RPSBLAST alignment of GI: 254780475 and MMDB domain: 2zjr_1_

>2zjr_1 (1:) 50S ribosomal protein L33; ribosome, large ribosomal subunit, ribonucleoprotein, RNA-binding, rRNA-binding, tRNA-binding, methylation; 2.91A {Deinococcus radiodurans}Length = 55
 Score = 59.2 bits (144), Expect = 2e-10
 Identities = 25/52 (48%), Positives = 32/52 (61%)

Query: 3  KAATIKIKLISSAGTGSFYVTKKNSRTMSGKMVKNKYDPVIRKHVEFKEGKI 54
              I +K+ SSAGTG +Y T KN R    K+   KYDPV +KHV F+E K+
Sbjct: 4  DGPRIIVKMESSAGTGFYYTTTKNRRNTQAKLELKKYDPVAKKHVVFREKKV 55