PSIBLAST alignment of GI: 254780475 and protein with PDB id: 1nwx

gi|29726813|pdb|1NWX|1 Chain 1, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Abt-773 Length = 55
>gi|29726844|pdb|1NWY|1 Chain 1, Complex Of The Large Ribosomal Subunit From Deinococcus Radiodurans With Azithromycin Length = 55
 Score = 75.3 bits (185), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 28/55 (50%), Positives = 35/55 (63%), Gaps = 1/55 (1%)

Query: 1  MAK-AATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKI 54
          MAK    I +K+ SSAGTG +Y T KN R    K+   KYDPV +KHV F+E K+
Sbjct: 1  MAKDGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKKV 55