RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter asiaticus str. psy62] (119 letters) >d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 Score = 23.9 bits (51), Expect = 4.0 Identities = 5/65 (7%), Positives = 14/65 (21%) Query: 45 DKNIMCLTIVLCAIAQIIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYH 104 + + L + H + G ++ + + W H Sbjct: 54 KAVTVDIYNQLTEETTLHWHGLEVPGEVDGGPQGIIPPGGKRSVTLNVDQPAATCWFHPH 113 Query: 105 LNNNM 109 + Sbjct: 114 QHGKT 118 >d1okia2 b.11.1.1 (A:145-236) beta-Crystallin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Score = 22.8 bits (49), Expect = 9.6 Identities = 6/28 (21%), Positives = 12/28 (42%) Query: 76 EDGWSIMAMIFTIIMVAICFVGSMWVMY 103 +D S+ F+ + ++ WV Y Sbjct: 24 DDAPSLWVYGFSDRVGSVKVSSGTWVGY 51 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.336 0.143 0.457 Gapped Lambda K H 0.267 0.0630 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 442,989 Number of extensions: 17157 Number of successful extensions: 73 Number of sequences better than 10.0: 1 Number of HSP's gapped: 71 Number of HSP's successfully gapped: 18 Length of query: 119 Length of database: 2,407,596 Length adjustment: 74 Effective length of query: 45 Effective length of database: 1,391,576 Effective search space: 62620920 Effective search space used: 62620920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 47 (22.1 bits)