RPSBLAST alignment for GI: 254780475 and conserved domain: KOG3505

>gnl|CDD|38715 KOG3505, KOG3505, KOG3505, Mitochondrial/chloroplast ribosomal protein L33-like [Translation, ribosomal structure and biogenesis]. Length = 55
 Score = 36.9 bits (85), Expect = 0.001
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 3  KAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKIK 55
          K   + I+L+S+AGTG FYV  +    ++ K+   KYDPV+++HV F E K+K
Sbjct: 5  KKKNMLIRLVSTAGTGFFYVKSRKK--LAEKLTFRKYDPVVKRHVLFTEQKMK 55