RPSBLAST alignment of GI: 254780473 and SCOP domain: d1ffta_

Alignment
>d1ffta_ f.24.1.1 (A:) Cytochrome O ubiquinol oxidase, subunit I {Escherichia coli [TaxId: 562]} Length = 501
 Score =  403 bits (1037), Expect = e-113
 Identities = 348/501 (69%), Positives = 413/501 (82%)

Query: 62  VDHKKIGIMYIILSLVMLFRGFADAIMMRLQQAIASGGGEGYLDAHHYDQIFTAHGVIMI 121
           VDHK++GIMYII+++VML RGFADAIMMR QQA+AS G  G+L  HHYDQIFTAHGVIMI
Sbjct: 1   VDHKRLGIMYIIVAIVMLLRGFADAIMMRSQQALASAGEAGFLPPHHYDQIFTAHGVIMI 60

Query: 122 FFVAMPMITGIMNFVVPLQIGARDVSFPFLNNFSFWMTVAGAVVIMCSLFIGEFASVGWL 181
           FFVAMP + G+MN VVPLQIGARDV+FPFLNN SFW TV G +++  SL +GEFA  GWL
Sbjct: 61  FFVAMPFVIGLMNLVVPLQIGARDVAFPFLNNLSFWFTVVGVILVNVSLGVGEFAQTGWL 120

Query: 182 AYPPLSGISYSPGVGVDYYIWGLQIAGIGTTLSGINLVVTIIKMRCPGMTMMKMPVFVWT 241
           AYPPLSGI YSPGVGVDY+IW LQ++GIGTTL+GIN  VTI+KMR PGMTM KMPVF W 
Sbjct: 121 AYPPLSGIEYSPGVGVDYWIWSLQLSGIGTTLTGINFFVTILKMRAPGMTMFKMPVFTWA 180

Query: 242 AFCSNIMIIAAFPILTATLFLLTLDRYIGTNFFTNHLGGNPMMYINLIWIWGHPEVYILV 301
           + C+N++IIA+FPILT T+ LLTLDRY+GT+FFTN +GGN MMYINLIW WGHPEVYIL+
Sbjct: 181 SLCANVLIIASFPILTVTVALLTLDRYLGTHFFTNDMGGNMMMYINLIWAWGHPEVYILI 240

Query: 302 LPAFGIFSEVVATFSGKRLFGYNSMVYATLAITILSYTVWLHHFFTMGSGANVNAFFGIM 361
           LP FG+FSE+ ATFS KRLFGY S+V+AT+ IT+LS+ VWLHHFFTMG+GANVNAFFGI 
Sbjct: 241 LPVFGVFSEIAATFSRKRLFGYTSLVWATVCITVLSFIVWLHHFFTMGAGANVNAFFGIT 300

Query: 362 TMVIAVPTGAKIFNWLFTMRLGKVRFEVPMMWTLGFMITFLIGGMTGVLLAVPPADFTLH 421
           TM+IA+PTG KIFNWLFTM  G++ F   M+WT+GF++TF +GGMTGVLLAVP ADF LH
Sbjct: 301 TMIIAIPTGVKIFNWLFTMYQGRIVFHSAMLWTIGFIVTFSVGGMTGVLLAVPGADFVLH 360

Query: 422 NSLFLVAHFHNTIIGGVVFGLFAGIVYWFPKAFGYQLNSFWGKVSFWCWFVGFYLAFMPL 481
           NSLFL+AHFHN IIGGVVFG FAG+ YW+PKAFG++LN  WGK +FW W +GF++AFMPL
Sbjct: 361 NSLFLIAHFHNVIIGGVVFGCFAGMTYWWPKAFGFKLNETWGKRAFWFWIIGFFVAFMPL 420

Query: 482 YALGLKGVTRRLSQYEDTTLQVYYVVALLGAVLIGIGVFSFVLSFIVSFLNRSKLQDTIG 541
           YALG  G+TRRLSQ  D       ++A  GAVLI +G+   V+   VS  +R + +D  G
Sbjct: 421 YALGFMGMTRRLSQQIDPQFHTMLMIAASGAVLIALGILCLVIQMYVSIRDRDQNRDLTG 480

Query: 542 DPWDGRTLEWSISSPSPQYNF 562
           DPW GRTLEW+ SSP P YNF
Sbjct: 481 DPWGGRTLEWATSSPPPFYNF 501

SCOP domain information

class: Membrane and cell surface proteins and peptides
fold: Cytochrome c oxidase subunit I-like
superfamily: Cytochrome c oxidase subunit I-like
family: Cytochrome c oxidase subunit I-like
domain: Cytochrome O ubiquinol oxidase, subunit I
species: Escherichia coli [TaxId: 562]