HHsearch alignment for GI: 254780475 and conserved domain: COG0267

>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis].
Probab=99.82  E-value=7.4e-21  Score=129.59  Aligned_cols=48  Identities=44%  Similarity=0.549  Sum_probs=47.1

Q ss_pred             EEEEEEEECCCCCCEEEEECCCCCCCCEEEEEECCCCCCCEEEEEEEE
Q ss_conf             269999951778875983548899833369941317446344668865
Q gi|254780475|r    6 TIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGK   53 (55)
Q Consensus         6 r~~I~L~st~~tg~~Y~T~knk~~~~~klel~Ky~p~~~kHvl~~E~K   53 (55)
T Consensus         3 r~ki~L~ct~c~g~nY~t~kN~r~~~~rLelkKycp~~~khtlhkE~K   50 (50)
T COG0267           3 RVKIKLACTACTSRNYTTTKNKRNKPERLELKKYCPVCRKHTLHKETK   50 (50)
T ss_pred             CCEEEEEEECCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEEEECC
T ss_conf             516999974468712898652678953177970185456377773049