HHsearch alignment for GI: 254780476 and conserved domain: CHL00148

>CHL00148 orf27 Ycf27; Reviewed.
Probab=99.97  E-value=6.9e-30  Score=192.46  Aligned_cols=119  Identities=24%  Similarity=0.490  Sum_probs=113.7

Q ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHCCCCCCCCEE
Q ss_conf             98778995399899999999999789899998897999999982799899995041296959999999828576899599
Q gi|254780476|r    1 MLKKVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLEITKQIKEDSELQEIPVI   80 (123)
Q Consensus         1 m~kkiLiVDD~~~~~~~l~~~l~~~g~~v~~a~~g~eal~~l~~~~~dlillD~~mp~~dG~el~~~ir~~~~~~~ipii   80 (123)
T Consensus         5 ~k~kILiVEDd~~l~~~l~~~L~~~G~~v~~a~~g~~a~~~~~~~~~DlviLDi~LP~~dG~~l~~~iR~~---~~~PII   81 (240)
T CHL00148          5 SKEKILVVDDEASIRRILETRLSIIGYEVITASDGEEALKLFHQEQPDLVILDVMMPKLDGYGVCQEIRKE---SDVPII   81 (240)
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCEEEEECCCCCCCCCEEEECCCCC---CCCCEE
T ss_conf             99829999398999999999999789999998999999999974799999997999988866305414037---995489


Q ss_pred             EEEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHC
Q ss_conf             999249989999999769988998798989999999997403
Q gi|254780476|r   81 AVTAFAMKGDEERIRKGGCEAYISKPISLSIFMETIKKYIGE  122 (123)
Q Consensus        81 ~~t~~~~~~~~~~~~~~g~~~~l~KPi~~~~L~~~i~~~l~~  122 (123)
T Consensus        82 ~LTa~~~~~d~v~gl~~GADDYi~KPf~~~EL~aRi~allrr  123 (240)
T CHL00148         82 MLTALGDVSDRITGLELGADDYVVKPFSPKELEARIRSVLRR  123 (240)
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             981678989999999769978952784479999999999866