PSIBLAST alignment of GI: 254780475 and protein with PDB id: 3pyo

>gi|322812600|pdb|3PYO|3 Chain 3, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The First 70s Ribosome. Length = 44
>gi|322812653|pdb|3PYR|3 Chain 3, Crystal Structure Of A Complex Containing Domain 3 From The Psiv Igr Ires Rna Bound To The 70s Ribosome. This File Contains The 50s Subunit Of The Second 70s Ribosome. Length = 44
 Score = 63.3 bits (154), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 18/41 (43%)

Query: 11 LISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKE 51
          L  +      Y T+KN R    K+   KY P  RKH   +E
Sbjct: 3  LECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHRE 43