BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase
subunit IV [Candidatus Liberibacter asiaticus str. psy62]
         (119 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780471|ref|YP_003064884.1| cytochrome o ubiquinol oxidase subunit IV [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 119

 Score =  239 bits (610), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%)

Query: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60
           MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ
Sbjct: 1   MKYDNIHNMNMHSYGTKKQCLVGFILSLILTIIPFGIVMKGFFLDKNIMCLTIVLCAIAQ 60

Query: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119
           IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH
Sbjct: 61  IIVHLVFFLHMSTKVEDGWSIMAMIFTIIMVAICFVGSMWVMYHLNNNMMSMEGMRSIH 119


>gi|254780843|ref|YP_003065256.1| glucose/galactose transporter [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 420

 Score = 23.9 bits (50), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 54  VLCAIAQIIVHLVFFLHMSTKVEDGWSIMAM-IFTIIMVAICF 95
            LCA A     LV     +T    GWS++A+ +F  IM    F
Sbjct: 304 TLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIF 346


>gi|254780504|ref|YP_003064917.1| glucose-6-phosphate 1-dehydrogenase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 492

 Score = 22.3 bits (46), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/57 (19%), Positives = 25/57 (43%), Gaps = 9/57 (15%)

Query: 60  QIIVHLVFFLHMSTKVEDGWSIMAMIFTI---------IMVAICFVGSMWVMYHLNN 107
           Q  + L+F++++  +   GW ++  +  I         + ++  F G +    H NN
Sbjct: 83  QKFLSLIFYINLDVEKNYGWELLGKLLDIDKTRIRVFYLAMSSAFFGKISQRIHANN 139


>gi|254780502|ref|YP_003064915.1| ribonucleotide-diphosphate reductase subunit alpha [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 954

 Score = 21.9 bits (45), Expect = 3.4,   Method: Composition-based stats.
 Identities = 8/26 (30%), Positives = 15/26 (57%)

Query: 92  AICFVGSMWVMYHLNNNMMSMEGMRS 117
           A+C +GS+ ++ H  NN    + + S
Sbjct: 598 AVCNLGSINLLAHFANNQFDYDKLAS 623


>gi|254780488|ref|YP_003064901.1| adenosylmethionine--8-amino-7-oxononanoate transaminase [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 423

 Score = 21.6 bits (44), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 7/13 (53%), Positives = 9/13 (69%)

Query: 35  FGIVMKGFFLDKN 47
           F +  KG+F DKN
Sbjct: 361 FNVQNKGYFFDKN 373


>gi|255764465|ref|YP_003064775.2| Na+/H+ antiporter NhaA [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 382

 Score = 21.6 bits (44), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 13/22 (59%)

Query: 14  YGTKKQCLVGFILSLILTIIPF 35
           YG    C +GF +SL LT+  F
Sbjct: 325 YGGSILCGIGFTMSLFLTLQAF 346


>gi|254780427|ref|YP_003064840.1| hypothetical protein CLIBASIA_01560 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 171

 Score = 21.2 bits (43), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 8/25 (32%), Positives = 17/25 (68%)

Query: 37 IVMKGFFLDKNIMCLTIVLCAIAQI 61
          ++ KG+F+ +NI+ L++V     +I
Sbjct: 43 LISKGYFVKENIVELSLVFTDSHRI 67


>gi|254780342|ref|YP_003064755.1| substrate-binding region of ABC-type glycine betaine transport
           system [Candidatus Liberibacter asiaticus str. psy62]
          Length = 309

 Score = 20.8 bits (42), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 8/23 (34%), Positives = 14/23 (60%)

Query: 97  GSMWVMYHLNNNMMSMEGMRSIH 119
           G+  ++  +NNN  S++G R I 
Sbjct: 151 GNQRILDMINNNKFSLKGFRLIE 173


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.336    0.143    0.457 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 76,381
Number of Sequences: 1233
Number of extensions: 2707
Number of successful extensions: 20
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 6
Number of HSP's gapped (non-prelim): 14
length of query: 119
length of database: 328,796
effective HSP length: 64
effective length of query: 55
effective length of database: 249,884
effective search space: 13743620
effective search space used: 13743620
T: 11
A: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.7 bits)
S2: 33 (17.3 bits)