLRV 66 Query: 74 KVEDGWSIMAMIFTIIMVAICFVGSMWVMYHL---NNNMMSMEGMRSIH 119 + + +V + + V+ + G +IH Sbjct: 67 F-------QYALLALFIVPVYLLNEWLVLDNASGLTEGFQDSAGSIAIH 108 >3ddh_A Putative haloacid dehalogenase-like family hydrolase; HAD superfamily, structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} (A:20-104) Length = 85 Score = 24.6 bits (54), Expect = 4.5 Identities = 7/26 (26%), Positives = 12/26 (46%), Gaps = 5/26 (19%) Query: 8 NMNMHSYGTKKQCLVGFILSLILTII 33 N+ + YG K F +S + T + Sbjct: 38 NLQILGYGAK-----AFTISXVETAL 58 >3hd6_A Ammonium transporter RH type C; ammonia, channel, rhesus, glycoprotein, membrane, structural genomics, PSI-2, protein structure initiative; HET: BOG; 2.10A {Homo sapiens} (A:1-245,A:344-490) Length = 392 Score = 24.2 bits (52), Expect = 6.5 Identities = 6/67 (8%), Positives = 15/67 (22%), Gaps = 3/67 (4%) Query: 49 MCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNN 108 + C + + +S IM + F+ + Sbjct: 129 NLINADFCVASVCVAFGAVLGKVSPI---QLLIMTFFQVTLFAVNEFILLNLLKVKDAGG 185 Query: 109 MMSMEGM 115 M++ Sbjct: 186 SMTIHTF 192 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.336 0.143 0.457 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 891,687 Number of extensions: 33349 Number of successful extensions: 162 Number of sequences better than 10.0: 1 Number of HSP's gapped: 157 Number of HSP's successfully gapped: 35 Length of query: 119 Length of database: 4,956,049 Length adjustment: 71 Effective length of query: 48 Effective length of database: 2,555,894 Effective search space: 122682912 Effective search space used: 122682912 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 50 (23.3 bits)