HHsearch results for GI: 254780475 and protein with PDBid: 2j01_6

>2j01_6 50S ribosomal protein L33; ribosome, tRNA, paromomycin, mRNA, translation; 2.8A {Thermus thermophilus} SCOP: g.41.8.6 PDB: 2hgq_5 2hgj_5 2hgu_5 2j03_6 2jl6_6 2jl8_6 2v47_6 2v49_6 2wdi_6 2wdj_6 2wdl_6 2wdn_6 2wh2_6 2wh4_6 2wrj_6 2wrl_6 2wro_6 2wrr_6 2x9s_6 2x9u_6 ...
Probab=99.85  E-value=2e-23  Score=141.93  Aligned_cols=54  Identities=37%  Similarity=0.442  Sum_probs=53.3

Q ss_pred             CCCCCEEEEEEEECCCCCCEEEEECCCCCCCCEEEEEECCCCCCCEEEEEEEEE
Q ss_conf             987762699999517788759835488998333699413174463446688650
Q gi|254780475|r    1 MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKI   54 (55)
Q Consensus         1 MaK~~r~~I~L~st~~tg~~Y~T~knk~~~~~klel~Ky~p~~~kHvl~~E~Ki   54 (55)
                      ||++.|+.|.|+|++|++++|+|+||++|+|+||||+||||+|++||+|+|+||
T Consensus         1 Ma~~~R~~I~L~Ctec~~rnY~T~KNkrn~p~rLelkKycp~c~kHt~hkE~Ki   54 (54)
T 2j01_6            1 MASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI   54 (54)
T ss_dssp             --------CCCCCCCTTSCCCCCCCCCTTSSCSSCCCCCCCSSSCCCCCCCC--
T ss_pred             CCCCCEEEEEEEECCCCCCCCEECCCCCCCCCEEEEECCCCCCCCEEEEEEEEC
T ss_conf             987753069999578778882497767889760579661878897434755019