RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780475|ref|YP_003064888.1| 50S ribosomal protein L33 [Candidatus Liberibacter asiaticus str. psy62] (55 letters) >gnl|CDD|144167 pfam00471, Ribosomal_L33, Ribosomal protein L33. Length = 48 Score = 56.7 bits (138), Expect = 1e-09 Identities = 18/48 (37%), Positives = 22/48 (45%) Query: 6 TIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGK 53 +KI L + G Y T KN R ++ KY P RKH KE K Sbjct: 1 RVKITLECTECGGRNYTTTKNKRNTPERLELKKYCPKCRKHTLHKETK 48 >gnl|CDD|30616 COG0267, RpmG, Ribosomal protein L33 [Translation, ribosomal structure and biogenesis]. Length = 50 Score = 47.5 bits (113), Expect = 7e-07 Identities = 21/47 (44%), Positives = 25/47 (53%) Query: 7 IKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGK 53 +KIKL +A T Y T KN R ++ KY PV RKH KE K Sbjct: 4 VKIKLACTACTSRNYTTTKNKRNKPERLELKKYCPVCRKHTLHKETK 50 >gnl|CDD|38715 KOG3505, KOG3505, KOG3505, Mitochondrial/chloroplast ribosomal protein L33-like [Translation, ribosomal structure and biogenesis]. Length = 55 Score = 36.9 bits (85), Expect = 0.001 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (3%) Query: 3 KAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKIK 55 K + I+L+S+AGTG FYV + ++ K+ KYDPV+++HV F E K+K Sbjct: 5 KKKNMLIRLVSTAGTGFFYVKSRKK--LAEKLTFRKYDPVVKRHVLFTEQKMK 55 >gnl|CDD|36416 KOG1202, KOG1202, KOG1202, Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism]. Length = 2376 Score = 25.7 bits (56), Expect = 2.7 Identities = 9/34 (26%), Positives = 20/34 (58%) Query: 1 MAKAATIKIKLISSAGTGSFYVTKKNSRTMSGKM 34 + K +K+++ G+G+F + + S +SGK+ Sbjct: 929 LPKTGVVKLEVNLFPGSGAFEICENGSLVVSGKI 962 >gnl|CDD|177033 CHL00104, rpl33, ribosomal protein L33. Length = 66 Score = 24.9 bits (55), Expect = 4.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Query: 19 SFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGK 53 S Y+T+KN ++ K+ P KH KE K Sbjct: 31 SRYITQKNRHNTPNRLELKKFCPYCYKHTIHKEIK 65 >gnl|CDD|119423 cd05163, TRRAP, TRansformation/tRanscription domain-Associated Protein (TRRAP), pseudokinase domain; The TRRAP catalytic domain is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. TRRAP shows some similarity to members of the phosphoinositide 3-kinase-related protein kinase (PIKK) subfamily in that it contains a FATC (FRAP, ATM and TRRAP, C-terminal) domain and has a large molecular weight. Unlike PIKK proteins, however, it contains an inactive PI3K-like pseudokinase domain, which lacks the conserved residues necessary for ATP binding and catalytic activity. TRRAP also contains many motifs that may be critical for protein-protein interactions. TRRAP is a common component of many histone acetyltransferase (HAT) complexes, and is responsible for the recruitment of these complexes to chromatin during transcription, replication, and DNA repair. TRRAP also exists in non-HAT complexes such as the p400 and MRN complexes, which are implicated in ATP-dependent remodeling and DNA repair, respectively.. Length = 253 Score = 24.9 bits (55), Expect = 5.5 Identities = 8/33 (24%), Positives = 15/33 (45%) Query: 10 KLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPV 42 K+ S TG+ Y + + K + + +PV Sbjct: 165 KIFISRDTGNVYQSDLLPSINNNKPLFHNNEPV 197 >gnl|CDD|143493 cd06819, PLPDE_III_LS_D-TA, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase. Low specificity D-threonine aldolase (Low specificity D-TA, EC 4.3.1.18), encoded by dtaAS gene from Arthrobacter sp. strain DK-38, is the prototype of this subfamily. Low specificity D-TAs are fold type III PLP-dependent enzymes that catalyze the interconversion between D-threonine/D-allo-threonine and glycine plus acetaldehyde. Both PLP and divalent cations (eg. Mn2+) are required for catalytic activity. Members of this subfamily show similarity to bacterial alanine racemase (AR), which contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain. AR exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Based on its similarity to AR, it is possible that low specificity D-TAs also form dimers in solution. Experimental data show that the monomeric form of low specificity D-TAs exhibit full catalytic activity. Length = 358 Score = 24.1 bits (53), Expect = 8.6 Identities = 5/21 (23%), Positives = 13/21 (61%) Query: 3 KAATIKIKLISSAGTGSFYVT 23 +AA + ++++ GTG++ Sbjct: 200 EAAGLPCEIVTGGGTGTYEFE 220 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.127 0.338 Gapped Lambda K H 0.267 0.0773 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 562,432 Number of extensions: 18856 Number of successful extensions: 38 Number of sequences better than 10.0: 1 Number of HSP's gapped: 37 Number of HSP's successfully gapped: 10 Length of query: 55 Length of database: 6,263,737 Length adjustment: 28 Effective length of query: 27 Effective length of database: 5,658,685 Effective search space: 152784495 Effective search space used: 152784495 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.0 bits)