RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreductase, blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Length = 291 Score = 25.3 bits (55), Expect = 3.2 Identities = 13/95 (13%), Positives = 25/95 (26%), Gaps = 12/95 (12%) Query: 20 CLVGFILSLILTIIPFGIVMKGFFLDKNIMC-----------LTIVLCAIAQIIVHLVFF 68 +G +L+ LT F + L I A+ + V Sbjct: 27 AGLGSLLTAYLTYTKLTEQ-PAAFCTGDGGSDLVLSSRWAEFLGIPTAAVGLLGFLGVLA 85 Query: 69 LHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMY 103 L + +V+ M+++Y Sbjct: 86 LAVLPDGLPLVKRWRWPALFGLVSAMTAFEMYMLY 120 >2owo_A DNA ligase; protein/DNA complex, ligase/DNA complex; HET: DNA OMC AMP; 2.30A {Escherichia coli K12} Length = 671 Score = 24.0 bits (51), Expect = 7.7 Identities = 9/65 (13%), Positives = 18/65 (27%) Query: 55 LCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEG 114 L AQ L F+ DG + + + ++ + + G Sbjct: 430 LICGAQRKESLKHFVSRRAMDVDGMGDKIIDQLVEKEYVHTPADLFKLTAGKLTGLERMG 489 Query: 115 MRSIH 119 +S Sbjct: 490 PKSAQ 494 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.336 0.143 0.457 Gapped Lambda K H 0.267 0.0455 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,021,024 Number of extensions: 39808 Number of successful extensions: 235 Number of sequences better than 10.0: 1 Number of HSP's gapped: 231 Number of HSP's successfully gapped: 30 Length of query: 119 Length of database: 5,693,230 Length adjustment: 80 Effective length of query: 39 Effective length of database: 3,753,710 Effective search space: 146394690 Effective search space used: 146394690 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 50 (23.7 bits)